PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2020-07-03
Number of transmembrane proteins: 5146 (alpha: 4654 , beta: 460 )
Content of 6nr2
HEADER    TRANSPORT PROTEIN                       22-JAN-19   6NR2              
TITLE CRYO-EM STRUCTURE OF THE TRPM8 ION CHANNEL IN COMPLEX WITH THE MENTHOL
TITLE 2 ANALOG WS-12 AND PI(4,5)P2
COMPND MOL_ID: 1;
COMPND 2 MOLECULE: TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL SUBFAMILY M
COMPND 3 MEMBER 8;
COMPND 4 CHAIN: A, B, C, D;
COMPND 5 ENGINEERED: YES;
COMPND 6 MUTATION: YES
SOURCE MOL_ID: 1;
SOURCE 2 ORGANISM_SCIENTIFIC: FICEDULA ALBICOLLIS;
SOURCE 3 ORGANISM_COMMON: COLLARED FLYCATCHER;
SOURCE 4 ORGANISM_TAXID: 59894;
SOURCE 5 GENE: TRPM8;
SOURCE 6 EXPRESSION_SYSTEM: HOMO SAPIENS;
SOURCE 7 EXPRESSION_SYSTEM_TAXID: 9606
REMARK 2
REMARK 2 RESOLUTION. 4.00 ANGSTROMS.
REMARK 3
REMARK 3 REFINEMENT.
REMARK 3 SOFTWARE PACKAGES : RELION, EPU, RELION, GCTF, COOT,
REMARK 3 RELION, RELION, RELION, PHENIX
REMARK 3 RECONSTRUCTION SCHEMA : NULL
REMARK 3
REMARK 3 EM MAP-MODEL FITTING AND REFINEMENT
REMARK 3 PDB ENTRY : 6BPQ
REMARK 3 REFINEMENT SPACE : REAL
REMARK 3 REFINEMENT PROTOCOL : RIGID BODY FIT
REMARK 3 REFINEMENT TARGET : NULL
REMARK 3 OVERALL ANISOTROPIC B VALUE : 100.000
REMARK 3
REMARK 3 FITTING PROCEDURE : NULL
REMARK 3
REMARK 3 EM IMAGE RECONSTRUCTION STATISTICS
REMARK 3 NOMINAL PIXEL SIZE (ANGSTROMS) : NULL
REMARK 3 ACTUAL PIXEL SIZE (ANGSTROMS) : NULL
REMARK 3 EFFECTIVE RESOLUTION (ANGSTROMS) : 4.000
REMARK 3 NUMBER OF PARTICLES : 46940
REMARK 3 CTF CORRECTION METHOD : PHASE FLIPPING AND AMPLITUDE
REMARK 3 CORRECTION
REMARK 3
REMARK 3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL
REMARK 3
REMARK 3 OTHER DETAILS: NULL
REMARK 4
REMARK 4 6NR2 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11
REMARK 100
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 23-JAN-19.
REMARK 100 THE DEPOSITION ID IS D_1000239256.
REMARK 245
REMARK 245 EXPERIMENTAL DETAILS
REMARK 245 RECONSTRUCTION METHOD : SINGLE PARTICLE
REMARK 245 SPECIMEN TYPE : NULL
REMARK 245
REMARK 245 ELECTRON MICROSCOPE SAMPLE
REMARK 245 SAMPLE TYPE : PARTICLE
REMARK 245 PARTICLE TYPE : POINT
REMARK 245 NAME OF SAMPLE : TRANSIENT RECEPTOR POTENTIAL
REMARK 245 MELASTATIN MEMBER 8
REMARK 245 SAMPLE CONCENTRATION (MG ML-1) : 0.50
REMARK 245 SAMPLE SUPPORT DETAILS : 15 MA
REMARK 245 SAMPLE VITRIFICATION DETAILS : NULL
REMARK 245 SAMPLE BUFFER : NULL
REMARK 245 PH : 8.00
REMARK 245 SAMPLE DETAILS : NULL
REMARK 245
REMARK 245 DATA ACQUISITION
REMARK 245 DATE OF EXPERIMENT : NULL
REMARK 245 NUMBER OF MICROGRAPHS-IMAGES : 4006
REMARK 245 TEMPERATURE (KELVIN) : NULL
REMARK 245 MICROSCOPE MODEL : FEI TITAN KRIOS
REMARK 245 DETECTOR TYPE : FEI FALCON III (4K X 4K)
REMARK 245 MINIMUM DEFOCUS (NM) : 1250.00
REMARK 245 MAXIMUM DEFOCUS (NM) : 3000.00
REMARK 245 MINIMUM TILT ANGLE (DEGREES) : NULL
REMARK 245 MAXIMUM TILT ANGLE (DEGREES) : NULL
REMARK 245 NOMINAL CS : 2.70
REMARK 245 IMAGING MODE : BRIGHT FIELD
REMARK 245 ELECTRON DOSE (ELECTRONS NM**-2) : 42.00
REMARK 245 ILLUMINATION MODE : FLOOD BEAM
REMARK 245 NOMINAL MAGNIFICATION : 75000
REMARK 245 CALIBRATED MAGNIFICATION : NULL
REMARK 245 SOURCE : FIELD EMISSION GUN
REMARK 245 ACCELERATION VOLTAGE (KV) : 300
REMARK 245 IMAGING DETAILS : NULL
REMARK 247
REMARK 247 ELECTRON MICROSCOPY
REMARK 247 THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON
REMARK 247 MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE
REMARK 247 THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES
REMARK 247 ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION
REMARK 247 OF THE STRUCTURE FACTORS.
REMARK 300
REMARK 300 BIOMOLECULE: 1
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON
REMARK 300 BURIED SURFACE AREA.
REMARK 350
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS
REMARK 350 GIVEN BELOW. BOTH NON-CRYSTALLOGRAPHIC AND
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.
REMARK 350
REMARK 350 BIOMOLECULE: 1
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: TETRAMERIC
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D
REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000
REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000
REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000
REMARK 400
REMARK 400 COMPOUND
REMARK 400 1
REMARK 465
REMARK 465 MISSING RESIDUES
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)
REMARK 465
REMARK 465 M RES C SSSEQI
REMARK 465 MET A -43
REMARK 465 ALA A -42
REMARK 465 THR A -41
REMARK 465 LEU A -40
REMARK 465 PHE A -39
REMARK 465 GLN A -38
REMARK 465 VAL A -37
REMARK 465 SER A -36
REMARK 465 MET A -35
REMARK 465 GLY A -34
REMARK 465 SER A -33
REMARK 465 MET A -32
REMARK 465 ARG A -31
REMARK 465 HIS A -30
REMARK 465 ARG A -29
REMARK 465 ARG A -28
REMARK 465 ASN A -27
REMARK 465 GLY A -26
REMARK 465 ASN A -25
REMARK 465 PHE A -24
REMARK 465 GLU A -23
REMARK 465 SER A -22
REMARK 465 SER A -21
REMARK 465 ARG A -20
REMARK 465 LEU A -19
REMARK 465 LEU A -18
REMARK 465 TYR A -17
REMARK 465 SER A -16
REMARK 465 SER A -15
REMARK 465 MET A -14
REMARK 465 SER A -13
REMARK 465 ARG A -12
REMARK 465 SER A -11
REMARK 465 ILE A -10
REMARK 465 ASP A -9
REMARK 465 VAL A -8
REMARK 465 ALA A -7
REMARK 465 CYS A -6
REMARK 465 SER A -5
REMARK 465 ASP A -4
REMARK 465 ALA A -3
REMARK 465 ASP A -2
REMARK 465 LEU A -1
REMARK 465 ALA A 0
REMARK 465 ASN A 1
REMARK 465 PHE A 2
REMARK 465 ILE A 3
REMARK 465 GLN A 4
REMARK 465 GLU A 5
REMARK 465 ASN A 6
REMARK 465 PHE A 7
REMARK 465 LYS A 8
REMARK 465 LYS A 9
REMARK 465 ARG A 10
REMARK 465 GLU A 11
REMARK 465 CYS A 12
REMARK 465 VAL A 13
REMARK 465 PHE A 14
REMARK 465 PHE A 15
REMARK 465 THR A 16
REMARK 465 LYS A 17
REMARK 465 ASP A 18
REMARK 465 THR A 19
REMARK 465 LYS A 20
REMARK 465 SER A 21
REMARK 465 MET A 22
REMARK 465 GLY A 23
REMARK 465 ASN A 24
REMARK 465 LEU A 25
REMARK 465 CYS A 26
REMARK 465 LYS A 27
REMARK 465 CYS A 28
REMARK 465 GLY A 29
REMARK 465 TYR A 30
REMARK 465 PRO A 31
REMARK 465 GLU A 32
REMARK 465 ASN A 33
REMARK 465 GLN A 34
REMARK 465 HIS A 35
REMARK 465 ILE A 36
REMARK 465 GLU A 37
REMARK 465 GLY A 38
REMARK 465 THR A 39
REMARK 465 GLN A 40
REMARK 465 VAL A 41
REMARK 465 ASN A 42
REMARK 465 THR A 43
REMARK 465 THR A 44
REMARK 465 GLU A 45
REMARK 465 LYS A 46
REMARK 465 TRP A 47
REMARK 465 ASN A 48
REMARK 465 TYR A 49
REMARK 465 LYS A 50
REMARK 465 LYS A 51
REMARK 465 HIS A 52
REMARK 465 THR A 149
REMARK 465 GLY A 150
REMARK 465 GLY A 151
REMARK 465 ALA A 152
REMARK 465 GLY A 213
REMARK 465 ILE A 214
REMARK 465 ALA A 215
REMARK 465 ALA A 216
REMARK 465 TRP A 217
REMARK 465 GLY A 218
REMARK 465 MET A 219
REMARK 465 ILE A 220
REMARK 465 SER A 221
REMARK 465 ASN A 222
REMARK 465 ARG A 223
REMARK 465 GLU A 224
REMARK 465 THR A 225
REMARK 465 LEU A 226
REMARK 465 ILE A 227
REMARK 465 ARG A 228
REMARK 465 THR A 229
REMARK 465 ALA A 230
REMARK 465 ASP A 231
REMARK 465 SER A 232
REMARK 465 ASP A 233
REMARK 465 GLY A 234
REMARK 465 SER A 235
REMARK 465 TYR A 236
REMARK 465 LEU A 237
REMARK 465 ALA A 238
REMARK 465 HIS A 239
REMARK 465 TYR A 240
REMARK 465 ILE A 241
REMARK 465 MET A 242
REMARK 465 ASP A 243
REMARK 465 ASP A 244
REMARK 465 LEU A 245
REMARK 465 LYS A 246
REMARK 465 ASP A 264
REMARK 465 ASN A 265
REMARK 465 GLY A 266
REMARK 465 THR A 267
REMARK 465 HIS A 268
REMARK 465 GLY A 269
REMARK 465 HIS A 270
REMARK 465 PRO A 271
REMARK 465 THR A 272
REMARK 465 GLY A 307
REMARK 465 GLY A 308
REMARK 465 GLU A 344
REMARK 465 ALA A 345
REMARK 465 GLU A 346
REMARK 465 GLY A 347
REMARK 465 THR A 348
REMARK 465 LEU A 349
REMARK 465 ALA A 350
REMARK 465 GLU A 398
REMARK 465 ALA A 399
REMARK 465 GLY A 400
REMARK 465 ASP A 401
REMARK 465 GLY A 534
REMARK 465 ALA A 535
REMARK 465 LYS A 536
REMARK 465 ARG A 537
REMARK 465 ASP A 538
REMARK 465 ASP A 539
REMARK 465 LYS A 540
REMARK 465 ASN A 541
REMARK 465 SER A 542
REMARK 465 LYS A 543
REMARK 465 ASP A 544
REMARK 465 GLU A 545
REMARK 465 MET A 546
REMARK 465 GLU A 547
REMARK 465 ILE A 548
REMARK 465 GLU A 549
REMARK 465 LEU A 550
REMARK 465 SER A 551
REMARK 465 GLU A 552
REMARK 465 GLU A 553
REMARK 465 CYS A 554
REMARK 465 LYS A 715
REMARK 465 PRO A 716
REMARK 465 VAL A 717
REMARK 465 GLU A 718
REMARK 465 LYS A 719
REMARK 465 THR A 720
REMARK 465 GLN A 913
REMARK 465 TYR A 914
REMARK 465 PRO A 915
REMARK 465 ASP A 916
REMARK 465 ASP A 917
REMARK 465 ILE A 918
REMARK 465 ASP A 919
REMARK 465 GLY A 920
REMARK 465 THR A 921
REMARK 465 THR A 922
REMARK 465 TYR A 923
REMARK 465 ASN A 924
REMARK 465 PHE A 925
REMARK 465 ASP A 926
REMARK 465 HIS A 927
REMARK 465 CYS A 928
REMARK 465 THR A 929
REMARK 465 PHE A 930
REMARK 465 SER A 931
REMARK 465 GLY A 932
REMARK 465 ASN A 933
REMARK 465 GLU A 934
REMARK 465 SER A 935
REMARK 465 LYS A 936
REMARK 465 PRO A 937
REMARK 465 LEU A 938
REMARK 465 CYS A 939
REMARK 465 VAL A 940
REMARK 465 GLU A 941
REMARK 465 LEU A 942
REMARK 465 ASP A 943
REMARK 465 ALA A 944
REMARK 465 ASN A 945
REMARK 465 ASN A 946
REMARK 465 GLN A 947
REMARK 465 PRO A 948
REMARK 465 ARG A 949
REMARK 465 PHE A 950
REMARK 465 PRO A 951
REMARK 465 SER A 984
REMARK 465 VAL A 985
REMARK 465 GLN A 986
REMARK 465 GLU A 987
REMARK 465 CYS A 1027
REMARK 465 PHE A 1028
REMARK 465 LYS A 1029
REMARK 465 CYS A 1030
REMARK 465 CYS A 1031
REMARK 465 CYS A 1032
REMARK 465 LYS A 1033
REMARK 465 LYS A 1034
REMARK 465 GLU A 1035
REMARK 465 SER A 1036
REMARK 465 LYS A 1037
REMARK 465 SER A 1071
REMARK 465 ASP A 1072
REMARK 465 SER A 1073
REMARK 465 SER A 1074
REMARK 465 GLU A 1075
REMARK 465 GLU A 1076
REMARK 465 LYS A 1101
REMARK 465 ILE A 1102
REMARK 465 LYS A 1103
REMARK 465 SER A 1104
REMARK 465 ASN A 1105
REMARK 465 SER A 1106
REMARK 465 LEU A 1107
REMARK 465 GLU A 1108
REMARK 465 VAL A 1109
REMARK 465 LEU A 1110
REMARK 465 PHE A 1111
REMARK 465 GLN A 1112
REMARK 465 GLY A 1113
REMARK 465 PRO A 1114
REMARK 465 ASP A 1115
REMARK 465 TYR A 1116
REMARK 465 LYS A 1117
REMARK 465 ASP A 1118
REMARK 465 ASP A 1119
REMARK 465 ASP A 1120
REMARK 465 ASP A 1121
REMARK 465 LYS A 1122
REMARK 465 ALA A 1123
REMARK 465 HIS A 1124
REMARK 465 HIS A 1125
REMARK 465 HIS A 1126
REMARK 465 HIS A 1127
REMARK 465 HIS A 1128
REMARK 465 HIS A 1129
REMARK 465 HIS A 1130
REMARK 465 HIS A 1131
REMARK 465 HIS A 1132
REMARK 465 HIS A 1133
REMARK 465 MET B -43
REMARK 465 ALA B -42
REMARK 465 THR B -41
REMARK 465 LEU B -40
REMARK 465 PHE B -39
REMARK 465 GLN B -38
REMARK 465 VAL B -37
REMARK 465 SER B -36
REMARK 465 MET B -35
REMARK 465 GLY B -34
REMARK 465 SER B -33
REMARK 465 MET B -32
REMARK 465 ARG B -31
REMARK 465 HIS B -30
REMARK 465 ARG B -29
REMARK 465 ARG B -28
REMARK 465 ASN B -27
REMARK 465 GLY B -26
REMARK 465 ASN B -25
REMARK 465 PHE B -24
REMARK 465 GLU B -23
REMARK 465 SER B -22
REMARK 465 SER B -21
REMARK 465 ARG B -20
REMARK 465 LEU B -19
REMARK 465 LEU B -18
REMARK 465 TYR B -17
REMARK 465 SER B -16
REMARK 465 SER B -15
REMARK 465 MET B -14
REMARK 465 SER B -13
REMARK 465 ARG B -12
REMARK 465 SER B -11
REMARK 465 ILE B -10
REMARK 465 ASP B -9
REMARK 465 VAL B -8
REMARK 465 ALA B -7
REMARK 465 CYS B -6
REMARK 465 SER B -5
REMARK 465 ASP B -4
REMARK 465 ALA B -3
REMARK 465 ASP B -2
REMARK 465 LEU B -1
REMARK 465 ALA B 0
REMARK 465 ASN B 1
REMARK 465 PHE B 2
REMARK 465 ILE B 3
REMARK 465 GLN B 4
REMARK 465 GLU B 5
REMARK 465 ASN B 6
REMARK 465 PHE B 7
REMARK 465 LYS B 8
REMARK 465 LYS B 9
REMARK 465 ARG B 10
REMARK 465 GLU B 11
REMARK 465 CYS B 12
REMARK 465 VAL B 13
REMARK 465 PHE B 14
REMARK 465 PHE B 15
REMARK 465 THR B 16
REMARK 465 LYS B 17
REMARK 465 ASP B 18
REMARK 465 THR B 19
REMARK 465 LYS B 20
REMARK 465 SER B 21
REMARK 465 MET B 22
REMARK 465 GLY B 23
REMARK 465 ASN B 24
REMARK 465 LEU B 25
REMARK 465 CYS B 26
REMARK 465 LYS B 27
REMARK 465 CYS B 28
REMARK 465 GLY B 29
REMARK 465 TYR B 30
REMARK 465 PRO B 31
REMARK 465 GLU B 32
REMARK 465 ASN B 33
REMARK 465 GLN B 34
REMARK 465 HIS B 35
REMARK 465 ILE B 36
REMARK 465 GLU B 37
REMARK 465 GLY B 38
REMARK 465 THR B 39
REMARK 465 GLN B 40
REMARK 465 VAL B 41
REMARK 465 ASN B 42
REMARK 465 THR B 43
REMARK 465 THR B 44
REMARK 465 GLU B 45
REMARK 465 LYS B 46
REMARK 465 TRP B 47
REMARK 465 ASN B 48
REMARK 465 TYR B 49
REMARK 465 LYS B 50
REMARK 465 LYS B 51
REMARK 465 HIS B 52
REMARK 465 THR B 149
REMARK 465 GLY B 150
REMARK 465 GLY B 151
REMARK 465 ALA B 152
REMARK 465 GLY B 213
REMARK 465 ILE B 214
REMARK 465 ALA B 215
REMARK 465 ALA B 216
REMARK 465 TRP B 217
REMARK 465 GLY B 218
REMARK 465 MET B 219
REMARK 465 ILE B 220
REMARK 465 SER B 221
REMARK 465 ASN B 222
REMARK 465 ARG B 223
REMARK 465 GLU B 224
REMARK 465 THR B 225
REMARK 465 LEU B 226
REMARK 465 ILE B 227
REMARK 465 ARG B 228
REMARK 465 THR B 229
REMARK 465 ALA B 230
REMARK 465 ASP B 231
REMARK 465 SER B 232
REMARK 465 ASP B 233
REMARK 465 GLY B 234
REMARK 465 SER B 235
REMARK 465 TYR B 236
REMARK 465 LEU B 237
REMARK 465 ALA B 238
REMARK 465 HIS B 239
REMARK 465 TYR B 240
REMARK 465 ILE B 241
REMARK 465 MET B 242
REMARK 465 ASP B 243
REMARK 465 ASP B 244
REMARK 465 LEU B 245
REMARK 465 LYS B 246
REMARK 465 ASP B 264
REMARK 465 ASN B 265
REMARK 465 GLY B 266
REMARK 465 THR B 267
REMARK 465 HIS B 268
REMARK 465 GLY B 269
REMARK 465 HIS B 270
REMARK 465 PRO B 271
REMARK 465 THR B 272
REMARK 465 GLY B 307
REMARK 465 GLY B 308
REMARK 465 GLU B 344
REMARK 465 ALA B 345
REMARK 465 GLU B 346
REMARK 465 GLY B 347
REMARK 465 THR B 348
REMARK 465 LEU B 349
REMARK 465 ALA B 350
REMARK 465 GLU B 398
REMARK 465 ALA B 399
REMARK 465 GLY B 400
REMARK 465 ASP B 401
REMARK 465 GLY B 534
REMARK 465 ALA B 535
REMARK 465 LYS B 536
REMARK 465 ARG B 537
REMARK 465 ASP B 538
REMARK 465 ASP B 539
REMARK 465 LYS B 540
REMARK 465 ASN B 541
REMARK 465 SER B 542
REMARK 465 LYS B 543
REMARK 465 ASP B 544
REMARK 465 GLU B 545
REMARK 465 MET B 546
REMARK 465 GLU B 547
REMARK 465 ILE B 548
REMARK 465 GLU B 549
REMARK 465 LEU B 550
REMARK 465 SER B 551
REMARK 465 GLU B 552
REMARK 465 GLU B 553
REMARK 465 CYS B 554
REMARK 465 LYS B 715
REMARK 465 PRO B 716
REMARK 465 VAL B 717
REMARK 465 GLU B 718
REMARK 465 LYS B 719
REMARK 465 THR B 720
REMARK 465 GLN B 913
REMARK 465 TYR B 914
REMARK 465 PRO B 915
REMARK 465 ASP B 916
REMARK 465 ASP B 917
REMARK 465 ILE B 918
REMARK 465 ASP B 919
REMARK 465 GLY B 920
REMARK 465 THR B 921
REMARK 465 THR B 922
REMARK 465 TYR B 923
REMARK 465 ASN B 924
REMARK 465 PHE B 925
REMARK 465 ASP B 926
REMARK 465 HIS B 927
REMARK 465 CYS B 928
REMARK 465 THR B 929
REMARK 465 PHE B 930
REMARK 465 SER B 931
REMARK 465 GLY B 932
REMARK 465 ASN B 933
REMARK 465 GLU B 934
REMARK 465 SER B 935
REMARK 465 LYS B 936
REMARK 465 PRO B 937
REMARK 465 LEU B 938
REMARK 465 CYS B 939
REMARK 465 VAL B 940
REMARK 465 GLU B 941
REMARK 465 LEU B 942
REMARK 465 ASP B 943
REMARK 465 ALA B 944
REMARK 465 ASN B 945
REMARK 465 ASN B 946
REMARK 465 GLN B 947
REMARK 465 PRO B 948
REMARK 465 ARG B 949
REMARK 465 PHE B 950
REMARK 465 PRO B 951
REMARK 465 SER B 984
REMARK 465 VAL B 985
REMARK 465 GLN B 986
REMARK 465 GLU B 987
REMARK 465 CYS B 1027
REMARK 465 PHE B 1028
REMARK 465 LYS B 1029
REMARK 465 CYS B 1030
REMARK 465 CYS B 1031
REMARK 465 CYS B 1032
REMARK 465 LYS B 1033
REMARK 465 LYS B 1034
REMARK 465 GLU B 1035
REMARK 465 SER B 1036
REMARK 465 LYS B 1037
REMARK 465 SER B 1071
REMARK 465 ASP B 1072
REMARK 465 SER B 1073
REMARK 465 SER B 1074
REMARK 465 GLU B 1075
REMARK 465 GLU B 1076
REMARK 465 LYS B 1101
REMARK 465 ILE B 1102
REMARK 465 LYS B 1103
REMARK 465 SER B 1104
REMARK 465 ASN B 1105
REMARK 465 SER B 1106
REMARK 465 LEU B 1107
REMARK 465 GLU B 1108
REMARK 465 VAL B 1109
REMARK 465 LEU B 1110
REMARK 465 PHE B 1111
REMARK 465 GLN B 1112
REMARK 465 GLY B 1113
REMARK 465 PRO B 1114
REMARK 465 ASP B 1115
REMARK 465 TYR B 1116
REMARK 465 LYS B 1117
REMARK 465 ASP B 1118
REMARK 465 ASP B 1119
REMARK 465 ASP B 1120
REMARK 465 ASP B 1121
REMARK 465 LYS B 1122
REMARK 465 ALA B 1123
REMARK 465 HIS B 1124
REMARK 465 HIS B 1125
REMARK 465 HIS B 1126
REMARK 465 HIS B 1127
REMARK 465 HIS B 1128
REMARK 465 HIS B 1129
REMARK 465 HIS B 1130
REMARK 465 HIS B 1131
REMARK 465 HIS B 1132
REMARK 465 HIS B 1133
REMARK 465 MET C -43
REMARK 465 ALA C -42
REMARK 465 THR C -41
REMARK 465 LEU C -40
REMARK 465 PHE C -39
REMARK 465 GLN C -38
REMARK 465 VAL C -37
REMARK 465 SER C -36
REMARK 465 MET C -35
REMARK 465 GLY C -34
REMARK 465 SER C -33
REMARK 465 MET C -32
REMARK 465 ARG C -31
REMARK 465 HIS C -30
REMARK 465 ARG C -29
REMARK 465 ARG C -28
REMARK 465 ASN C -27
REMARK 465 GLY C -26
REMARK 465 ASN C -25
REMARK 465 PHE C -24
REMARK 465 GLU C -23
REMARK 465 SER C -22
REMARK 465 SER C -21
REMARK 465 ARG C -20
REMARK 465 LEU C -19
REMARK 465 LEU C -18
REMARK 465 TYR C -17
REMARK 465 SER C -16
REMARK 465 SER C -15
REMARK 465 MET C -14
REMARK 465 SER C -13
REMARK 465 ARG C -12
REMARK 465 SER C -11
REMARK 465 ILE C -10
REMARK 465 ASP C -9
REMARK 465 VAL C -8
REMARK 465 ALA C -7
REMARK 465 CYS C -6
REMARK 465 SER C -5
REMARK 465 ASP C -4
REMARK 465 ALA C -3
REMARK 465 ASP C -2
REMARK 465 LEU C -1
REMARK 465 ALA C 0
REMARK 465 ASN C 1
REMARK 465 PHE C 2
REMARK 465 ILE C 3
REMARK 465 GLN C 4
REMARK 465 GLU C 5
REMARK 465 ASN C 6
REMARK 465 PHE C 7
REMARK 465 LYS C 8
REMARK 465 LYS C 9
REMARK 465 ARG C 10
REMARK 465 GLU C 11
REMARK 465 CYS C 12
REMARK 465 VAL C 13
REMARK 465 PHE C 14
REMARK 465 PHE C 15
REMARK 465 THR C 16
REMARK 465 LYS C 17
REMARK 465 ASP C 18
REMARK 465 THR C 19
REMARK 465 LYS C 20
REMARK 465 SER C 21
REMARK 465 MET C 22
REMARK 465 GLY C 23
REMARK 465 ASN C 24
REMARK 465 LEU C 25
REMARK 465 CYS C 26
REMARK 465 LYS C 27
REMARK 465 CYS C 28
REMARK 465 GLY C 29
REMARK 465 TYR C 30
REMARK 465 PRO C 31
REMARK 465 GLU C 32
REMARK 465 ASN C 33
REMARK 465 GLN C 34
REMARK 465 HIS C 35
REMARK 465 ILE C 36
REMARK 465 GLU C 37
REMARK 465 GLY C 38
REMARK 465 THR C 39
REMARK 465 GLN C 40
REMARK 465 VAL C 41
REMARK 465 ASN C 42
REMARK 465 THR C 43
REMARK 465 THR C 44
REMARK 465 GLU C 45
REMARK 465 LYS C 46
REMARK 465 TRP C 47
REMARK 465 ASN C 48
REMARK 465 TYR C 49
REMARK 465 LYS C 50
REMARK 465 LYS C 51
REMARK 465 HIS C 52
REMARK 465 THR C 149
REMARK 465 GLY C 150
REMARK 465 GLY C 151
REMARK 465 ALA C 152
REMARK 465 GLY C 213
REMARK 465 ILE C 214
REMARK 465 ALA C 215
REMARK 465 ALA C 216
REMARK 465 TRP C 217
REMARK 465 GLY C 218
REMARK 465 MET C 219
REMARK 465 ILE C 220
REMARK 465 SER C 221
REMARK 465 ASN C 222
REMARK 465 ARG C 223
REMARK 465 GLU C 224
REMARK 465 THR C 225
REMARK 465 LEU C 226
REMARK 465 ILE C 227
REMARK 465 ARG C 228
REMARK 465 THR C 229
REMARK 465 ALA C 230
REMARK 465 ASP C 231
REMARK 465 SER C 232
REMARK 465 ASP C 233
REMARK 465 GLY C 234
REMARK 465 SER C 235
REMARK 465 TYR C 236
REMARK 465 LEU C 237
REMARK 465 ALA C 238
REMARK 465 HIS C 239
REMARK 465 TYR C 240
REMARK 465 ILE C 241
REMARK 465 MET C 242
REMARK 465 ASP C 243
REMARK 465 ASP C 244
REMARK 465 LEU C 245
REMARK 465 LYS C 246
REMARK 465 ASP C 264
REMARK 465 ASN C 265
REMARK 465 GLY C 266
REMARK 465 THR C 267
REMARK 465 HIS C 268
REMARK 465 GLY C 269
REMARK 465 HIS C 270
REMARK 465 PRO C 271
REMARK 465 THR C 272
REMARK 465 GLY C 307
REMARK 465 GLY C 308
REMARK 465 GLU C 344
REMARK 465 ALA C 345
REMARK 465 GLU C 346
REMARK 465 GLY C 347
REMARK 465 THR C 348
REMARK 465 LEU C 349
REMARK 465 ALA C 350
REMARK 465 GLU C 398
REMARK 465 ALA C 399
REMARK 465 GLY C 400
REMARK 465 ASP C 401
REMARK 465 GLY C 534
REMARK 465 ALA C 535
REMARK 465 LYS C 536
REMARK 465 ARG C 537
REMARK 465 ASP C 538
REMARK 465 ASP C 539
REMARK 465 LYS C 540
REMARK 465 ASN C 541
REMARK 465 SER C 542
REMARK 465 LYS C 543
REMARK 465 ASP C 544
REMARK 465 GLU C 545
REMARK 465 MET C 546
REMARK 465 GLU C 547
REMARK 465 ILE C 548
REMARK 465 GLU C 549
REMARK 465 LEU C 550
REMARK 465 SER C 551
REMARK 465 GLU C 552
REMARK 465 GLU C 553
REMARK 465 CYS C 554
REMARK 465 LYS C 715
REMARK 465 PRO C 716
REMARK 465 VAL C 717
REMARK 465 GLU C 718
REMARK 465 LYS C 719
REMARK 465 THR C 720
REMARK 465 GLN C 913
REMARK 465 TYR C 914
REMARK 465 PRO C 915
REMARK 465 ASP C 916
REMARK 465 ASP C 917
REMARK 465 ILE C 918
REMARK 465 ASP C 919
REMARK 465 GLY C 920
REMARK 465 THR C 921
REMARK 465 THR C 922
REMARK 465 TYR C 923
REMARK 465 ASN C 924
REMARK 465 PHE C 925
REMARK 465 ASP C 926
REMARK 465 HIS C 927
REMARK 465 CYS C 928
REMARK 465 THR C 929
REMARK 465 PHE C 930
REMARK 465 SER C 931
REMARK 465 GLY C 932
REMARK 465 ASN C 933
REMARK 465 GLU C 934
REMARK 465 SER C 935
REMARK 465 LYS C 936
REMARK 465 PRO C 937
REMARK 465 LEU C 938
REMARK 465 CYS C 939
REMARK 465 VAL C 940
REMARK 465 GLU C 941
REMARK 465 LEU C 942
REMARK 465 ASP C 943
REMARK 465 ALA C 944
REMARK 465 ASN C 945
REMARK 465 ASN C 946
REMARK 465 GLN C 947
REMARK 465 PRO C 948
REMARK 465 ARG C 949
REMARK 465 PHE C 950
REMARK 465 PRO C 951
REMARK 465 SER C 984
REMARK 465 VAL C 985
REMARK 465 GLN C 986
REMARK 465 GLU C 987
REMARK 465 CYS C 1027
REMARK 465 PHE C 1028
REMARK 465 LYS C 1029
REMARK 465 CYS C 1030
REMARK 465 CYS C 1031
REMARK 465 CYS C 1032
REMARK 465 LYS C 1033
REMARK 465 LYS C 1034
REMARK 465 GLU C 1035
REMARK 465 SER C 1036
REMARK 465 LYS C 1037
REMARK 465 SER C 1071
REMARK 465 ASP C 1072
REMARK 465 SER C 1073
REMARK 465 SER C 1074
REMARK 465 GLU C 1075
REMARK 465 GLU C 1076
REMARK 465 LYS C 1101
REMARK 465 ILE C 1102
REMARK 465 LYS C 1103
REMARK 465 SER C 1104
REMARK 465 ASN C 1105
REMARK 465 SER C 1106
REMARK 465 LEU C 1107
REMARK 465 GLU C 1108
REMARK 465 VAL C 1109
REMARK 465 LEU C 1110
REMARK 465 PHE C 1111
REMARK 465 GLN C 1112
REMARK 465 GLY C 1113
REMARK 465 PRO C 1114
REMARK 465 ASP C 1115
REMARK 465 TYR C 1116
REMARK 465 LYS C 1117
REMARK 465 ASP C 1118
REMARK 465 ASP C 1119
REMARK 465 ASP C 1120
REMARK 465 ASP C 1121
REMARK 465 LYS C 1122
REMARK 465 ALA C 1123
REMARK 465 HIS C 1124
REMARK 465 HIS C 1125
REMARK 465 HIS C 1126
REMARK 465 HIS C 1127
REMARK 465 HIS C 1128
REMARK 465 HIS C 1129
REMARK 465 HIS C 1130
REMARK 465 HIS C 1131
REMARK 465 HIS C 1132
REMARK 465 HIS C 1133
REMARK 465 MET D -43
REMARK 465 ALA D -42
REMARK 465 THR D -41
REMARK 465 LEU D -40
REMARK 465 PHE D -39
REMARK 465 GLN D -38
REMARK 465 VAL D -37
REMARK 465 SER D -36
REMARK 465 MET D -35
REMARK 465 GLY D -34
REMARK 465 SER D -33
REMARK 465 MET D -32
REMARK 465 ARG D -31
REMARK 465 HIS D -30
REMARK 465 ARG D -29
REMARK 465 ARG D -28
REMARK 465 ASN D -27
REMARK 465 GLY D -26
REMARK 465 ASN D -25
REMARK 465 PHE D -24
REMARK 465 GLU D -23
REMARK 465 SER D -22
REMARK 465 SER D -21
REMARK 465 ARG D -20
REMARK 465 LEU D -19
REMARK 465 LEU D -18
REMARK 465 TYR D -17
REMARK 465 SER D -16
REMARK 465 SER D -15
REMARK 465 MET D -14
REMARK 465 SER D -13
REMARK 465 ARG D -12
REMARK 465 SER D -11
REMARK 465 ILE D -10
REMARK 465 ASP D -9
REMARK 465 VAL D -8
REMARK 465 ALA D -7
REMARK 465 CYS D -6
REMARK 465 SER D -5
REMARK 465 ASP D -4
REMARK 465 ALA D -3
REMARK 465 ASP D -2
REMARK 465 LEU D -1
REMARK 465 ALA D 0
REMARK 465 ASN D 1
REMARK 465 PHE D 2
REMARK 465 ILE D 3
REMARK 465 GLN D 4
REMARK 465 GLU D 5
REMARK 465 ASN D 6
REMARK 465 PHE D 7
REMARK 465 LYS D 8
REMARK 465 LYS D 9
REMARK 465 ARG D 10
REMARK 465 GLU D 11
REMARK 465 CYS D 12
REMARK 465 VAL D 13
REMARK 465 PHE D 14
REMARK 465 PHE D 15
REMARK 465 THR D 16
REMARK 465 LYS D 17
REMARK 465 ASP D 18
REMARK 465 THR D 19
REMARK 465 LYS D 20
REMARK 465 SER D 21
REMARK 465 MET D 22
REMARK 465 GLY D 23
REMARK 465 ASN D 24
REMARK 465 LEU D 25
REMARK 465 CYS D 26
REMARK 465 LYS D 27
REMARK 465 CYS D 28
REMARK 465 GLY D 29
REMARK 465 TYR D 30
REMARK 465 PRO D 31
REMARK 465 GLU D 32
REMARK 465 ASN D 33
REMARK 465 GLN D 34
REMARK 465 HIS D 35
REMARK 465 ILE D 36
REMARK 465 GLU D 37
REMARK 465 GLY D 38
REMARK 465 THR D 39
REMARK 465 GLN D 40
REMARK 465 VAL D 41
REMARK 465 ASN D 42
REMARK 465 THR D 43
REMARK 465 THR D 44
REMARK 465 GLU D 45
REMARK 465 LYS D 46
REMARK 465 TRP D 47
REMARK 465 ASN D 48
REMARK 465 TYR D 49
REMARK 465 LYS D 50
REMARK 465 LYS D 51
REMARK 465 HIS D 52
REMARK 465 THR D 149
REMARK 465 GLY D 150
REMARK 465 GLY D 151
REMARK 465 ALA D 152
REMARK 465 GLY D 213
REMARK 465 ILE D 214
REMARK 465 ALA D 215
REMARK 465 ALA D 216
REMARK 465 TRP D 217
REMARK 465 GLY D 218
REMARK 465 MET D 219
REMARK 465 ILE D 220
REMARK 465 SER D 221
REMARK 465 ASN D 222
REMARK 465 ARG D 223
REMARK 465 GLU D 224
REMARK 465 THR D 225
REMARK 465 LEU D 226
REMARK 465 ILE D 227
REMARK 465 ARG D 228
REMARK 465 THR D 229
REMARK 465 ALA D 230
REMARK 465 ASP D 231
REMARK 465 SER D 232
REMARK 465 ASP D 233
REMARK 465 GLY D 234
REMARK 465 SER D 235
REMARK 465 TYR D 236
REMARK 465 LEU D 237
REMARK 465 ALA D 238
REMARK 465 HIS D 239
REMARK 465 TYR D 240
REMARK 465 ILE D 241
REMARK 465 MET D 242
REMARK 465 ASP D 243
REMARK 465 ASP D 244
REMARK 465 LEU D 245
REMARK 465 LYS D 246
REMARK 465 ASP D 264
REMARK 465 ASN D 265
REMARK 465 GLY D 266
REMARK 465 THR D 267
REMARK 465 HIS D 268
REMARK 465 GLY D 269
REMARK 465 HIS D 270
REMARK 465 PRO D 271
REMARK 465 THR D 272
REMARK 465 GLY D 307
REMARK 465 GLY D 308
REMARK 465 GLU D 344
REMARK 465 ALA D 345
REMARK 465 GLU D 346
REMARK 465 GLY D 347
REMARK 465 THR D 348
REMARK 465 LEU D 349
REMARK 465 ALA D 350
REMARK 465 GLU D 398
REMARK 465 ALA D 399
REMARK 465 GLY D 400
REMARK 465 ASP D 401
REMARK 465 GLY D 534
REMARK 465 ALA D 535
REMARK 465 LYS D 536
REMARK 465 ARG D 537
REMARK 465 ASP D 538
REMARK 465 ASP D 539
REMARK 465 LYS D 540
REMARK 465 ASN D 541
REMARK 465 SER D 542
REMARK 465 LYS D 543
REMARK 465 ASP D 544
REMARK 465 GLU D 545
REMARK 465 MET D 546
REMARK 465 GLU D 547
REMARK 465 ILE D 548
REMARK 465 GLU D 549
REMARK 465 LEU D 550
REMARK 465 SER D 551
REMARK 465 GLU D 552
REMARK 465 GLU D 553
REMARK 465 CYS D 554
REMARK 465 LYS D 715
REMARK 465 PRO D 716
REMARK 465 VAL D 717
REMARK 465 GLU D 718
REMARK 465 LYS D 719
REMARK 465 THR D 720
REMARK 465 GLN D 913
REMARK 465 TYR D 914
REMARK 465 PRO D 915
REMARK 465 ASP D 916
REMARK 465 ASP D 917
REMARK 465 ILE D 918
REMARK 465 ASP D 919
REMARK 465 GLY D 920
REMARK 465 THR D 921
REMARK 465 THR D 922
REMARK 465 TYR D 923
REMARK 465 ASN D 924
REMARK 465 PHE D 925
REMARK 465 ASP D 926
REMARK 465 HIS D 927
REMARK 465 CYS D 928
REMARK 465 THR D 929
REMARK 465 PHE D 930
REMARK 465 SER D 931
REMARK 465 GLY D 932
REMARK 465 ASN D 933
REMARK 465 GLU D 934
REMARK 465 SER D 935
REMARK 465 LYS D 936
REMARK 465 PRO D 937
REMARK 465 LEU D 938
REMARK 465 CYS D 939
REMARK 465 VAL D 940
REMARK 465 GLU D 941
REMARK 465 LEU D 942
REMARK 465 ASP D 943
REMARK 465 ALA D 944
REMARK 465 ASN D 945
REMARK 465 ASN D 946
REMARK 465 GLN D 947
REMARK 465 PRO D 948
REMARK 465 ARG D 949
REMARK 465 PHE D 950
REMARK 465 PRO D 951
REMARK 465 SER D 984
REMARK 465 VAL D 985
REMARK 465 GLN D 986
REMARK 465 GLU D 987
REMARK 465 CYS D 1027
REMARK 465 PHE D 1028
REMARK 465 LYS D 1029
REMARK 465 CYS D 1030
REMARK 465 CYS D 1031
REMARK 465 CYS D 1032
REMARK 465 LYS D 1033
REMARK 465 LYS D 1034
REMARK 465 GLU D 1035
REMARK 465 SER D 1036
REMARK 465 LYS D 1037
REMARK 465 SER D 1071
REMARK 465 ASP D 1072
REMARK 465 SER D 1073
REMARK 465 SER D 1074
REMARK 465 GLU D 1075
REMARK 465 GLU D 1076
REMARK 465 LYS D 1101
REMARK 465 ILE D 1102
REMARK 465 LYS D 1103
REMARK 465 SER D 1104
REMARK 465 ASN D 1105
REMARK 465 SER D 1106
REMARK 465 LEU D 1107
REMARK 465 GLU D 1108
REMARK 465 VAL D 1109
REMARK 465 LEU D 1110
REMARK 465 PHE D 1111
REMARK 465 GLN D 1112
REMARK 465 GLY D 1113
REMARK 465 PRO D 1114
REMARK 465 ASP D 1115
REMARK 465 TYR D 1116
REMARK 465 LYS D 1117
REMARK 465 ASP D 1118
REMARK 465 ASP D 1119
REMARK 465 ASP D 1120
REMARK 465 ASP D 1121
REMARK 465 LYS D 1122
REMARK 465 ALA D 1123
REMARK 465 HIS D 1124
REMARK 465 HIS D 1125
REMARK 465 HIS D 1126
REMARK 465 HIS D 1127
REMARK 465 HIS D 1128
REMARK 465 HIS D 1129
REMARK 465 HIS D 1130
REMARK 465 HIS D 1131
REMARK 465 HIS D 1132
REMARK 465 HIS D 1133
REMARK 470
REMARK 470 MISSING ATOM
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 470 I=INSERTION CODE):
REMARK 470 M RES CSSEQI ATOMS
REMARK 470 LYS A 116 CG CD CE NZ
REMARK 470 TYR A 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG A 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU A 120 CG CD1 CD2
REMARK 470 CYS A 122 SG
REMARK 470 ASP A 123 CG OD1 OD2
REMARK 470 THR A 124 OG1 CG2
REMARK 470 ASP A 125 CG OD1 OD2
REMARK 470 GLU A 127 CG CD OE1 OE2
REMARK 470 THR A 128 OG1 CG2
REMARK 470 ASP A 131 CG OD1 OD2
REMARK 470 LEU A 132 CG CD1 CD2
REMARK 470 GLN A 135 CG CD OE1 NE2
REMARK 470 HIS A 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS A 140 CG CD CE NZ
REMARK 470 LYS A 153 CG CD CE NZ
REMARK 470 ASN A 154 CG OD1 ND2
REMARK 470 PHE A 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS A 158 CG CD CE NZ
REMARK 470 ARG A 162 CG CD NE CZ NH1 NH2
REMARK 470 THR A 181 OG1 CG2
REMARK 470 THR A 184 OG1 CG2
REMARK 470 HIS A 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU A 188 CG CD1 CD2
REMARK 470 MET A 189 CG SD CE
REMARK 470 LYS A 190 CG CD CE NZ
REMARK 470 GLU A 194 CG CD OE1 OE2
REMARK 470 ASP A 198 CG OD1 OD2
REMARK 470 ARG A 203 NE CZ NH1 NH2
REMARK 470 SER A 204 OG
REMARK 470 SER A 205 OG
REMARK 470 GLU A 206 CG CD OE1 OE2
REMARK 470 VAL A 209 CG1 CG2
REMARK 470 ARG A 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP A 248 CG OD1 OD2
REMARK 470 LEU A 250 CG CD1 CD2
REMARK 470 ASP A 254 CG OD1 OD2
REMARK 470 ASN A 255 CG OD1 ND2
REMARK 470 VAL A 263 CG1 CG2
REMARK 470 ILE A 273 CG1 CG2 CD1
REMARK 470 GLU A 274 CG CD OE1 OE2
REMARK 470 LYS A 276 CG CD CE NZ
REMARK 470 LYS A 283 CG CD CE NZ
REMARK 470 GLU A 287 CG CD OE1 OE2
REMARK 470 GLU A 292 CG CD OE1 OE2
REMARK 470 SER A 293 OG
REMARK 470 ASN A 294 CG OD1 ND2
REMARK 470 GLN A 306 CG CD OE1 NE2
REMARK 470 GLU A 311 CG CD OE1 OE2
REMARK 470 THR A 312 OG1 CG2
REMARK 470 LYS A 314 CG CD CE NZ
REMARK 470 ASN A 317 CG OD1 ND2
REMARK 470 LYS A 323 CG CD CE NZ
REMARK 470 GLU A 330 CG CD OE1 OE2
REMARK 470 ARG A 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL A 338 CG1 CG2
REMARK 470 SER A 341 OG
REMARK 470 LEU A 342 CG CD1 CD2
REMARK 470 VAL A 343 CG1 CG2
REMARK 470 SER A 351 OG
REMARK 470 LYS A 355 CG CD CE NZ
REMARK 470 GLU A 356 CG CD OE1 OE2
REMARK 470 LEU A 359 CG CD1 CD2
REMARK 470 ARG A 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE A 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU A 362 CG CD1 CD2
REMARK 470 ARG A 364 CG CD NE CZ NH1 NH2
REMARK 470 THR A 365 OG1 CG2
REMARK 470 ARG A 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU A 369 CG CD1 CD2
REMARK 470 SER A 370 OG
REMARK 470 GLU A 371 CG CD OE1 OE2
REMARK 470 GLU A 372 CG CD OE1 OE2
REMARK 470 GLU A 373 CG CD OE1 OE2
REMARK 470 THR A 374 OG1 CG2
REMARK 470 GLU A 375 CG CD OE1 OE2
REMARK 470 LYS A 379 CG CD CE NZ
REMARK 470 TRP A 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP A 380 CZ3 CH2
REMARK 470 LYS A 382 CG CD CE NZ
REMARK 470 GLU A 383 CG CD OE1 OE2
REMARK 470 VAL A 384 CG1 CG2
REMARK 470 GLU A 386 CG CD OE1 OE2
REMARK 470 LYS A 395 CG CD CE NZ
REMARK 470 ILE A 396 CG1 CG2 CD1
REMARK 470 GLU A 397 CG CD OE1 OE2
REMARK 470 GLU A 402 CG CD OE1 OE2
REMARK 470 LYS A 414 CE NZ
REMARK 470 THR A 418 OG1 CG2
REMARK 470 GLU A 420 CG CD OE1 OE2
REMARK 470 HIS A 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP A 422 CG OD1 OD2
REMARK 470 ARG A 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP A 424 CG OD1 OD2
REMARK 470 ASN A 425 CG OD1 ND2
REMARK 470 ASP A 440 CG OD1 OD2
REMARK 470 ASP A 444 CG OD1 OD2
REMARK 470 GLU A 445 CG CD OE1 OE2
REMARK 470 ASN A 449 CG OD1 ND2
REMARK 470 ASP A 450 CG OD1 OD2
REMARK 470 ARG A 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU A 454 CG CD OE1 OE2
REMARK 470 SER A 455 OG
REMARK 470 ASP A 457 CG OD1 OD2
REMARK 470 ASP A 460 CG OD1 OD2
REMARK 470 ASP A 469 CG OD1 OD2
REMARK 470 GLU A 491 CG CD OE1 OE2
REMARK 470 GLU A 495 CG CD OE1 OE2
REMARK 470 LYS A 507 CG CD CE NZ
REMARK 470 ASP A 518 CG OD1 OD2
REMARK 470 ASP A 530 CG OD1 OD2
REMARK 470 GLU A 575 CG CD OE1 OE2
REMARK 470 GLU A 627 CG CD OE1 OE2
REMARK 470 ASP A 636 CG OD1 OD2
REMARK 470 GLU A 685 CG CD OE1 OE2
REMARK 470 LYS A 714 CG CD CE NZ
REMARK 470 LYS A 721 CG CD CE NZ
REMARK 470 LYS A 722 CG CD CE NZ
REMARK 470 LYS A 762 CG CD CE NZ
REMARK 470 GLU A 763 CG CD OE1 OE2
REMARK 470 GLU A 768 CG CD OE1 OE2
REMARK 470 ILE A 770 CG1 CG2 CD1
REMARK 470 LEU A 779 CG CD1 CD2
REMARK 470 LYS A 792 CG CD CE NZ
REMARK 470 SER A 795 OG
REMARK 470 ASP A 796 CG OD1 OD2
REMARK 470 ILE A 810 CG1 CG2 CD1
REMARK 470 ILE A 813 CG1 CG2 CD1
REMARK 470 VAL A 814 CG1 CG2
REMARK 470 LEU A 817 CG CD1 CD2
REMARK 470 HIS A 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER A 819 OG
REMARK 470 ASP A 820 CG OD1 OD2
REMARK 470 GLU A 821 CG CD OE1 OE2
REMARK 470 ASP A 834 CG OD1 OD2
REMARK 470 ARG A 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS A 890 CG CD CE NZ
REMARK 470 ASN A 891 CG OD1 ND2
REMARK 470 HIS A 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU A 896 CG CD OE1 OE2
REMARK 470 GLU A 952 CG CD OE1 OE2
REMARK 470 THR A 955 OG1 CG2
REMARK 470 ILE A 956 CG1 CG2 CD1
REMARK 470 LEU A 958 CG CD1 CD2
REMARK 470 VAL A 959 CG1 CG2
REMARK 470 MET A 963 CG SD CE
REMARK 470 ASN A 989 CG OD1 ND2
REMARK 470 LEU A1008 CG CD1 CD2
REMARK 470 ILE A1020 CG1 CG2 CD1
REMARK 470 MET A1022 CG SD CE
REMARK 470 MET A1024 CG SD CE
REMARK 470 LYS A1026 CG CD CE NZ
REMARK 470 GLU A1038 CG CD OE1 OE2
REMARK 470 GLU A1050 CG CD OE1 OE2
REMARK 470 LYS A1069 CG CD CE NZ
REMARK 470 LYS B 116 CG CD CE NZ
REMARK 470 TYR B 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG B 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU B 120 CG CD1 CD2
REMARK 470 CYS B 122 SG
REMARK 470 ASP B 123 CG OD1 OD2
REMARK 470 THR B 124 OG1 CG2
REMARK 470 ASP B 125 CG OD1 OD2
REMARK 470 GLU B 127 CG CD OE1 OE2
REMARK 470 THR B 128 OG1 CG2
REMARK 470 ASP B 131 CG OD1 OD2
REMARK 470 LEU B 132 CG CD1 CD2
REMARK 470 GLN B 135 CG CD OE1 NE2
REMARK 470 HIS B 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS B 140 CG CD CE NZ
REMARK 470 LYS B 153 CG CD CE NZ
REMARK 470 ASN B 154 CG OD1 ND2
REMARK 470 PHE B 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS B 158 CG CD CE NZ
REMARK 470 ARG B 162 CG CD NE CZ NH1 NH2
REMARK 470 THR B 181 OG1 CG2
REMARK 470 THR B 184 OG1 CG2
REMARK 470 HIS B 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU B 188 CG CD1 CD2
REMARK 470 MET B 189 CG SD CE
REMARK 470 LYS B 190 CG CD CE NZ
REMARK 470 GLU B 194 CG CD OE1 OE2
REMARK 470 ASP B 198 CG OD1 OD2
REMARK 470 ARG B 203 NE CZ NH1 NH2
REMARK 470 SER B 204 OG
REMARK 470 SER B 205 OG
REMARK 470 GLU B 206 CG CD OE1 OE2
REMARK 470 VAL B 209 CG1 CG2
REMARK 470 ARG B 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP B 248 CG OD1 OD2
REMARK 470 LEU B 250 CG CD1 CD2
REMARK 470 ASP B 254 CG OD1 OD2
REMARK 470 ASN B 255 CG OD1 ND2
REMARK 470 VAL B 263 CG1 CG2
REMARK 470 ILE B 273 CG1 CG2 CD1
REMARK 470 GLU B 274 CG CD OE1 OE2
REMARK 470 LYS B 276 CG CD CE NZ
REMARK 470 LYS B 283 CG CD CE NZ
REMARK 470 GLU B 287 CG CD OE1 OE2
REMARK 470 GLU B 292 CG CD OE1 OE2
REMARK 470 SER B 293 OG
REMARK 470 ASN B 294 CG OD1 ND2
REMARK 470 GLN B 306 CG CD OE1 NE2
REMARK 470 GLU B 311 CG CD OE1 OE2
REMARK 470 THR B 312 OG1 CG2
REMARK 470 LYS B 314 CG CD CE NZ
REMARK 470 ASN B 317 CG OD1 ND2
REMARK 470 LYS B 323 CG CD CE NZ
REMARK 470 GLU B 330 CG CD OE1 OE2
REMARK 470 ARG B 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL B 338 CG1 CG2
REMARK 470 SER B 341 OG
REMARK 470 LEU B 342 CG CD1 CD2
REMARK 470 VAL B 343 CG1 CG2
REMARK 470 SER B 351 OG
REMARK 470 LYS B 355 CG CD CE NZ
REMARK 470 GLU B 356 CG CD OE1 OE2
REMARK 470 LEU B 359 CG CD1 CD2
REMARK 470 ARG B 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE B 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU B 362 CG CD1 CD2
REMARK 470 ARG B 364 CG CD NE CZ NH1 NH2
REMARK 470 THR B 365 OG1 CG2
REMARK 470 ARG B 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU B 369 CG CD1 CD2
REMARK 470 SER B 370 OG
REMARK 470 GLU B 371 CG CD OE1 OE2
REMARK 470 GLU B 372 CG CD OE1 OE2
REMARK 470 GLU B 373 CG CD OE1 OE2
REMARK 470 THR B 374 OG1 CG2
REMARK 470 GLU B 375 CG CD OE1 OE2
REMARK 470 LYS B 379 CG CD CE NZ
REMARK 470 TRP B 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP B 380 CZ3 CH2
REMARK 470 LYS B 382 CG CD CE NZ
REMARK 470 GLU B 383 CG CD OE1 OE2
REMARK 470 VAL B 384 CG1 CG2
REMARK 470 GLU B 386 CG CD OE1 OE2
REMARK 470 LYS B 395 CG CD CE NZ
REMARK 470 ILE B 396 CG1 CG2 CD1
REMARK 470 GLU B 397 CG CD OE1 OE2
REMARK 470 GLU B 402 CG CD OE1 OE2
REMARK 470 LYS B 414 CE NZ
REMARK 470 THR B 418 OG1 CG2
REMARK 470 GLU B 420 CG CD OE1 OE2
REMARK 470 HIS B 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP B 422 CG OD1 OD2
REMARK 470 ARG B 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP B 424 CG OD1 OD2
REMARK 470 ASN B 425 CG OD1 ND2
REMARK 470 ASP B 440 CG OD1 OD2
REMARK 470 ASP B 444 CG OD1 OD2
REMARK 470 GLU B 445 CG CD OE1 OE2
REMARK 470 ASN B 449 CG OD1 ND2
REMARK 470 ASP B 450 CG OD1 OD2
REMARK 470 ARG B 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU B 454 CG CD OE1 OE2
REMARK 470 SER B 455 OG
REMARK 470 ASP B 457 CG OD1 OD2
REMARK 470 ASP B 460 CG OD1 OD2
REMARK 470 ASP B 469 CG OD1 OD2
REMARK 470 GLU B 491 CG CD OE1 OE2
REMARK 470 GLU B 495 CG CD OE1 OE2
REMARK 470 LYS B 507 CG CD CE NZ
REMARK 470 ASP B 518 CG OD1 OD2
REMARK 470 ASP B 530 CG OD1 OD2
REMARK 470 GLU B 575 CG CD OE1 OE2
REMARK 470 GLU B 627 CG CD OE1 OE2
REMARK 470 ASP B 636 CG OD1 OD2
REMARK 470 GLU B 685 CG CD OE1 OE2
REMARK 470 LYS B 714 CG CD CE NZ
REMARK 470 LYS B 721 CG CD CE NZ
REMARK 470 LYS B 722 CG CD CE NZ
REMARK 470 LYS B 762 CG CD CE NZ
REMARK 470 GLU B 763 CG CD OE1 OE2
REMARK 470 GLU B 768 CG CD OE1 OE2
REMARK 470 ILE B 770 CG1 CG2 CD1
REMARK 470 LEU B 779 CG CD1 CD2
REMARK 470 LYS B 792 CG CD CE NZ
REMARK 470 SER B 795 OG
REMARK 470 ASP B 796 CG OD1 OD2
REMARK 470 ILE B 810 CG1 CG2 CD1
REMARK 470 ILE B 813 CG1 CG2 CD1
REMARK 470 VAL B 814 CG1 CG2
REMARK 470 LEU B 817 CG CD1 CD2
REMARK 470 HIS B 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER B 819 OG
REMARK 470 ASP B 820 CG OD1 OD2
REMARK 470 GLU B 821 CG CD OE1 OE2
REMARK 470 ASP B 834 CG OD1 OD2
REMARK 470 ARG B 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS B 890 CG CD CE NZ
REMARK 470 ASN B 891 CG OD1 ND2
REMARK 470 HIS B 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU B 896 CG CD OE1 OE2
REMARK 470 GLU B 952 CG CD OE1 OE2
REMARK 470 THR B 955 OG1 CG2
REMARK 470 ILE B 956 CG1 CG2 CD1
REMARK 470 LEU B 958 CG CD1 CD2
REMARK 470 VAL B 959 CG1 CG2
REMARK 470 MET B 963 CG SD CE
REMARK 470 ASN B 989 CG OD1 ND2
REMARK 470 LEU B1008 CG CD1 CD2
REMARK 470 ILE B1020 CG1 CG2 CD1
REMARK 470 MET B1022 CG SD CE
REMARK 470 MET B1024 CG SD CE
REMARK 470 LYS B1026 CG CD CE NZ
REMARK 470 GLU B1038 CG CD OE1 OE2
REMARK 470 GLU B1050 CG CD OE1 OE2
REMARK 470 LYS B1069 CG CD CE NZ
REMARK 470 LYS C 116 CG CD CE NZ
REMARK 470 TYR C 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG C 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU C 120 CG CD1 CD2
REMARK 470 CYS C 122 SG
REMARK 470 ASP C 123 CG OD1 OD2
REMARK 470 THR C 124 OG1 CG2
REMARK 470 ASP C 125 CG OD1 OD2
REMARK 470 GLU C 127 CG CD OE1 OE2
REMARK 470 THR C 128 OG1 CG2
REMARK 470 ASP C 131 CG OD1 OD2
REMARK 470 LEU C 132 CG CD1 CD2
REMARK 470 GLN C 135 CG CD OE1 NE2
REMARK 470 HIS C 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS C 140 CG CD CE NZ
REMARK 470 LYS C 153 CG CD CE NZ
REMARK 470 ASN C 154 CG OD1 ND2
REMARK 470 PHE C 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS C 158 CG CD CE NZ
REMARK 470 ARG C 162 CG CD NE CZ NH1 NH2
REMARK 470 THR C 181 OG1 CG2
REMARK 470 THR C 184 OG1 CG2
REMARK 470 HIS C 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU C 188 CG CD1 CD2
REMARK 470 MET C 189 CG SD CE
REMARK 470 LYS C 190 CG CD CE NZ
REMARK 470 GLU C 194 CG CD OE1 OE2
REMARK 470 ASP C 198 CG OD1 OD2
REMARK 470 ARG C 203 NE CZ NH1 NH2
REMARK 470 SER C 204 OG
REMARK 470 SER C 205 OG
REMARK 470 GLU C 206 CG CD OE1 OE2
REMARK 470 VAL C 209 CG1 CG2
REMARK 470 ARG C 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP C 248 CG OD1 OD2
REMARK 470 LEU C 250 CG CD1 CD2
REMARK 470 ASP C 254 CG OD1 OD2
REMARK 470 ASN C 255 CG OD1 ND2
REMARK 470 VAL C 263 CG1 CG2
REMARK 470 ILE C 273 CG1 CG2 CD1
REMARK 470 GLU C 274 CG CD OE1 OE2
REMARK 470 LYS C 276 CG CD CE NZ
REMARK 470 LYS C 283 CG CD CE NZ
REMARK 470 GLU C 287 CG CD OE1 OE2
REMARK 470 GLU C 292 CG CD OE1 OE2
REMARK 470 SER C 293 OG
REMARK 470 ASN C 294 CG OD1 ND2
REMARK 470 GLN C 306 CG CD OE1 NE2
REMARK 470 GLU C 311 CG CD OE1 OE2
REMARK 470 THR C 312 OG1 CG2
REMARK 470 LYS C 314 CG CD CE NZ
REMARK 470 ASN C 317 CG OD1 ND2
REMARK 470 LYS C 323 CG CD CE NZ
REMARK 470 GLU C 330 CG CD OE1 OE2
REMARK 470 ARG C 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL C 338 CG1 CG2
REMARK 470 SER C 341 OG
REMARK 470 LEU C 342 CG CD1 CD2
REMARK 470 VAL C 343 CG1 CG2
REMARK 470 SER C 351 OG
REMARK 470 LYS C 355 CG CD CE NZ
REMARK 470 GLU C 356 CG CD OE1 OE2
REMARK 470 LEU C 359 CG CD1 CD2
REMARK 470 ARG C 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE C 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU C 362 CG CD1 CD2
REMARK 470 ARG C 364 CG CD NE CZ NH1 NH2
REMARK 470 THR C 365 OG1 CG2
REMARK 470 ARG C 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU C 369 CG CD1 CD2
REMARK 470 SER C 370 OG
REMARK 470 GLU C 371 CG CD OE1 OE2
REMARK 470 GLU C 372 CG CD OE1 OE2
REMARK 470 GLU C 373 CG CD OE1 OE2
REMARK 470 THR C 374 OG1 CG2
REMARK 470 GLU C 375 CG CD OE1 OE2
REMARK 470 LYS C 379 CG CD CE NZ
REMARK 470 TRP C 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP C 380 CZ3 CH2
REMARK 470 LYS C 382 CG CD CE NZ
REMARK 470 GLU C 383 CG CD OE1 OE2
REMARK 470 VAL C 384 CG1 CG2
REMARK 470 GLU C 386 CG CD OE1 OE2
REMARK 470 LYS C 395 CG CD CE NZ
REMARK 470 ILE C 396 CG1 CG2 CD1
REMARK 470 GLU C 397 CG CD OE1 OE2
REMARK 470 GLU C 402 CG CD OE1 OE2
REMARK 470 LYS C 414 CE NZ
REMARK 470 THR C 418 OG1 CG2
REMARK 470 GLU C 420 CG CD OE1 OE2
REMARK 470 HIS C 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP C 422 CG OD1 OD2
REMARK 470 ARG C 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP C 424 CG OD1 OD2
REMARK 470 ASN C 425 CG OD1 ND2
REMARK 470 ASP C 440 CG OD1 OD2
REMARK 470 ASP C 444 CG OD1 OD2
REMARK 470 GLU C 445 CG CD OE1 OE2
REMARK 470 ASN C 449 CG OD1 ND2
REMARK 470 ASP C 450 CG OD1 OD2
REMARK 470 ARG C 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU C 454 CG CD OE1 OE2
REMARK 470 SER C 455 OG
REMARK 470 ASP C 457 CG OD1 OD2
REMARK 470 ASP C 460 CG OD1 OD2
REMARK 470 ASP C 469 CG OD1 OD2
REMARK 470 GLU C 491 CG CD OE1 OE2
REMARK 470 GLU C 495 CG CD OE1 OE2
REMARK 470 LYS C 507 CG CD CE NZ
REMARK 470 ASP C 518 CG OD1 OD2
REMARK 470 ASP C 530 CG OD1 OD2
REMARK 470 GLU C 575 CG CD OE1 OE2
REMARK 470 GLU C 627 CG CD OE1 OE2
REMARK 470 ASP C 636 CG OD1 OD2
REMARK 470 GLU C 685 CG CD OE1 OE2
REMARK 470 LYS C 714 CG CD CE NZ
REMARK 470 LYS C 721 CG CD CE NZ
REMARK 470 LYS C 722 CG CD CE NZ
REMARK 470 LYS C 762 CG CD CE NZ
REMARK 470 GLU C 763 CG CD OE1 OE2
REMARK 470 GLU C 768 CG CD OE1 OE2
REMARK 470 ILE C 770 CG1 CG2 CD1
REMARK 470 LEU C 779 CG CD1 CD2
REMARK 470 LYS C 792 CG CD CE NZ
REMARK 470 SER C 795 OG
REMARK 470 ASP C 796 CG OD1 OD2
REMARK 470 ILE C 810 CG1 CG2 CD1
REMARK 470 ILE C 813 CG1 CG2 CD1
REMARK 470 VAL C 814 CG1 CG2
REMARK 470 LEU C 817 CG CD1 CD2
REMARK 470 HIS C 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER C 819 OG
REMARK 470 ASP C 820 CG OD1 OD2
REMARK 470 GLU C 821 CG CD OE1 OE2
REMARK 470 ASP C 834 CG OD1 OD2
REMARK 470 ARG C 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS C 890 CG CD CE NZ
REMARK 470 ASN C 891 CG OD1 ND2
REMARK 470 HIS C 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU C 896 CG CD OE1 OE2
REMARK 470 GLU C 952 CG CD OE1 OE2
REMARK 470 THR C 955 OG1 CG2
REMARK 470 ILE C 956 CG1 CG2 CD1
REMARK 470 LEU C 958 CG CD1 CD2
REMARK 470 VAL C 959 CG1 CG2
REMARK 470 MET C 963 CG SD CE
REMARK 470 ASN C 989 CG OD1 ND2
REMARK 470 LEU C1008 CG CD1 CD2
REMARK 470 ILE C1020 CG1 CG2 CD1
REMARK 470 MET C1022 CG SD CE
REMARK 470 MET C1024 CG SD CE
REMARK 470 LYS C1026 CG CD CE NZ
REMARK 470 GLU C1038 CG CD OE1 OE2
REMARK 470 GLU C1050 CG CD OE1 OE2
REMARK 470 LYS C1069 CG CD CE NZ
REMARK 470 LYS D 116 CG CD CE NZ
REMARK 470 TYR D 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG D 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU D 120 CG CD1 CD2
REMARK 470 CYS D 122 SG
REMARK 470 ASP D 123 CG OD1 OD2
REMARK 470 THR D 124 OG1 CG2
REMARK 470 ASP D 125 CG OD1 OD2
REMARK 470 GLU D 127 CG CD OE1 OE2
REMARK 470 THR D 128 OG1 CG2
REMARK 470 ASP D 131 CG OD1 OD2
REMARK 470 LEU D 132 CG CD1 CD2
REMARK 470 GLN D 135 CG CD OE1 NE2
REMARK 470 HIS D 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS D 140 CG CD CE NZ
REMARK 470 LYS D 153 CG CD CE NZ
REMARK 470 ASN D 154 CG OD1 ND2
REMARK 470 PHE D 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS D 158 CG CD CE NZ
REMARK 470 ARG D 162 CG CD NE CZ NH1 NH2
REMARK 470 THR D 181 OG1 CG2
REMARK 470 THR D 184 OG1 CG2
REMARK 470 HIS D 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU D 188 CG CD1 CD2
REMARK 470 MET D 189 CG SD CE
REMARK 470 LYS D 190 CG CD CE NZ
REMARK 470 GLU D 194 CG CD OE1 OE2
REMARK 470 ASP D 198 CG OD1 OD2
REMARK 470 ARG D 203 NE CZ NH1 NH2
REMARK 470 SER D 204 OG
REMARK 470 SER D 205 OG
REMARK 470 GLU D 206 CG CD OE1 OE2
REMARK 470 VAL D 209 CG1 CG2
REMARK 470 ARG D 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP D 248 CG OD1 OD2
REMARK 470 LEU D 250 CG CD1 CD2
REMARK 470 ASP D 254 CG OD1 OD2
REMARK 470 ASN D 255 CG OD1 ND2
REMARK 470 VAL D 263 CG1 CG2
REMARK 470 ILE D 273 CG1 CG2 CD1
REMARK 470 GLU D 274 CG CD OE1 OE2
REMARK 470 LYS D 276 CG CD CE NZ
REMARK 470 LYS D 283 CG CD CE NZ
REMARK 470 GLU D 287 CG CD OE1 OE2
REMARK 470 GLU D 292 CG CD OE1 OE2
REMARK 470 SER D 293 OG
REMARK 470 ASN D 294 CG OD1 ND2
REMARK 470 GLN D 306 CG CD OE1 NE2
REMARK 470 GLU D 311 CG CD OE1 OE2
REMARK 470 THR D 312 OG1 CG2
REMARK 470 LYS D 314 CG CD CE NZ
REMARK 470 ASN D 317 CG OD1 ND2
REMARK 470 LYS D 323 CG CD CE NZ
REMARK 470 GLU D 330 CG CD OE1 OE2
REMARK 470 ARG D 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL D 338 CG1 CG2
REMARK 470 SER D 341 OG
REMARK 470 LEU D 342 CG CD1 CD2
REMARK 470 VAL D 343 CG1 CG2
REMARK 470 SER D 351 OG
REMARK 470 LYS D 355 CG CD CE NZ
REMARK 470 GLU D 356 CG CD OE1 OE2
REMARK 470 LEU D 359 CG CD1 CD2
REMARK 470 ARG D 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE D 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU D 362 CG CD1 CD2
REMARK 470 ARG D 364 CG CD NE CZ NH1 NH2
REMARK 470 THR D 365 OG1 CG2
REMARK 470 ARG D 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU D 369 CG CD1 CD2
REMARK 470 SER D 370 OG
REMARK 470 GLU D 371 CG CD OE1 OE2
REMARK 470 GLU D 372 CG CD OE1 OE2
REMARK 470 GLU D 373 CG CD OE1 OE2
REMARK 470 THR D 374 OG1 CG2
REMARK 470 GLU D 375 CG CD OE1 OE2
REMARK 470 LYS D 379 CG CD CE NZ
REMARK 470 TRP D 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP D 380 CZ3 CH2
REMARK 470 LYS D 382 CG CD CE NZ
REMARK 470 GLU D 383 CG CD OE1 OE2
REMARK 470 VAL D 384 CG1 CG2
REMARK 470 GLU D 386 CG CD OE1 OE2
REMARK 470 LYS D 395 CG CD CE NZ
REMARK 470 ILE D 396 CG1 CG2 CD1
REMARK 470 GLU D 397 CG CD OE1 OE2
REMARK 470 GLU D 402 CG CD OE1 OE2
REMARK 470 LYS D 414 CE NZ
REMARK 470 THR D 418 OG1 CG2
REMARK 470 GLU D 420 CG CD OE1 OE2
REMARK 470 HIS D 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP D 422 CG OD1 OD2
REMARK 470 ARG D 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP D 424 CG OD1 OD2
REMARK 470 ASN D 425 CG OD1 ND2
REMARK 470 ASP D 440 CG OD1 OD2
REMARK 470 ASP D 444 CG OD1 OD2
REMARK 470 GLU D 445 CG CD OE1 OE2
REMARK 470 ASN D 449 CG OD1 ND2
REMARK 470 ASP D 450 CG OD1 OD2
REMARK 470 ARG D 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU D 454 CG CD OE1 OE2
REMARK 470 SER D 455 OG
REMARK 470 ASP D 457 CG OD1 OD2
REMARK 470 ASP D 460 CG OD1 OD2
REMARK 470 ASP D 469 CG OD1 OD2
REMARK 470 GLU D 491 CG CD OE1 OE2
REMARK 470 GLU D 495 CG CD OE1 OE2
REMARK 470 LYS D 507 CG CD CE NZ
REMARK 470 ASP D 518 CG OD1 OD2
REMARK 470 ASP D 530 CG OD1 OD2
REMARK 470 GLU D 575 CG CD OE1 OE2
REMARK 470 GLU D 627 CG CD OE1 OE2
REMARK 470 ASP D 636 CG OD1 OD2
REMARK 470 GLU D 685 CG CD OE1 OE2
REMARK 470 LYS D 714 CG CD CE NZ
REMARK 470 LYS D 721 CG CD CE NZ
REMARK 470 LYS D 722 CG CD CE NZ
REMARK 470 LYS D 762 CG CD CE NZ
REMARK 470 GLU D 763 CG CD OE1 OE2
REMARK 470 GLU D 768 CG CD OE1 OE2
REMARK 470 ILE D 770 CG1 CG2 CD1
REMARK 470 LEU D 779 CG CD1 CD2
REMARK 470 LYS D 792 CG CD CE NZ
REMARK 470 SER D 795 OG
REMARK 470 ASP D 796 CG OD1 OD2
REMARK 470 ILE D 810 CG1 CG2 CD1
REMARK 470 ILE D 813 CG1 CG2 CD1
REMARK 470 VAL D 814 CG1 CG2
REMARK 470 LEU D 817 CG CD1 CD2
REMARK 470 HIS D 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER D 819 OG
REMARK 470 ASP D 820 CG OD1 OD2
REMARK 470 GLU D 821 CG CD OE1 OE2
REMARK 470 ASP D 834 CG OD1 OD2
REMARK 470 ARG D 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS D 890 CG CD CE NZ
REMARK 470 ASN D 891 CG OD1 ND2
REMARK 470 HIS D 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU D 896 CG CD OE1 OE2
REMARK 470 GLU D 952 CG CD OE1 OE2
REMARK 470 THR D 955 OG1 CG2
REMARK 470 ILE D 956 CG1 CG2 CD1
REMARK 470 LEU D 958 CG CD1 CD2
REMARK 470 VAL D 959 CG1 CG2
REMARK 470 MET D 963 CG SD CE
REMARK 470 ASN D 989 CG OD1 ND2
REMARK 470 LEU D1008 CG CD1 CD2
REMARK 470 ILE D1020 CG1 CG2 CD1
REMARK 470 MET D1022 CG SD CE
REMARK 470 MET D1024 CG SD CE
REMARK 470 LYS D1026 CG CD CE NZ
REMARK 470 GLU D1038 CG CD OE1 OE2
REMARK 470 GLU D1050 CG CD OE1 OE2
REMARK 470 LYS D1069 CG CD CE NZ
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: TORSION ANGLES
REMARK 500
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)
REMARK 500
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400
REMARK 500
REMARK 500 M RES CSSEQI PSI PHI
REMARK 500 UNK A 110 32.78 -150.09
REMARK 500 ASP A 125 66.34 60.48
REMARK 500 SER A 204 79.26 -102.86
REMARK 500 LYS A 276 -5.91 63.30
REMARK 500 ARG A 334 -166.52 -126.41
REMARK 500 SER A 352 -9.15 71.47
REMARK 500 ASN A 449 -0.37 -59.48
REMARK 500 HIS A 559 74.12 51.80
REMARK 500 GLU A 821 -4.45 70.15
REMARK 500 GLU A 892 74.11 59.96
REMARK 500 HIS A 893 32.24 -81.01
REMARK 500 PHE A 978 -164.89 -105.86
REMARK 500 UNK B 110 32.76 -150.09
REMARK 500 ASP B 125 66.38 60.39
REMARK 500 SER B 204 79.29 -102.88
REMARK 500 LYS B 276 -5.90 63.25
REMARK 500 ARG B 334 -166.52 -126.45
REMARK 500 SER B 352 -9.15 71.41
REMARK 500 ASN B 449 -0.33 -59.45
REMARK 500 HIS B 559 74.15 51.82
REMARK 500 GLU B 821 -4.42 70.09
REMARK 500 GLU B 892 74.15 59.98
REMARK 500 HIS B 893 32.33 -81.07
REMARK 500 PHE B 978 -164.87 -105.90
REMARK 500 UNK C 110 32.78 -150.14
REMARK 500 ASP C 125 66.37 60.41
REMARK 500 SER C 204 79.28 -102.82
REMARK 500 LYS C 276 -5.88 63.28
REMARK 500 ARG C 334 -166.48 -126.39
REMARK 500 SER C 352 -9.13 71.51
REMARK 500 ASN C 449 -0.41 -59.46
REMARK 500 HIS C 559 74.21 51.78
REMARK 500 GLU C 821 -4.51 70.24
REMARK 500 GLU C 892 74.18 59.96
REMARK 500 HIS C 893 32.15 -80.96
REMARK 500 PHE C 978 -164.92 -105.86
REMARK 500 UNK D 110 32.74 -150.06
REMARK 500 ASP D 125 66.36 60.45
REMARK 500 SER D 204 79.23 -102.85
REMARK 500 LYS D 276 -5.94 63.33
REMARK 500 ARG D 334 -166.51 -126.45
REMARK 500 SER D 352 -9.10 71.39
REMARK 500 ASN D 449 -0.35 -59.48
REMARK 500 HIS D 559 74.11 51.82
REMARK 500 GLU D 821 -4.50 70.18
REMARK 500 GLU D 892 74.12 60.02
REMARK 500 HIS D 893 32.26 -81.02
REMARK 500 PHE D 978 -164.87 -105.86
REMARK 500
REMARK 500 REMARK: NULL
REMARK 610
REMARK 610 MISSING HETEROATOM
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 610 I=INSERTION CODE):
REMARK 610 M RES C SSEQI
REMARK 610 KXP A 1301
REMARK 610 KXP B 1301
REMARK 610 KXP C 1301
REMARK 610 KXP D 1301
REMARK 800
REMARK 800 SITE
REMARK 800 SITE_IDENTIFIER: AC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP A 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS A 1302
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP B 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS B 1302
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP C 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS C 1302
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP D 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS D 1302
REMARK 900
REMARK 900 RELATED ENTRIES
REMARK 900 RELATED ID: EMD-0487 RELATED DB: EMDB
REMARK 900 CRYO-EM STRUCTURE OF THE TRPM8 ION CHANNEL IN COMPLEX WITH MENTHOL
REMARK 900 ANALOG WS-12 AND PI(4,5)P2
REMARK 900 RELATED ID: EMD-0488 RELATED DB: EMDB
REMARK 900 RELATED ID: EMD-0489 RELATED DB: EMDB
REMARK 999
REMARK 999 SEQUENCE
REMARK 999 THE COMPLETE SAMPLE SEQUENCE INCLUDING TAGS AND ENGINEERED
REMARK 999 MUTATIONS IS THE FOLLOWING:
REMARK 999 MATLFQVSMGSMRHRRNGNFESSRLLYSSMSRSIDVACSDADLANFIQENFKKRECVFFTKD TKSMG
REMARK 999 NLCKCGYPENQHIEGTQVNTTEKWNYKKHTKELPTDAFGDIQFENLGKRGKYIRL SCDTDSETLYDL
REMARK 999 MTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIF TGGTHYGLMKYIGEVVRDN
REMARK 999 TISRSSEENVVAIGIAAWGMISNRETLIRTADSDGSYLAHY IMDDLKRDPLYCLDNNHTHLLLVDNG
REMARK 999 THGHPTIEAKVRTQLEKYISERVIPESNYGGKIP IVCFAQGGGKETLKSINVAIKSKIPCVVVEGSG
REMARK 999 RIADVIASLVEAEGTLASSCVKESLLR FLPRTISRLSEEETESWIKWIKEVLESPHLLTVIKIEEAG
REMARK 999 DEIVSNAISFALYKAFSTNE HDRDNWNGQLKLLLEWNQLDLASDEIFTNDRNWESADLQDVMFTALV
REMARK 999 KDRPKFVRLFLEN GLNLRKFLTTEVLRELYTNNFSSLVFKNLQIAKNSYNDALLTFVWKMVEDFRRG
REMARK 999 AKRDDK NSKDEMEIELSEECPITRHPLQALFIWSVLQNKKELSKVIWEQTRGCTLAALGASKLLKS
REMARK 999 MAKVKNDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELA VEARDQQ
REMARK 999 FIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFFFPLIGCGFISFRKKPVEKT KKLFLYYVSFFTSP
REMARK 999 FVVFSWNVIFYIAFLLLFAYVLLMDFQKEPTALEIILYVLVFILLC DEVRQWYMNGSKYFSDLWNVM
REMARK 999 DTLAIFYFIAGIVFRLHSDESSWYSGRVIFCLDYIVFTL RLIHIFTVSRNLGPKIIMLQRMMIDVFF
REMARK 999 FLFLFAVWMVAFGVARQGILRKNEHRWEWIFR SVIYEPYLAMFGQYPDDIDGTTYNFDHCTFSGNES
REMARK 999 KPLCVELDANNQPRFPEWITIPLVC IYMLSTNILLVNLLVAMFGYTVGSVQENNDQVWKFQRFFLVQ
REMARK 999 EYCSRLTIPFPFVIFAYI FMVMRKCFKCCCKKESKEPSVCCSRNEDNEILAWEAVMKENYLVKINTK
REMARK 999 ASDSSEEMVHR FRQLDAKLSDLKGLLKEISSKIKSNSLEVLFQGPDYKDDDDKAHHHHHHHHHH
SITE 1 AC1 3 ASN A 692 PHE A 735 LYS D 605
SITE 1 AC2 6 TYR A 745 ASP A 781 ARG A 841 ILE A 845
SITE 2 AC2 6 TYR A1004 ARG A1007
SITE 1 AC3 3 LYS A 605 ASN B 692 PHE B 735
SITE 1 AC4 6 TYR B 745 ASP B 781 ARG B 841 ILE B 845
SITE 2 AC4 6 TYR B1004 ARG B1007
SITE 1 AC5 3 LYS B 605 ASN C 692 PHE C 735
SITE 1 AC6 6 TYR C 745 ASP C 781 ARG C 841 ILE C 845
SITE 2 AC6 6 TYR C1004 ARG C1007
SITE 1 AC7 3 LYS C 605 ASN D 692 PHE D 735
SITE 1 AC8 6 TYR D 745 ASP D 781 ARG D 841 ILE D 845
SITE 2 AC8 6 TYR D1004 ARG D1007
SEQRES 1 A 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 A 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 A 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 A 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 A 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 A 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 A 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 A 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 A 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 A 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 A 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 A 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 A 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 A 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 A 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 A 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 A 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 A 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 A 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 A 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 A 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 A 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 A 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 A 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 A 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 A 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 A 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 A 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 A 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 A 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 A 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 A 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 A 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 A 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 A 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 A 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 A 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 A 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 A 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 A 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 A 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 A 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 A 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 A 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 A 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 A 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 A 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 A 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 A 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 A 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 A 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 A 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 A 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 A 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 A 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 A 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 A 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 A 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 A 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 A 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 A 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 A 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 A 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 A 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 A 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 A 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 A 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 A 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 A 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 A 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 A 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 A 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 A 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 A 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 A 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 A 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 A 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 A 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 A 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 A 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 A 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 A 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 A 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 A 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 A 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 A 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 A 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 A 1135 HIS HIS HIS HIS
SEQRES 1 B 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 B 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 B 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 B 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 B 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 B 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 B 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 B 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 B 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 B 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 B 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 B 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 B 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 B 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 B 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 B 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 B 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 B 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 B 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 B 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 B 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 B 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 B 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 B 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 B 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 B 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 B 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 B 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 B 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 B 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 B 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 B 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 B 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 B 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 B 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 B 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 B 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 B 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 B 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 B 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 B 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 B 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 B 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 B 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 B 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 B 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 B 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 B 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 B 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 B 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 B 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 B 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 B 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 B 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 B 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 B 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 B 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 B 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 B 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 B 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 B 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 B 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 B 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 B 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 B 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 B 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 B 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 B 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 B 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 B 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 B 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 B 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 B 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 B 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 B 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 B 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 B 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 B 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 B 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 B 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 B 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 B 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 B 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 B 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 B 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 B 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 B 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 B 1135 HIS HIS HIS HIS
SEQRES 1 C 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 C 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 C 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 C 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 C 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 C 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 C 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 C 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 C 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 C 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 C 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 C 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 C 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 C 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 C 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 C 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 C 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 C 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 C 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 C 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 C 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 C 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 C 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 C 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 C 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 C 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 C 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 C 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 C 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 C 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 C 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 C 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 C 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 C 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 C 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 C 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 C 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 C 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 C 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 C 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 C 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 C 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 C 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 C 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 C 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 C 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 C 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 C 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 C 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 C 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 C 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 C 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 C 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 C 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 C 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 C 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 C 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 C 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 C 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 C 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 C 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 C 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 C 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 C 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 C 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 C 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 C 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 C 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 C 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 C 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 C 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 C 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 C 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 C 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 C 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 C 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 C 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 C 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 C 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 C 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 C 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 C 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 C 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 C 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 C 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 C 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 C 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 C 1135 HIS HIS HIS HIS
SEQRES 1 D 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 D 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 D 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 D 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 D 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 D 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 D 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 D 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 D 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 D 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 D 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 D 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 D 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 D 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 D 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 D 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 D 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 D 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 D 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 D 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 D 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 D 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 D 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 D 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 D 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 D 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 D 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 D 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 D 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 D 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 D 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 D 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 D 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 D 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 D 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 D 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 D 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 D 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 D 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 D 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 D 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 D 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 D 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 D 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 D 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 D 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 D 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 D 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 D 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 D 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 D 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 D 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 D 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 D 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 D 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 D 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 D 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 D 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 D 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 D 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 D 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 D 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 D 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 D 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 D 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 D 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 D 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 D 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 D 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 D 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 D 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 D 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 D 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 D 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 D 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 D 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 D 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 D 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 D 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 D 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 D 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 D 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 D 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 D 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 D 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 D 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 D 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 D 1135 HIS HIS HIS HIS
ATOM 1 N UNK A 53 55.573 8.106 -67.303 1.00146.36 N
ATOM 2 CA UNK A 53 56.501 7.453 -68.218 1.00146.36 C
ATOM 3 C UNK A 53 57.773 7.038 -67.489 1.00146.36 C
ATOM 4 O UNK A 53 58.876 7.393 -67.902 1.00146.36 O
ATOM 5 CB UNK A 53 56.841 8.378 -69.388 1.00146.36 C
ATOM 6 N UNK A 54 57.613 6.282 -66.409 1.00148.00 N
ATOM 7 CA UNK A 54 58.748 5.860 -65.597 1.00148.00 C
ATOM 8 C UNK A 54 59.497 4.694 -66.228 1.00148.00 C
ATOM 9 O UNK A 54 59.040 4.081 -67.193 1.00148.00 O
ATOM 10 CB UNK A 54 58.285 5.472 -64.192 1.00148.00 C
ATOM 11 N UNK A 55 60.661 4.393 -65.664 1.00141.16 N
ATOM 12 CA UNK A 55 61.471 3.273 -66.119 1.00141.16 C
ATOM 13 C UNK A 55 61.475 2.176 -65.062 1.00141.16 C
ATOM 14 O UNK A 55 61.598 2.453 -63.870 1.00141.16 O
ATOM 15 CB UNK A 55 62.900 3.726 -66.425 1.00141.16 C
ATOM 16 N UNK A 56 61.343 0.933 -65.504 1.00131.26 N
ATOM 17 CA UNK A 56 61.260 -0.194 -64.586 1.00131.26 C
ATOM 18 C UNK A 56 62.609 -0.528 -63.960 1.00131.26 C
ATOM 19 O UNK A 56 63.652 -0.055 -64.412 1.00131.26 O
ATOM 20 CB UNK A 56 60.705 -1.420 -65.309 1.00131.26 C
ATOM 21 N UNK A 57 62.572 -1.354 -62.919 1.00128.32 N
ATOM 22 CA UNK A 57 63.771 -1.759 -62.196 1.00128.32 C
ATOM 23 C UNK A 57 63.518 -3.045 -61.422 1.00128.32 C
ATOM 24 O UNK A 57 62.748 -3.042 -60.463 1.00128.32 O
ATOM 25 CB UNK A 57 64.220 -0.656 -61.234 1.00128.32 C
ATOM 26 N UNK A 58 64.161 -4.135 -61.829 1.00129.76 N
ATOM 27 CA UNK A 58 63.975 -5.410 -61.147 1.00129.76 C
ATOM 28 C UNK A 58 65.190 -6.323 -61.275 1.00129.76 C
ATOM 29 O UNK A 58 66.214 -5.939 -61.841 1.00129.76 O
ATOM 30 CB UNK A 58 62.737 -6.124 -61.686 1.00129.76 C
ATOM 31 N UNK A 59 65.057 -7.538 -60.749 1.00131.22 N
ATOM 32 CA UNK A 59 66.162 -8.493 -60.688 1.00131.22 C
ATOM 33 C UNK A 59 66.518 -9.067 -62.055 1.00131.22 C
ATOM 34 O UNK A 59 65.622 -9.438 -62.814 1.00131.22 O
ATOM 35 CB UNK A 59 65.820 -9.632 -59.728 1.00131.22 C
ATOM 36 N UNK A 60 67.824 -9.129 -62.334 1.00127.31 N
ATOM 37 CA UNK A 60 68.408 -9.626 -63.589 1.00127.31 C
ATOM 38 C UNK A 60 67.846 -8.927 -64.822 1.00127.31 C
ATOM 39 O UNK A 60 67.661 -9.552 -65.865 1.00127.31 O
ATOM 40 CB UNK A 60 68.213 -11.141 -63.718 1.00127.31 C
ATOM 41 N UNK A 61 67.587 -7.630 -64.700 1.00125.56 N
ATOM 42 CA UNK A 61 66.863 -6.909 -65.736 1.00125.56 C
ATOM 43 C UNK A 61 67.509 -5.585 -66.114 1.00125.56 C
ATOM 44 O UNK A 61 67.459 -4.620 -65.353 1.00125.56 O
ATOM 45 CB UNK A 61 65.427 -6.658 -65.281 1.00125.56 C
ATOM 46 N UNK A 62 68.106 -5.544 -67.298 1.00125.06 N
ATOM 47 CA UNK A 62 68.607 -4.295 -67.848 1.00125.06 C
ATOM 48 C UNK A 62 67.427 -3.482 -68.362 1.00125.06 C
ATOM 49 O UNK A 62 66.565 -4.015 -69.057 1.00125.06 O
ATOM 50 CB UNK A 62 69.613 -4.557 -68.968 1.00125.06 C
ATOM 51 N UNK A 63 67.379 -2.201 -68.019 1.00121.17 N
ATOM 52 CA UNK A 63 66.266 -1.357 -68.435 1.00121.17 C
ATOM 53 C UNK A 63 66.578 -0.621 -69.734 1.00121.17 C
ATOM 54 O UNK A 63 67.712 -0.626 -70.216 1.00121.17 O
ATOM 55 CB UNK A 63 65.914 -0.354 -67.337 1.00121.17 C
ATOM 56 N UNK A 64 65.554 0.007 -70.299 1.00127.95 N
ATOM 57 CA UNK A 64 65.697 0.783 -71.522 1.00127.95 C
ATOM 58 C UNK A 64 64.596 1.829 -71.568 1.00127.95 C
ATOM 59 O UNK A 64 63.568 1.674 -70.913 1.00127.95 O
ATOM 60 CB UNK A 64 65.635 -0.117 -72.755 1.00127.95 C
ATOM 61 N UNK A 65 64.807 2.887 -72.340 1.00130.05 N
ATOM 62 CA UNK A 65 63.844 3.979 -72.402 1.00130.05 C
ATOM 63 C UNK A 65 62.653 3.628 -73.284 1.00130.05 C
ATOM 64 O UNK A 65 62.637 2.596 -73.958 1.00130.05 O
ATOM 65 CB UNK A 65 64.514 5.255 -72.915 1.00130.05 C
ATOM 66 N UNK A 66 61.652 4.500 -73.269 1.00140.73 N
ATOM 67 CA UNK A 66 60.476 4.331 -74.108 1.00140.73 C
ATOM 68 C UNK A 66 60.763 4.821 -75.520 1.00140.73 C
ATOM 69 O UNK A 66 59.953 5.534 -76.112 1.00140.73 O
ATOM 70 CB UNK A 66 59.282 5.084 -73.522 1.00140.73 C
ATOM 71 N UNK A 105 56.885 -0.268 -60.950 1.00125.02 N
ATOM 72 CA UNK A 105 56.557 -1.602 -61.442 1.00125.02 C
ATOM 73 C UNK A 105 57.810 -2.434 -61.674 1.00125.02 C
ATOM 74 O UNK A 105 58.431 -2.338 -62.731 1.00125.02 O
ATOM 75 CB UNK A 105 55.754 -1.510 -62.738 1.00125.02 C
ATOM 76 N UNK A 106 58.172 -3.250 -60.689 1.00130.02 N
ATOM 77 CA UNK A 106 59.337 -4.116 -60.801 1.00130.02 C
ATOM 78 C UNK A 106 59.065 -5.254 -61.778 1.00130.02 C
ATOM 79 O UNK A 106 58.371 -6.216 -61.449 1.00130.02 O
ATOM 80 CB UNK A 106 59.726 -4.672 -59.433 1.00130.02 C
ATOM 81 N UNK A 107 59.617 -5.135 -62.980 1.00126.69 N
ATOM 82 CA UNK A 107 59.358 -6.096 -64.043 1.00126.69 C
ATOM 83 C UNK A 107 60.578 -6.966 -64.320 1.00126.69 C
ATOM 84 O UNK A 107 61.574 -6.487 -64.861 1.00126.69 O
ATOM 85 CB UNK A 107 58.932 -5.366 -65.317 1.00126.69 C
ATOM 86 N UNK A 108 60.496 -8.241 -63.954 1.00120.94 N
ATOM 87 CA UNK A 108 61.611 -9.167 -64.135 1.00120.94 C
ATOM 88 C UNK A 108 61.776 -9.591 -65.592 1.00120.94 C
ATOM 89 O UNK A 108 61.392 -10.699 -65.964 1.00120.94 O
ATOM 90 CB UNK A 108 61.420 -10.404 -63.257 1.00120.94 C
ATOM 91 N UNK A 109 62.369 -8.721 -66.404 1.00120.31 N
ATOM 92 CA UNK A 109 62.508 -8.976 -67.834 1.00120.31 C
ATOM 93 C UNK A 109 63.618 -9.977 -68.142 1.00120.31 C
ATOM 94 O UNK A 109 64.235 -10.543 -67.241 1.00120.31 O
ATOM 95 CB UNK A 109 62.769 -7.669 -68.583 1.00120.31 C
ATOM 96 N UNK A 110 63.864 -10.197 -69.429 1.00120.85 N
ATOM 97 CA UNK A 110 64.914 -11.112 -69.858 1.00120.85 C
ATOM 98 C UNK A 110 65.487 -10.674 -71.199 1.00120.85 C
ATOM 99 O UNK A 110 65.896 -11.504 -72.012 1.00120.85 O
ATOM 100 CB UNK A 110 64.383 -12.543 -69.952 1.00120.85 C
ATOM 101 N UNK A 111 65.514 -9.364 -71.418 1.00117.29 N
ATOM 102 CA UNK A 111 66.033 -8.792 -72.653 1.00117.29 C
ATOM 103 C UNK A 111 67.548 -8.939 -72.741 1.00117.29 C
ATOM 104 O UNK A 111 68.144 -8.695 -73.792 1.00117.29 O
ATOM 105 CB UNK A 111 65.645 -7.317 -72.759 1.00117.29 C
ATOM 106 N LYS A 116 55.601 -10.479 -63.545 1.00113.28 N
ATOM 107 CA LYS A 116 55.635 -9.449 -64.573 1.00113.28 C
ATOM 108 C LYS A 116 56.787 -9.690 -65.535 1.00113.28 C
ATOM 109 O LYS A 116 57.492 -8.758 -65.912 1.00113.28 O
ATOM 110 CB LYS A 116 55.756 -8.064 -63.940 1.00113.28 C
ATOM 111 N TYR A 117 56.963 -10.951 -65.924 1.00112.66 N
ATOM 112 CA TYR A 117 58.087 -11.336 -66.766 1.00112.66 C
ATOM 113 C TYR A 117 57.918 -10.794 -68.179 1.00112.66 C
ATOM 114 O TYR A 117 56.833 -10.850 -68.759 1.00112.66 O
ATOM 115 CB TYR A 117 58.220 -12.857 -66.802 1.00112.66 C
ATOM 116 N ILE A 118 59.002 -10.259 -68.728 1.00114.90 N
ATOM 117 CA ILE A 118 59.011 -9.675 -70.062 1.00114.90 C
ATOM 118 C ILE A 118 60.059 -10.398 -70.889 1.00114.90 C
ATOM 119 O ILE A 118 61.216 -10.509 -70.471 1.00114.90 O
ATOM 120 CB ILE A 118 59.308 -8.166 -70.019 1.00114.90 C
ATOM 121 CG1 ILE A 118 58.224 -7.431 -69.239 1.00114.90 C
ATOM 122 CG2 ILE A 118 59.417 -7.599 -71.423 1.00114.90 C
ATOM 123 CD1 ILE A 118 58.565 -5.991 -68.959 1.00114.90 C
ATOM 124 N ARG A 119 59.659 -10.893 -72.054 1.00118.68 N
ATOM 125 CA ARG A 119 60.586 -11.497 -72.998 1.00118.68 C
ATOM 126 C ARG A 119 60.476 -10.780 -74.333 1.00118.68 C
ATOM 127 O ARG A 119 59.385 -10.691 -74.905 1.00118.68 O
ATOM 128 CB ARG A 119 60.304 -12.991 -73.172 1.00118.68 C
ATOM 129 N LEU A 120 61.598 -10.260 -74.819 1.00128.32 N
ATOM 130 CA LEU A 120 61.663 -9.753 -76.181 1.00128.32 C
ATOM 131 C LEU A 120 62.015 -10.906 -77.108 1.00128.32 C
ATOM 132 O LEU A 120 62.842 -11.755 -76.762 1.00128.32 O
ATOM 133 CB LEU A 120 62.698 -8.635 -76.297 1.00128.32 C
ATOM 134 N SER A 121 61.386 -10.946 -78.279 1.00133.31 N
ATOM 135 CA SER A 121 61.489 -12.130 -79.117 1.00133.31 C
ATOM 136 C SER A 121 61.519 -11.747 -80.587 1.00133.31 C
ATOM 137 O SER A 121 60.924 -10.752 -81.006 1.00133.31 O
ATOM 138 CB SER A 121 60.327 -13.093 -78.851 1.00133.31 C
ATOM 139 OG SER A 121 59.094 -12.509 -79.233 1.00133.31 O
ATOM 140 N CYS A 122 62.230 -12.556 -81.366 1.00129.30 N
ATOM 141 CA CYS A 122 62.145 -12.476 -82.813 1.00129.30 C
ATOM 142 C CYS A 122 60.958 -13.298 -83.308 1.00129.30 C
ATOM 143 O CYS A 122 60.481 -14.218 -82.640 1.00129.30 O
ATOM 144 CB CYS A 122 63.440 -12.969 -83.456 1.00129.30 C
ATOM 145 N ASP A 123 60.485 -12.959 -84.507 1.00123.46 N
ATOM 146 CA ASP A 123 59.263 -13.551 -85.048 1.00123.46 C
ATOM 147 C ASP A 123 59.565 -14.950 -85.581 1.00123.46 C
ATOM 148 O ASP A 123 59.806 -15.161 -86.772 1.00123.46 O
ATOM 149 CB ASP A 123 58.677 -12.657 -86.132 1.00123.46 C
ATOM 150 N THR A 124 59.526 -15.926 -84.671 1.00132.57 N
ATOM 151 CA THR A 124 59.745 -17.329 -85.011 1.00132.57 C
ATOM 152 C THR A 124 59.179 -18.211 -83.903 1.00132.57 C
ATOM 153 O THR A 124 58.972 -17.762 -82.773 1.00132.57 O
ATOM 154 CB THR A 124 61.234 -17.637 -85.221 1.00132.57 C
ATOM 155 N ASP A 125 58.930 -19.480 -84.260 1.00134.63 N
ATOM 156 CA ASP A 125 58.716 -20.594 -83.319 1.00134.63 C
ATOM 157 C ASP A 125 57.515 -20.386 -82.394 1.00134.63 C
ATOM 158 O ASP A 125 57.658 -20.231 -81.180 1.00134.63 O
ATOM 159 CB ASP A 125 59.982 -20.863 -82.503 1.00134.63 C
ATOM 160 N SER A 126 56.318 -20.377 -82.987 1.00136.98 N
ATOM 161 CA SER A 126 55.095 -20.187 -82.209 1.00136.98 C
ATOM 162 C SER A 126 54.823 -21.376 -81.294 1.00136.98 C
ATOM 163 O SER A 126 54.371 -21.205 -80.154 1.00136.98 O
ATOM 164 CB SER A 126 53.911 -19.962 -83.148 1.00136.98 C
ATOM 165 OG SER A 126 54.077 -18.778 -83.904 1.00136.98 O
ATOM 166 N GLU A 127 55.084 -22.591 -81.784 1.00132.35 N
ATOM 167 CA GLU A 127 54.841 -23.785 -80.981 1.00132.35 C
ATOM 168 C GLU A 127 55.803 -23.862 -79.804 1.00132.35 C
ATOM 169 O GLU A 127 55.398 -24.202 -78.687 1.00132.35 O
ATOM 170 CB GLU A 127 54.956 -25.036 -81.852 1.00132.35 C
ATOM 171 N THR A 128 57.072 -23.513 -80.032 1.00131.45 N
ATOM 172 CA THR A 128 58.033 -23.440 -78.937 1.00131.45 C
ATOM 173 C THR A 128 57.679 -22.319 -77.971 1.00131.45 C
ATOM 174 O THR A 128 57.915 -22.436 -76.764 1.00131.45 O
ATOM 175 CB THR A 128 59.444 -23.244 -79.488 1.00131.45 C
ATOM 176 N LEU A 129 57.083 -21.237 -78.484 1.00130.87 N
ATOM 177 CA LEU A 129 56.651 -20.129 -77.635 1.00130.87 C
ATOM 178 C LEU A 129 55.529 -20.544 -76.694 1.00130.87 C
ATOM 179 O LEU A 129 55.572 -20.250 -75.490 1.00130.87 O
ATOM 180 CB LEU A 129 56.204 -18.959 -78.507 1.00130.87 C
ATOM 181 CG LEU A 129 55.675 -17.737 -77.769 1.00130.87 C
ATOM 182 CD1 LEU A 129 56.743 -17.168 -76.864 1.00130.87 C
ATOM 183 CD2 LEU A 129 55.205 -16.700 -78.766 1.00130.87 C
ATOM 184 N TYR A 130 54.514 -21.229 -77.226 1.00132.30 N
ATOM 185 CA TYR A 130 53.433 -21.714 -76.376 1.00132.30 C
ATOM 186 C TYR A 130 53.921 -22.803 -75.431 1.00132.30 C
ATOM 187 O TYR A 130 53.455 -22.891 -74.289 1.00132.30 O
ATOM 188 CB TYR A 130 52.271 -22.217 -77.230 1.00132.30 C
ATOM 189 CG TYR A 130 51.117 -22.767 -76.422 1.00132.30 C
ATOM 190 CD1 TYR A 130 50.280 -21.921 -75.708 1.00132.30 C
ATOM 191 CD2 TYR A 130 50.858 -24.132 -76.383 1.00132.30 C
ATOM 192 CE1 TYR A 130 49.226 -22.420 -74.968 1.00132.30 C
ATOM 193 CE2 TYR A 130 49.805 -24.640 -75.648 1.00132.30 C
ATOM 194 CZ TYR A 130 48.993 -23.778 -74.945 1.00132.30 C
ATOM 195 OH TYR A 130 47.946 -24.277 -74.210 1.00132.30 O
ATOM 196 N ASP A 131 54.879 -23.624 -75.878 1.00130.49 N
ATOM 197 CA ASP A 131 55.468 -24.630 -75.000 1.00130.49 C
ATOM 198 C ASP A 131 56.225 -23.982 -73.846 1.00130.49 C
ATOM 199 O ASP A 131 56.180 -24.473 -72.714 1.00130.49 O
ATOM 200 CB ASP A 131 56.392 -25.546 -75.800 1.00130.49 C
ATOM 201 N LEU A 132 56.895 -22.859 -74.112 1.00131.15 N
ATOM 202 CA LEU A 132 57.571 -22.122 -73.050 1.00131.15 C
ATOM 203 C LEU A 132 56.573 -21.495 -72.087 1.00131.15 C
ATOM 204 O LEU A 132 56.772 -21.530 -70.868 1.00131.15 O
ATOM 205 CB LEU A 132 58.478 -21.049 -73.650 1.00131.15 C
ATOM 206 N MET A 133 55.482 -20.932 -72.613 1.00132.58 N
ATOM 207 CA MET A 133 54.496 -20.293 -71.741 1.00132.58 C
ATOM 208 C MET A 133 53.729 -21.320 -70.914 1.00132.58 C
ATOM 209 O MET A 133 53.208 -21.002 -69.838 1.00132.58 O
ATOM 210 CB MET A 133 53.540 -19.435 -72.560 1.00132.58 C
ATOM 211 CG MET A 133 54.182 -18.193 -73.125 1.00132.58 C
ATOM 212 SD MET A 133 52.988 -17.143 -73.962 1.00132.58 S
ATOM 213 CE MET A 133 52.716 -18.090 -75.455 1.00132.58 C
ATOM 214 N THR A 134 53.640 -22.558 -71.401 1.00133.60 N
ATOM 215 CA THR A 134 53.023 -23.610 -70.598 1.00133.60 C
ATOM 216 C THR A 134 53.998 -24.175 -69.573 1.00133.60 C
ATOM 217 O THR A 134 53.638 -24.381 -68.409 1.00133.60 O
ATOM 218 CB THR A 134 52.489 -24.726 -71.492 1.00133.60 C
ATOM 219 OG1 THR A 134 53.526 -25.178 -72.370 1.00133.60 O
ATOM 220 CG2 THR A 134 51.281 -24.259 -72.286 1.00133.60 C
ATOM 221 N GLN A 135 55.238 -24.445 -69.989 1.00132.56 N
ATOM 222 CA GLN A 135 56.178 -25.135 -69.113 1.00132.56 C
ATOM 223 C GLN A 135 56.707 -24.217 -68.020 1.00132.56 C
ATOM 224 O GLN A 135 56.943 -24.660 -66.890 1.00132.56 O
ATOM 225 CB GLN A 135 57.332 -25.705 -69.935 1.00132.56 C
ATOM 226 N HIS A 136 56.906 -22.936 -68.332 1.00134.98 N
ATOM 227 CA HIS A 136 57.555 -22.051 -67.373 1.00134.98 C
ATOM 228 C HIS A 136 56.555 -21.418 -66.412 1.00134.98 C
ATOM 229 O HIS A 136 56.728 -21.506 -65.191 1.00134.98 O
ATOM 230 CB HIS A 136 58.361 -20.986 -68.113 1.00134.98 C
ATOM 231 CG HIS A 136 59.535 -21.538 -68.862 1.00134.98 C
ATOM 232 ND1 HIS A 136 60.678 -21.976 -68.230 1.00134.98 N
ATOM 233 CD2 HIS A 136 59.744 -21.726 -70.186 1.00134.98 C
ATOM 234 CE1 HIS A 136 61.539 -22.411 -69.132 1.00134.98 C
ATOM 235 NE2 HIS A 136 60.996 -22.271 -70.328 1.00134.98 N
ATOM 236 N TRP A 137 55.504 -20.780 -66.927 1.00132.91 N
ATOM 237 CA TRP A 137 54.634 -20.020 -66.036 1.00132.91 C
ATOM 238 C TRP A 137 53.219 -20.576 -65.900 1.00132.91 C
ATOM 239 O TRP A 137 52.785 -20.907 -64.791 1.00132.91 O
ATOM 240 CB TRP A 137 54.519 -18.572 -66.511 1.00132.91 C
ATOM 241 CG TRP A 137 55.779 -17.777 -66.496 1.00132.91 C
ATOM 242 CD1 TRP A 137 56.321 -17.118 -65.434 1.00132.91 C
ATOM 243 CD2 TRP A 137 56.616 -17.487 -67.619 1.00132.91 C
ATOM 244 NE1 TRP A 137 57.467 -16.465 -65.818 1.00132.91 N
ATOM 245 CE2 TRP A 137 57.666 -16.674 -67.157 1.00132.91 C
ATOM 246 CE3 TRP A 137 56.585 -17.848 -68.969 1.00132.91 C
ATOM 247 CZ2 TRP A 137 58.680 -16.220 -67.995 1.00132.91 C
ATOM 248 CZ3 TRP A 137 57.587 -17.396 -69.797 1.00132.91 C
ATOM 249 CH2 TRP A 137 58.620 -16.590 -69.309 1.00132.91 C
ATOM 250 N HIS A 138 52.495 -20.692 -67.010 1.00125.03 N
ATOM 251 CA HIS A 138 51.041 -20.748 -66.970 1.00125.03 C
ATOM 252 C HIS A 138 50.508 -22.144 -67.259 1.00125.03 C
ATOM 253 O HIS A 138 51.122 -22.932 -67.981 1.00125.03 O
ATOM 254 CB HIS A 138 50.437 -19.762 -67.969 1.00125.03 C
ATOM 255 N LEU A 139 49.341 -22.433 -66.687 1.00117.22 N
ATOM 256 CA LEU A 139 48.654 -23.695 -66.914 1.00117.22 C
ATOM 257 C LEU A 139 47.846 -23.649 -68.208 1.00117.22 C
ATOM 258 O LEU A 139 47.661 -22.594 -68.817 1.00117.22 O
ATOM 259 CB LEU A 139 47.766 -24.028 -65.711 1.00117.22 C
ATOM 260 CG LEU A 139 46.772 -22.992 -65.168 1.00117.22 C
ATOM 261 CD1 LEU A 139 45.396 -23.083 -65.795 1.00117.22 C
ATOM 262 CD2 LEU A 139 46.671 -23.112 -63.656 1.00117.22 C
ATOM 263 N LYS A 140 47.376 -24.821 -68.635 1.00114.05 N
ATOM 264 CA LYS A 140 46.569 -24.904 -69.845 1.00114.05 C
ATOM 265 C LYS A 140 45.196 -24.299 -69.600 1.00114.05 C
ATOM 266 O LYS A 140 44.544 -24.590 -68.595 1.00114.05 O
ATOM 267 CB LYS A 140 46.430 -26.356 -70.297 1.00114.05 C
ATOM 268 N THR A 141 44.747 -23.463 -70.534 1.00112.59 N
ATOM 269 CA THR A 141 43.572 -22.663 -70.209 1.00112.59 C
ATOM 270 C THR A 141 42.425 -22.941 -71.165 1.00112.59 C
ATOM 271 O THR A 141 42.640 -23.024 -72.382 1.00112.59 O
ATOM 272 CB THR A 141 43.918 -21.183 -70.238 1.00112.59 C
ATOM 273 OG1 THR A 141 44.534 -20.862 -71.489 1.00112.59 O
ATOM 274 CG2 THR A 141 44.846 -20.841 -69.087 1.00112.59 C
ATOM 275 N PRO A 142 41.203 -23.065 -70.640 1.00110.32 N
ATOM 276 CA PRO A 142 40.090 -23.531 -71.480 1.00110.32 C
ATOM 277 C PRO A 142 39.568 -22.480 -72.437 1.00110.32 C
ATOM 278 O PRO A 142 38.889 -22.823 -73.409 1.00110.32 O
ATOM 279 CB PRO A 142 39.019 -23.918 -70.451 1.00110.32 C
ATOM 280 CG PRO A 142 39.754 -24.055 -69.157 1.00110.32 C
ATOM 281 CD PRO A 142 40.844 -23.054 -69.215 1.00110.32 C
ATOM 282 N ASN A 143 39.845 -21.206 -72.186 1.00111.94 N
ATOM 283 CA ASN A 143 39.271 -20.131 -72.978 1.00111.94 C
ATOM 284 C ASN A 143 40.348 -19.094 -73.253 1.00111.94 C
ATOM 285 O ASN A 143 41.335 -19.003 -72.522 1.00111.94 O
ATOM 286 CB ASN A 143 38.081 -19.494 -72.249 1.00111.94 C
ATOM 287 CG ASN A 143 37.225 -18.644 -73.155 1.00111.94 C
ATOM 288 OD1 ASN A 143 37.493 -18.523 -74.347 1.00111.94 O
ATOM 289 ND2 ASN A 143 36.184 -18.050 -72.595 1.00111.94 N
ATOM 290 N LEU A 144 40.163 -18.324 -74.323 1.00107.67 N
ATOM 291 CA LEU A 144 41.021 -17.182 -74.608 1.00107.67 C
ATOM 292 C LEU A 144 40.252 -16.155 -75.425 1.00107.67 C
ATOM 293 O LEU A 144 39.593 -16.499 -76.410 1.00107.67 O
ATOM 294 CB LEU A 144 42.310 -17.620 -75.311 1.00107.67 C
ATOM 295 CG LEU A 144 42.323 -18.337 -76.652 1.00107.67 C
ATOM 296 CD1 LEU A 144 42.495 -17.362 -77.805 1.00107.67 C
ATOM 297 CD2 LEU A 144 43.432 -19.352 -76.628 1.00107.67 C
ATOM 298 N VAL A 145 40.324 -14.900 -74.998 1.00106.15 N
ATOM 299 CA VAL A 145 39.610 -13.798 -75.624 1.00106.15 C
ATOM 300 C VAL A 145 40.633 -12.837 -76.205 1.00106.15 C
ATOM 301 O VAL A 145 41.444 -12.270 -75.467 1.00106.15 O
ATOM 302 CB VAL A 145 38.706 -13.078 -74.609 1.00106.15 C
ATOM 303 CG1 VAL A 145 38.067 -11.863 -75.231 1.00106.15 C
ATOM 304 CG2 VAL A 145 37.649 -14.016 -74.085 1.00106.15 C
ATOM 305 N ILE A 146 40.595 -12.647 -77.518 1.00112.43 N
ATOM 306 CA ILE A 146 41.399 -11.638 -78.196 1.00112.43 C
ATOM 307 C ILE A 146 40.525 -10.425 -78.483 1.00112.43 C
ATOM 308 O ILE A 146 39.466 -10.543 -79.109 1.00112.43 O
ATOM 309 CB ILE A 146 42.046 -12.188 -79.483 1.00112.43 C
ATOM 310 CG1 ILE A 146 43.006 -11.168 -80.110 1.00112.43 C
ATOM 311 CG2 ILE A 146 41.010 -12.689 -80.455 1.00112.43 C
ATOM 312 CD1 ILE A 146 43.895 -11.705 -81.166 1.00112.43 C
ATOM 313 N SER A 147 40.960 -9.266 -78.001 1.00110.62 N
ATOM 314 CA SER A 147 40.261 -8.012 -78.216 1.00110.62 C
ATOM 315 C SER A 147 41.206 -7.018 -78.867 1.00110.62 C
ATOM 316 O SER A 147 42.379 -6.930 -78.495 1.00110.62 O
ATOM 317 CB SER A 147 39.735 -7.445 -76.902 1.00110.62 C
ATOM 318 OG SER A 147 40.806 -7.081 -76.055 1.00110.62 O
ATOM 319 N VAL A 148 40.693 -6.281 -79.843 1.00119.15 N
ATOM 320 CA VAL A 148 41.462 -5.234 -80.494 1.00119.15 C
ATOM 321 C VAL A 148 40.803 -3.882 -80.262 1.00119.15 C
ATOM 322 O VAL A 148 39.670 -3.653 -80.685 1.00119.15 O
ATOM 323 CB VAL A 148 41.617 -5.508 -81.993 1.00119.15 C
ATOM 324 CG1 VAL A 148 42.342 -4.358 -82.658 1.00119.15 C
ATOM 325 CG2 VAL A 148 42.362 -6.809 -82.215 1.00119.15 C
ATOM 326 N LYS A 153 45.124 6.181 -81.150 1.00129.46 N
ATOM 327 CA LYS A 153 44.022 5.248 -80.957 1.00129.46 C
ATOM 328 C LYS A 153 43.261 5.556 -79.674 1.00129.46 C
ATOM 329 O LYS A 153 42.757 4.652 -79.011 1.00129.46 O
ATOM 330 CB LYS A 153 44.538 3.809 -80.926 1.00129.46 C
ATOM 331 N ASN A 154 43.184 6.838 -79.329 1.00129.68 N
ATOM 332 CA ASN A 154 42.490 7.248 -78.116 1.00129.68 C
ATOM 333 C ASN A 154 40.982 7.219 -78.321 1.00129.68 C
ATOM 334 O ASN A 154 40.483 7.437 -79.428 1.00129.68 O
ATOM 335 CB ASN A 154 42.935 8.647 -77.695 1.00129.68 C
ATOM 336 N PHE A 155 40.255 6.943 -77.241 1.00127.06 N
ATOM 337 CA PHE A 155 38.803 6.872 -77.273 1.00127.06 C
ATOM 338 C PHE A 155 38.250 7.368 -75.946 1.00127.06 C
ATOM 339 O PHE A 155 38.994 7.657 -75.007 1.00127.06 O
ATOM 340 CB PHE A 155 38.308 5.448 -77.556 1.00127.06 C
ATOM 341 N ALA A 156 36.926 7.467 -75.882 1.00124.64 N
ATOM 342 CA ALA A 156 36.223 7.945 -74.699 1.00124.64 C
ATOM 343 C ALA A 156 35.295 6.851 -74.191 1.00124.64 C
ATOM 344 O ALA A 156 34.687 6.127 -74.986 1.00124.64 O
ATOM 345 CB ALA A 156 35.437 9.218 -75.006 1.00124.64 C
ATOM 346 N LEU A 157 35.193 6.731 -72.871 1.00122.55 N
ATOM 347 CA LEU A 157 34.331 5.718 -72.284 1.00122.55 C
ATOM 348 C LEU A 157 32.883 6.191 -72.274 1.00122.55 C
ATOM 349 O LEU A 157 32.598 7.375 -72.084 1.00122.55 O
ATOM 350 CB LEU A 157 34.801 5.379 -70.864 1.00122.55 C
ATOM 351 CG LEU A 157 34.723 6.371 -69.693 1.00122.55 C
ATOM 352 CD1 LEU A 157 33.457 6.185 -68.850 1.00122.55 C
ATOM 353 CD2 LEU A 157 35.968 6.291 -68.822 1.00122.55 C
ATOM 354 N LYS A 158 31.971 5.252 -72.483 1.00129.76 N
ATOM 355 CA LYS A 158 30.544 5.489 -72.322 1.00129.76 C
ATOM 356 C LYS A 158 30.153 4.988 -70.937 1.00129.76 C
ATOM 357 O LYS A 158 30.910 4.219 -70.334 1.00129.76 O
ATOM 358 CB LYS A 158 29.759 4.777 -73.428 1.00129.76 C
ATOM 359 N PRO A 159 29.006 5.396 -70.384 1.00128.04 N
ATOM 360 CA PRO A 159 28.596 4.803 -69.099 1.00128.04 C
ATOM 361 C PRO A 159 28.092 3.372 -69.214 1.00128.04 C
ATOM 362 O PRO A 159 27.970 2.689 -68.191 1.00128.04 O
ATOM 363 CB PRO A 159 27.505 5.761 -68.604 1.00128.04 C
ATOM 364 CG PRO A 159 26.996 6.423 -69.827 1.00128.04 C
ATOM 365 CD PRO A 159 28.176 6.561 -70.735 1.00128.04 C
ATOM 366 N ARG A 160 27.785 2.893 -70.422 1.00128.62 N
ATOM 367 CA ARG A 160 27.350 1.509 -70.600 1.00128.62 C
ATOM 368 C ARG A 160 28.529 0.573 -70.853 1.00128.62 C
ATOM 369 O ARG A 160 28.570 -0.537 -70.313 1.00128.62 O
ATOM 370 CB ARG A 160 26.346 1.398 -71.753 1.00128.62 C
ATOM 371 CG ARG A 160 25.724 0.016 -71.860 1.00128.62 C
ATOM 372 CD ARG A 160 24.813 -0.121 -73.057 1.00128.62 C
ATOM 373 NE ARG A 160 25.567 -0.122 -74.304 1.00128.62 N
ATOM 374 CZ ARG A 160 25.010 -0.093 -75.508 1.00128.62 C
ATOM 375 NH1 ARG A 160 23.690 -0.065 -75.628 1.00128.62 N
ATOM 376 NH2 ARG A 160 25.771 -0.097 -76.594 1.00128.62 N
ATOM 377 N MET A 161 29.479 1.007 -71.688 1.00128.49 N
ATOM 378 CA MET A 161 30.633 0.217 -72.117 1.00128.49 C
ATOM 379 C MET A 161 31.506 -0.251 -70.958 1.00128.49 C
ATOM 380 O MET A 161 32.116 -1.327 -71.026 1.00128.49 O
ATOM 381 CB MET A 161 31.475 1.032 -73.095 1.00128.49 C
ATOM 382 CG MET A 161 30.771 1.342 -74.399 1.00128.49 C
ATOM 383 SD MET A 161 30.372 -0.129 -75.356 1.00128.49 S
ATOM 384 CE MET A 161 32.006 -0.647 -75.876 1.00128.49 C
ATOM 385 N ARG A 162 31.569 0.566 -69.900 1.00126.55 N
ATOM 386 CA ARG A 162 32.294 0.195 -68.688 1.00126.55 C
ATOM 387 C ARG A 162 31.698 -1.047 -68.040 1.00126.55 C
ATOM 388 O ARG A 162 32.433 -1.955 -67.626 1.00126.55 O
ATOM 389 CB ARG A 162 32.277 1.365 -67.708 1.00126.55 C
ATOM 390 N LYS A 163 30.364 -1.105 -67.962 1.00128.67 N
ATOM 391 CA LYS A 163 29.674 -2.291 -67.461 1.00128.67 C
ATOM 392 C LYS A 163 29.932 -3.501 -68.349 1.00128.67 C
ATOM 393 O LYS A 163 30.106 -4.618 -67.848 1.00128.67 O
ATOM 394 CB LYS A 163 28.176 -1.996 -67.349 1.00128.67 C
ATOM 395 CG LYS A 163 27.291 -3.144 -66.880 1.00128.67 C
ATOM 396 CD LYS A 163 26.483 -3.725 -68.037 1.00128.67 C
ATOM 397 CE LYS A 163 25.533 -4.804 -67.562 1.00128.67 C
ATOM 398 NZ LYS A 163 24.491 -4.250 -66.657 1.00128.67 N
ATOM 399 N ILE A 164 30.004 -3.287 -69.666 1.00122.87 N
ATOM 400 CA ILE A 164 30.231 -4.383 -70.607 1.00122.87 C
ATOM 401 C ILE A 164 31.620 -4.978 -70.422 1.00122.87 C
ATOM 402 O ILE A 164 31.785 -6.202 -70.359 1.00122.87 O
ATOM 403 CB ILE A 164 30.016 -3.886 -72.046 1.00122.87 C
ATOM 404 CG1 ILE A 164 28.579 -3.408 -72.214 1.00122.87 C
ATOM 405 CG2 ILE A 164 30.322 -4.980 -73.048 1.00122.87 C
ATOM 406 CD1 ILE A 164 28.335 -2.674 -73.501 1.00122.87 C
ATOM 407 N PHE A 165 32.633 -4.127 -70.282 1.00123.24 N
ATOM 408 CA PHE A 165 33.992 -4.646 -70.174 1.00123.24 C
ATOM 409 C PHE A 165 34.271 -5.212 -68.786 1.00123.24 C
ATOM 410 O PHE A 165 35.033 -6.182 -68.651 1.00123.24 O
ATOM 411 CB PHE A 165 34.982 -3.555 -70.561 1.00123.24 C
ATOM 412 CG PHE A 165 34.975 -3.253 -72.028 1.00123.24 C
ATOM 413 CD1 PHE A 165 34.527 -4.199 -72.937 1.00123.24 C
ATOM 414 CD2 PHE A 165 35.362 -2.013 -72.499 1.00123.24 C
ATOM 415 CE1 PHE A 165 34.500 -3.926 -74.289 1.00123.24 C
ATOM 416 CE2 PHE A 165 35.330 -1.733 -73.855 1.00123.24 C
ATOM 417 CZ PHE A 165 34.902 -2.693 -74.749 1.00123.24 C
ATOM 418 N SER A 166 33.633 -4.659 -67.748 1.00123.57 N
ATOM 419 CA SER A 166 33.721 -5.277 -66.428 1.00123.57 C
ATOM 420 C SER A 166 33.036 -6.638 -66.416 1.00123.57 C
ATOM 421 O SER A 166 33.527 -7.583 -65.785 1.00123.57 O
ATOM 422 CB SER A 166 33.106 -4.360 -65.374 1.00123.57 C
ATOM 423 OG SER A 166 31.711 -4.234 -65.569 1.00123.57 O
ATOM 424 N ARG A 167 31.923 -6.761 -67.145 1.00118.92 N
ATOM 425 CA ARG A 167 31.252 -8.045 -67.300 1.00118.92 C
ATOM 426 C ARG A 167 32.138 -9.047 -68.028 1.00118.92 C
ATOM 427 O ARG A 167 32.197 -10.225 -67.651 1.00118.92 O
ATOM 428 CB ARG A 167 29.943 -7.836 -68.058 1.00118.92 C
ATOM 429 CG ARG A 167 29.134 -9.087 -68.270 1.00118.92 C
ATOM 430 CD ARG A 167 28.641 -9.610 -66.947 1.00118.92 C
ATOM 431 NE ARG A 167 27.744 -8.658 -66.308 1.00118.92 N
ATOM 432 CZ ARG A 167 27.343 -8.744 -65.046 1.00118.92 C
ATOM 433 NH1 ARG A 167 27.761 -9.743 -64.282 1.00118.92 N
ATOM 434 NH2 ARG A 167 26.524 -7.830 -64.548 1.00118.92 N
ATOM 435 N LEU A 168 32.853 -8.584 -69.057 1.00113.41 N
ATOM 436 CA LEU A 168 33.724 -9.466 -69.827 1.00113.41 C
ATOM 437 C LEU A 168 34.882 -9.978 -68.981 1.00113.41 C
ATOM 438 O LEU A 168 35.206 -11.171 -69.018 1.00113.41 O
ATOM 439 CB LEU A 168 34.236 -8.729 -71.063 1.00113.41 C
ATOM 440 CG LEU A 168 34.928 -9.505 -72.182 1.00113.41 C
ATOM 441 CD1 LEU A 168 34.587 -8.837 -73.486 1.00113.41 C
ATOM 442 CD2 LEU A 168 36.438 -9.542 -72.029 1.00113.41 C
ATOM 443 N ILE A 169 35.504 -9.096 -68.197 1.00113.49 N
ATOM 444 CA ILE A 169 36.617 -9.531 -67.356 1.00113.49 C
ATOM 445 C ILE A 169 36.115 -10.411 -66.211 1.00113.49 C
ATOM 446 O ILE A 169 36.806 -11.346 -65.779 1.00113.49 O
ATOM 447 CB ILE A 169 37.409 -8.303 -66.870 1.00113.49 C
ATOM 448 CG1 ILE A 169 38.008 -7.587 -68.073 1.00113.49 C
ATOM 449 CG2 ILE A 169 38.551 -8.678 -65.949 1.00113.49 C
ATOM 450 CD1 ILE A 169 38.652 -6.277 -67.738 1.00113.49 C
ATOM 451 N TYR A 170 34.878 -10.185 -65.757 1.00115.22 N
ATOM 452 CA TYR A 170 34.293 -11.061 -64.746 1.00115.22 C
ATOM 453 C TYR A 170 34.070 -12.471 -65.284 1.00115.22 C
ATOM 454 O TYR A 170 34.351 -13.459 -64.592 1.00115.22 O
ATOM 455 CB TYR A 170 32.981 -10.467 -64.244 1.00115.22 C
ATOM 456 CG TYR A 170 32.349 -11.275 -63.148 1.00115.22 C
ATOM 457 CD1 TYR A 170 32.881 -11.268 -61.865 1.00115.22 C
ATOM 458 CD2 TYR A 170 31.219 -12.043 -63.390 1.00115.22 C
ATOM 459 CE1 TYR A 170 32.311 -12.005 -60.852 1.00115.22 C
ATOM 460 CE2 TYR A 170 30.639 -12.786 -62.382 1.00115.22 C
ATOM 461 CZ TYR A 170 31.190 -12.762 -61.114 1.00115.22 C
ATOM 462 OH TYR A 170 30.621 -13.498 -60.100 1.00115.22 O
ATOM 463 N ILE A 171 33.581 -12.579 -66.524 1.00111.46 N
ATOM 464 CA ILE A 171 33.431 -13.884 -67.169 1.00111.46 C
ATOM 465 C ILE A 171 34.790 -14.542 -67.370 1.00111.46 C
ATOM 466 O ILE A 171 34.952 -15.752 -67.156 1.00111.46 O
ATOM 467 CB ILE A 171 32.667 -13.730 -68.497 1.00111.46 C
ATOM 468 CG1 ILE A 171 31.232 -13.294 -68.229 1.00111.46 C
ATOM 469 CG2 ILE A 171 32.654 -15.017 -69.295 1.00111.46 C
ATOM 470 CD1 ILE A 171 30.510 -12.838 -69.464 1.00111.46 C
ATOM 471 N ALA A 172 35.797 -13.745 -67.737 1.00107.79 N
ATOM 472 CA ALA A 172 37.134 -14.282 -67.975 1.00107.79 C
ATOM 473 C ALA A 172 37.772 -14.803 -66.694 1.00107.79 C
ATOM 474 O ALA A 172 38.576 -15.741 -66.729 1.00107.79 O
ATOM 475 CB ALA A 172 38.019 -13.215 -68.609 1.00107.79 C
ATOM 476 N GLN A 173 37.437 -14.205 -65.553 1.00113.29 N
ATOM 477 CA GLN A 173 37.941 -14.740 -64.293 1.00113.29 C
ATOM 478 C GLN A 173 37.140 -15.958 -63.854 1.00113.29 C
ATOM 479 O GLN A 173 37.696 -16.891 -63.263 1.00113.29 O
ATOM 480 CB GLN A 173 37.921 -13.666 -63.208 1.00113.29 C
ATOM 481 CG GLN A 173 38.563 -14.095 -61.898 1.00113.29 C
ATOM 482 CD GLN A 173 38.583 -12.991 -60.868 1.00113.29 C
ATOM 483 OE1 GLN A 173 38.104 -11.885 -61.116 1.00113.29 O
ATOM 484 NE2 GLN A 173 39.129 -13.287 -59.698 1.00113.29 N
ATOM 485 N SER A 174 35.833 -15.968 -64.135 1.00109.84 N
ATOM 486 CA SER A 174 34.991 -17.077 -63.694 1.00109.84 C
ATOM 487 C SER A 174 35.316 -18.365 -64.442 1.00109.84 C
ATOM 488 O SER A 174 35.443 -19.427 -63.826 1.00109.84 O
ATOM 489 CB SER A 174 33.520 -16.721 -63.873 1.00109.84 C
ATOM 490 OG SER A 174 33.199 -16.612 -65.246 1.00109.84 O
ATOM 491 N LYS A 175 35.457 -18.296 -65.765 1.00100.44 N
ATOM 492 CA LYS A 175 35.799 -19.506 -66.505 1.00100.44 C
ATOM 493 C LYS A 175 37.282 -19.829 -66.399 1.00100.44 C
ATOM 494 O LYS A 175 37.660 -21.002 -66.330 1.00100.44 O
ATOM 495 CB LYS A 175 35.409 -19.365 -67.972 1.00100.44 C
ATOM 496 CG LYS A 175 33.936 -19.160 -68.203 1.00100.44 C
ATOM 497 CD LYS A 175 33.151 -20.387 -67.816 1.00100.44 C
ATOM 498 CE LYS A 175 31.695 -20.238 -68.211 1.00100.44 C
ATOM 499 NZ LYS A 175 31.002 -19.213 -67.387 1.00100.44 N
ATOM 500 N GLY A 176 38.132 -18.808 -66.413 1.00106.52 N
ATOM 501 CA GLY A 176 39.564 -19.011 -66.462 1.00106.52 C
ATOM 502 C GLY A 176 40.021 -18.894 -67.899 1.00106.52 C
ATOM 503 O GLY A 176 39.832 -19.830 -68.681 1.00106.52 O
ATOM 504 N ALA A 177 40.611 -17.765 -68.266 1.00108.71 N
ATOM 505 CA ALA A 177 40.851 -17.463 -69.668 1.00108.71 C
ATOM 506 C ALA A 177 42.099 -16.614 -69.854 1.00108.71 C
ATOM 507 O ALA A 177 42.769 -16.230 -68.895 1.00108.71 O
ATOM 508 CB ALA A 177 39.653 -16.740 -70.286 1.00108.71 C
ATOM 509 N TRP A 178 42.397 -16.331 -71.115 1.00105.82 N
ATOM 510 CA TRP A 178 43.496 -15.462 -71.499 1.00105.82 C
ATOM 511 C TRP A 178 42.957 -14.270 -72.267 1.00105.82 C
ATOM 512 O TRP A 178 42.102 -14.424 -73.143 1.00105.82 O
ATOM 513 CB TRP A 178 44.518 -16.206 -72.349 1.00105.82 C
ATOM 514 CG TRP A 178 45.405 -17.077 -71.560 1.00105.82 C
ATOM 515 CD1 TRP A 178 45.475 -17.144 -70.210 1.00105.82 C
ATOM 516 CD2 TRP A 178 46.381 -17.990 -72.061 1.00105.82 C
ATOM 517 NE1 TRP A 178 46.433 -18.044 -69.832 1.00105.82 N
ATOM 518 CE2 TRP A 178 46.999 -18.584 -70.952 1.00105.82 C
ATOM 519 CE3 TRP A 178 46.789 -18.367 -73.343 1.00105.82 C
ATOM 520 CZ2 TRP A 178 48.001 -19.539 -71.080 1.00105.82 C
ATOM 521 CZ3 TRP A 178 47.783 -19.314 -73.470 1.00105.82 C
ATOM 522 CH2 TRP A 178 48.379 -19.889 -72.346 1.00105.82 C
ATOM 523 N ILE A 179 43.448 -13.086 -71.929 1.00103.75 N
ATOM 524 CA ILE A 179 43.124 -11.866 -72.649 1.00103.75 C
ATOM 525 C ILE A 179 44.350 -11.456 -73.451 1.00103.75 C
ATOM 526 O ILE A 179 45.442 -11.308 -72.893 1.00103.75 O
ATOM 527 CB ILE A 179 42.684 -10.744 -71.698 1.00103.75 C
ATOM 528 CG1 ILE A 179 41.373 -11.102 -71.003 1.00103.75 C
ATOM 529 CG2 ILE A 179 42.554 -9.436 -72.446 1.00103.75 C
ATOM 530 CD1 ILE A 179 40.993 -10.133 -69.916 1.00103.75 C
ATOM 531 N PHE A 180 44.177 -11.291 -74.759 1.00105.37 N
ATOM 532 CA PHE A 180 45.211 -10.767 -75.632 1.00105.37 C
ATOM 533 C PHE A 180 44.804 -9.377 -76.087 1.00105.37 C
ATOM 534 O PHE A 180 43.766 -9.209 -76.731 1.00105.37 O
ATOM 535 CB PHE A 180 45.435 -11.687 -76.826 1.00105.37 C
ATOM 536 CG PHE A 180 46.113 -12.972 -76.473 1.00105.37 C
ATOM 537 CD1 PHE A 180 47.487 -13.034 -76.382 1.00105.37 C
ATOM 538 CD2 PHE A 180 45.379 -14.110 -76.206 1.00105.37 C
ATOM 539 CE1 PHE A 180 48.122 -14.211 -76.048 1.00105.37 C
ATOM 540 CE2 PHE A 180 46.007 -15.293 -75.871 1.00105.37 C
ATOM 541 CZ PHE A 180 47.383 -15.342 -75.792 1.00105.37 C
ATOM 542 N THR A 181 45.610 -8.382 -75.735 1.00113.95 N
ATOM 543 CA THR A 181 45.258 -6.997 -75.988 1.00113.95 C
ATOM 544 C THR A 181 46.388 -6.323 -76.742 1.00113.95 C
ATOM 545 O THR A 181 47.429 -6.925 -77.011 1.00113.95 O
ATOM 546 CB THR A 181 44.970 -6.236 -74.692 1.00113.95 C
ATOM 547 N GLY A 182 46.168 -5.051 -77.075 1.00124.47 N
ATOM 548 CA GLY A 182 47.138 -4.327 -77.883 1.00124.47 C
ATOM 549 C GLY A 182 48.407 -3.983 -77.127 1.00124.47 C
ATOM 550 O GLY A 182 49.462 -3.780 -77.731 1.00124.47 O
ATOM 551 N GLY A 183 48.323 -3.907 -75.802 1.00125.75 N
ATOM 552 CA GLY A 183 49.482 -3.521 -75.015 1.00125.75 C
ATOM 553 C GLY A 183 49.849 -2.064 -75.163 1.00125.75 C
ATOM 554 O GLY A 183 51.024 -1.707 -75.038 1.00125.75 O
ATOM 555 N THR A 184 48.864 -1.207 -75.419 1.00132.79 N
ATOM 556 CA THR A 184 49.080 0.192 -75.766 1.00132.79 C
ATOM 557 C THR A 184 49.519 0.976 -74.539 1.00132.79 C
ATOM 558 O THR A 184 49.538 0.437 -73.426 1.00132.79 O
ATOM 559 CB THR A 184 47.815 0.807 -76.363 1.00132.79 C
ATOM 560 N HIS A 185 49.915 2.229 -74.760 1.00136.89 N
ATOM 561 CA HIS A 185 50.307 3.157 -73.698 1.00136.89 C
ATOM 562 C HIS A 185 49.108 3.352 -72.773 1.00136.89 C
ATOM 563 O HIS A 185 49.124 2.820 -71.656 1.00136.89 O
ATOM 564 CB HIS A 185 50.845 4.425 -74.342 1.00136.89 C
ATOM 565 N TYR A 186 48.046 4.015 -73.219 1.00134.27 N
ATOM 566 CA TYR A 186 46.844 4.246 -72.432 1.00134.27 C
ATOM 567 C TYR A 186 45.681 4.435 -73.389 1.00134.27 C
ATOM 568 O TYR A 186 45.862 4.927 -74.507 1.00134.27 O
ATOM 569 CB TYR A 186 46.968 5.467 -71.508 1.00134.27 C
ATOM 570 CG TYR A 186 47.896 5.258 -70.338 1.00134.27 C
ATOM 571 CD1 TYR A 186 47.486 4.533 -69.228 1.00134.27 C
ATOM 572 CD2 TYR A 186 49.189 5.764 -70.350 1.00134.27 C
ATOM 573 CE1 TYR A 186 48.332 4.325 -68.156 1.00134.27 C
ATOM 574 CE2 TYR A 186 50.046 5.562 -69.281 1.00134.27 C
ATOM 575 CZ TYR A 186 49.611 4.842 -68.188 1.00134.27 C
ATOM 576 OH TYR A 186 50.457 4.638 -67.122 1.00134.27 O
ATOM 577 N GLY A 187 44.500 4.027 -72.950 1.00133.71 N
ATOM 578 CA GLY A 187 43.302 4.110 -73.752 1.00133.71 C
ATOM 579 C GLY A 187 42.285 3.105 -73.262 1.00133.71 C
ATOM 580 O GLY A 187 41.982 3.037 -72.067 1.00133.71 O
ATOM 581 N LEU A 188 41.761 2.307 -74.190 1.00128.29 N
ATOM 582 CA LEU A 188 40.812 1.269 -73.816 1.00128.29 C
ATOM 583 C LEU A 188 41.523 0.121 -73.105 1.00128.29 C
ATOM 584 O LEU A 188 40.990 -0.457 -72.145 1.00128.29 O
ATOM 585 CB LEU A 188 40.078 0.799 -75.072 1.00128.29 C
ATOM 586 N MET A 189 42.736 -0.208 -73.558 1.00123.61 N
ATOM 587 CA MET A 189 43.519 -1.272 -72.938 1.00123.61 C
ATOM 588 C MET A 189 43.944 -0.889 -71.527 1.00123.61 C
ATOM 589 O MET A 189 44.083 -1.750 -70.651 1.00123.61 O
ATOM 590 CB MET A 189 44.738 -1.591 -73.803 1.00123.61 C
ATOM 591 N LYS A 190 44.137 0.407 -71.288 1.00121.53 N
ATOM 592 CA LYS A 190 44.395 0.924 -69.951 1.00121.53 C
ATOM 593 C LYS A 190 43.216 0.665 -69.027 1.00121.53 C
ATOM 594 O LYS A 190 43.401 0.273 -67.871 1.00121.53 O
ATOM 595 CB LYS A 190 44.683 2.420 -70.002 1.00121.53 C
ATOM 596 N TYR A 191 42.001 0.867 -69.537 1.00118.93 N
ATOM 597 CA TYR A 191 40.816 0.636 -68.720 1.00118.93 C
ATOM 598 C TYR A 191 40.623 -0.849 -68.442 1.00118.93 C
ATOM 599 O TYR A 191 40.201 -1.235 -67.344 1.00118.93 O
ATOM 600 CB TYR A 191 39.579 1.223 -69.396 1.00118.93 C
ATOM 601 CG TYR A 191 38.354 1.079 -68.540 1.00118.93 C
ATOM 602 CD1 TYR A 191 38.207 1.840 -67.391 1.00118.93 C
ATOM 603 CD2 TYR A 191 37.351 0.182 -68.871 1.00118.93 C
ATOM 604 CE1 TYR A 191 37.100 1.713 -66.593 1.00118.93 C
ATOM 605 CE2 TYR A 191 36.233 0.049 -68.079 1.00118.93 C
ATOM 606 CZ TYR A 191 36.115 0.819 -66.941 1.00118.93 C
ATOM 607 OH TYR A 191 35.014 0.698 -66.133 1.00118.93 O
ATOM 608 N ILE A 192 40.937 -1.696 -69.431 1.00119.23 N
ATOM 609 CA ILE A 192 40.890 -3.142 -69.216 1.00119.23 C
ATOM 610 C ILE A 192 41.900 -3.561 -68.154 1.00119.23 C
ATOM 611 O ILE A 192 41.574 -4.342 -67.254 1.00119.23 O
ATOM 612 CB ILE A 192 41.104 -3.899 -70.541 1.00119.23 C
ATOM 613 CG1 ILE A 192 39.910 -3.704 -71.469 1.00119.23 C
ATOM 614 CG2 ILE A 192 41.307 -5.382 -70.313 1.00119.23 C
ATOM 615 CD1 ILE A 192 40.104 -4.343 -72.822 1.00119.23 C
ATOM 616 N GLY A 193 43.118 -3.014 -68.211 1.00114.79 N
ATOM 617 CA GLY A 193 44.111 -3.317 -67.187 1.00114.79 C
ATOM 618 C GLY A 193 43.711 -2.823 -65.808 1.00114.79 C
ATOM 619 O GLY A 193 43.985 -3.479 -64.798 1.00114.79 O
ATOM 620 N GLU A 194 43.018 -1.683 -65.754 1.00110.99 N
ATOM 621 CA GLU A 194 42.525 -1.164 -64.481 1.00110.99 C
ATOM 622 C GLU A 194 41.458 -2.074 -63.883 1.00110.99 C
ATOM 623 O GLU A 194 41.488 -2.369 -62.680 1.00110.99 O
ATOM 624 CB GLU A 194 41.979 0.250 -64.670 1.00110.99 C
ATOM 625 N VAL A 195 40.519 -2.543 -64.708 1.00108.66 N
ATOM 626 CA VAL A 195 39.467 -3.426 -64.203 1.00108.66 C
ATOM 627 C VAL A 195 40.047 -4.792 -63.833 1.00108.66 C
ATOM 628 O VAL A 195 39.590 -5.440 -62.881 1.00108.66 O
ATOM 629 CB VAL A 195 38.319 -3.514 -65.231 1.00108.66 C
ATOM 630 CG1 VAL A 195 37.227 -4.471 -64.797 1.00108.66 C
ATOM 631 CG2 VAL A 195 37.706 -2.147 -65.429 1.00108.66 C
ATOM 632 N VAL A 196 41.106 -5.217 -64.534 1.00108.66 N
ATOM 633 CA VAL A 196 41.834 -6.430 -64.157 1.00108.66 C
ATOM 634 C VAL A 196 42.457 -6.285 -62.776 1.00108.66 C
ATOM 635 O VAL A 196 42.318 -7.177 -61.929 1.00108.66 O
ATOM 636 CB VAL A 196 42.890 -6.779 -65.225 1.00108.66 C
ATOM 637 CG1 VAL A 196 43.913 -7.755 -64.688 1.00108.66 C
ATOM 638 CG2 VAL A 196 42.216 -7.420 -66.411 1.00108.66 C
ATOM 639 N ARG A 197 43.127 -5.155 -62.519 1.00106.04 N
ATOM 640 CA ARG A 197 43.722 -4.924 -61.203 1.00106.04 C
ATOM 641 C ARG A 197 42.658 -4.862 -60.116 1.00106.04 C
ATOM 642 O ARG A 197 42.842 -5.415 -59.022 1.00106.04 O
ATOM 643 CB ARG A 197 44.543 -3.637 -61.212 1.00106.04 C
ATOM 644 CG ARG A 197 45.253 -3.344 -59.899 1.00106.04 C
ATOM 645 CD ARG A 197 46.103 -2.085 -59.990 1.00106.04 C
ATOM 646 NE ARG A 197 45.309 -0.885 -60.240 1.00106.04 N
ATOM 647 CZ ARG A 197 44.717 -0.168 -59.291 1.00106.04 C
ATOM 648 NH1 ARG A 197 44.831 -0.524 -58.020 1.00106.04 N
ATOM 649 NH2 ARG A 197 44.016 0.910 -59.613 1.00106.04 N
ATOM 650 N ASP A 198 41.513 -4.251 -60.436 1.00102.75 N
ATOM 651 CA ASP A 198 40.412 -4.158 -59.485 1.00102.75 C
ATOM 652 C ASP A 198 39.841 -5.530 -59.147 1.00102.75 C
ATOM 653 O ASP A 198 39.559 -5.821 -57.981 1.00102.75 O
ATOM 654 CB ASP A 198 39.322 -3.247 -60.046 1.00102.75 C
ATOM 655 N ASN A 199 39.685 -6.397 -60.146 1.00107.09 N
ATOM 656 CA ASN A 199 39.109 -7.708 -59.870 1.00107.09 C
ATOM 657 C ASN A 199 40.129 -8.650 -59.242 1.00107.09 C
ATOM 658 O ASN A 199 39.752 -9.634 -58.596 1.00107.09 O
ATOM 659 CB ASN A 199 38.519 -8.306 -61.144 1.00107.09 C
ATOM 660 CG ASN A 199 37.215 -7.640 -61.545 1.00107.09 C
ATOM 661 OD1 ASN A 199 36.371 -7.352 -60.701 1.00107.09 O
ATOM 662 ND2 ASN A 199 37.045 -7.397 -62.836 1.00107.09 N
ATOM 663 N THR A 200 41.424 -8.379 -59.418 1.00103.21 N
ATOM 664 CA THR A 200 42.413 -9.152 -58.673 1.00103.21 C
ATOM 665 C THR A 200 42.421 -8.765 -57.204 1.00103.21 C
ATOM 666 O THR A 200 42.564 -9.631 -56.334 1.00103.21 O
ATOM 667 CB THR A 200 43.815 -8.991 -59.253 1.00103.21 C
ATOM 668 OG1 THR A 200 44.149 -7.603 -59.340 1.00103.21 O
ATOM 669 CG2 THR A 200 43.934 -9.669 -60.602 1.00103.21 C
ATOM 670 N ILE A 201 42.281 -7.473 -56.895 1.00 96.25 N
ATOM 671 CA ILE A 201 42.259 -7.103 -55.481 1.00 96.25 C
ATOM 672 C ILE A 201 40.879 -7.355 -54.881 1.00 96.25 C
ATOM 673 O ILE A 201 40.709 -7.339 -53.657 1.00 96.25 O
ATOM 674 CB ILE A 201 42.744 -5.652 -55.271 1.00 96.25 C
ATOM 675 CG1 ILE A 201 41.911 -4.618 -56.031 1.00 96.25 C
ATOM 676 CG2 ILE A 201 44.206 -5.526 -55.658 1.00 96.25 C
ATOM 677 CD1 ILE A 201 40.828 -3.933 -55.223 1.00 96.25 C
ATOM 678 N SER A 202 39.874 -7.594 -55.725 1.00101.02 N
ATOM 679 CA SER A 202 38.543 -7.899 -55.213 1.00101.02 C
ATOM 680 C SER A 202 38.446 -9.341 -54.727 1.00101.02 C
ATOM 681 O SER A 202 38.149 -9.586 -53.552 1.00101.02 O
ATOM 682 CB SER A 202 37.497 -7.628 -56.291 1.00101.02 C
ATOM 683 OG SER A 202 36.202 -7.968 -55.835 1.00101.02 O
ATOM 684 N ARG A 203 38.702 -10.307 -55.611 1.00109.45 N
ATOM 685 CA ARG A 203 38.497 -11.725 -55.335 1.00109.45 C
ATOM 686 C ARG A 203 39.835 -12.416 -55.126 1.00109.45 C
ATOM 687 O ARG A 203 40.884 -11.874 -55.488 1.00109.45 O
ATOM 688 CB ARG A 203 37.746 -12.412 -56.480 1.00109.45 C
ATOM 689 CG ARG A 203 36.279 -12.053 -56.579 1.00109.45 C
ATOM 690 CD ARG A 203 35.597 -12.854 -57.675 1.00109.45 C
ATOM 691 N SER A 204 39.794 -13.609 -54.533 1.00115.41 N
ATOM 692 CA SER A 204 40.993 -14.422 -54.333 1.00115.41 C
ATOM 693 C SER A 204 41.026 -15.547 -55.371 1.00115.41 C
ATOM 694 O SER A 204 40.685 -16.703 -55.111 1.00115.41 O
ATOM 695 CB SER A 204 41.038 -14.963 -52.911 1.00115.41 C
ATOM 696 N SER A 205 41.445 -15.179 -56.579 1.00117.94 N
ATOM 697 CA SER A 205 41.631 -16.136 -57.660 1.00117.94 C
ATOM 698 C SER A 205 42.802 -15.678 -58.511 1.00117.94 C
ATOM 699 O SER A 205 43.364 -14.600 -58.297 1.00117.94 O
ATOM 700 CB SER A 205 40.371 -16.290 -58.518 1.00117.94 C
ATOM 701 N GLU A 206 43.169 -16.506 -59.481 1.00116.96 N
ATOM 702 CA GLU A 206 44.315 -16.241 -60.336 1.00116.96 C
ATOM 703 C GLU A 206 43.864 -16.190 -61.786 1.00116.96 C
ATOM 704 O GLU A 206 43.328 -17.172 -62.309 1.00116.96 O
ATOM 705 CB GLU A 206 45.395 -17.307 -60.150 1.00116.96 C
ATOM 706 N GLU A 207 44.080 -15.047 -62.429 1.00114.01 N
ATOM 707 CA GLU A 207 43.797 -14.884 -63.845 1.00114.01 C
ATOM 708 C GLU A 207 44.790 -13.896 -64.428 1.00114.01 C
ATOM 709 O GLU A 207 45.317 -13.041 -63.713 1.00114.01 O
ATOM 710 CB GLU A 207 42.354 -14.426 -64.083 1.00114.01 C
ATOM 711 CG GLU A 207 41.982 -13.074 -63.521 1.00114.01 C
ATOM 712 CD GLU A 207 42.157 -11.975 -64.531 1.00114.01 C
ATOM 713 OE1 GLU A 207 42.261 -12.305 -65.730 1.00114.01 O
ATOM 714 OE2 GLU A 207 42.184 -10.796 -64.132 1.00114.01 O
ATOM 715 N ASN A 208 45.033 -14.008 -65.728 1.00108.93 N
ATOM 716 CA ASN A 208 46.159 -13.350 -66.370 1.00108.93 C
ATOM 717 C ASN A 208 45.752 -12.727 -67.695 1.00108.93 C
ATOM 718 O ASN A 208 44.690 -13.042 -68.236 1.00108.93 O
ATOM 719 CB ASN A 208 47.289 -14.351 -66.574 1.00108.93 C
ATOM 720 CG ASN A 208 46.801 -15.645 -67.184 1.00108.93 C
ATOM 721 OD1 ASN A 208 45.614 -15.797 -67.467 1.00108.93 O
ATOM 722 ND2 ASN A 208 47.713 -16.586 -67.385 1.00108.93 N
ATOM 723 N VAL A 209 46.604 -11.843 -68.205 1.00106.98 N
ATOM 724 CA VAL A 209 46.390 -11.146 -69.468 1.00106.98 C
ATOM 725 C VAL A 209 47.742 -10.974 -70.155 1.00106.98 C
ATOM 726 O VAL A 209 48.698 -10.443 -69.578 1.00106.98 O
ATOM 727 CB VAL A 209 45.661 -9.811 -69.271 1.00106.98 C
ATOM 728 N VAL A 210 47.846 -11.464 -71.380 1.00106.10 N
ATOM 729 CA VAL A 210 49.072 -11.323 -72.149 1.00106.10 C
ATOM 730 C VAL A 210 48.891 -10.195 -73.153 1.00106.10 C
ATOM 731 O VAL A 210 48.088 -10.304 -74.084 1.00106.10 O
ATOM 732 CB VAL A 210 49.425 -12.643 -72.844 1.00106.10 C
ATOM 733 CG1 VAL A 210 50.671 -12.480 -73.686 1.00106.10 C
ATOM 734 CG2 VAL A 210 49.600 -13.735 -71.815 1.00106.10 C
ATOM 735 N ALA A 211 49.641 -9.112 -72.977 1.00113.62 N
ATOM 736 CA ALA A 211 49.494 -7.913 -73.795 1.00113.62 C
ATOM 737 C ALA A 211 50.675 -7.782 -74.745 1.00113.62 C
ATOM 738 O ALA A 211 51.698 -7.189 -74.390 1.00113.62 O
ATOM 739 CB ALA A 211 49.378 -6.667 -72.920 1.00113.62 C
ATOM 740 N ILE A 212 50.523 -8.310 -75.952 1.00117.96 N
ATOM 741 CA ILE A 212 51.574 -8.255 -76.956 1.00117.96 C
ATOM 742 C ILE A 212 51.677 -6.864 -77.559 1.00117.96 C
ATOM 743 O ILE A 212 50.717 -6.363 -78.137 1.00117.96 O
ATOM 744 CB ILE A 212 51.339 -9.305 -78.045 1.00117.96 C
ATOM 745 CG1 ILE A 212 51.495 -10.708 -77.463 1.00117.96 C
ATOM 746 CG2 ILE A 212 52.280 -9.097 -79.211 1.00117.96 C
ATOM 747 CD1 ILE A 212 51.029 -11.803 -78.389 1.00117.96 C
ATOM 748 N ARG A 247 63.829 -4.564 -78.096 1.00142.24 N
ATOM 749 CA ARG A 247 64.084 -4.298 -79.508 1.00142.24 C
ATOM 750 C ARG A 247 62.903 -3.594 -80.161 1.00142.24 C
ATOM 751 O ARG A 247 63.079 -2.835 -81.121 1.00142.24 O
ATOM 752 CB ARG A 247 64.403 -5.602 -80.240 1.00142.24 C
ATOM 753 N ASP A 248 61.697 -3.840 -79.668 1.00140.63 N
ATOM 754 CA ASP A 248 60.538 -3.131 -80.179 1.00140.63 C
ATOM 755 C ASP A 248 60.582 -1.676 -79.719 1.00140.63 C
ATOM 756 O ASP A 248 60.775 -1.409 -78.526 1.00140.63 O
ATOM 757 CB ASP A 248 59.246 -3.796 -79.699 1.00140.63 C
ATOM 758 N PRO A 249 60.429 -0.717 -80.624 1.00145.90 N
ATOM 759 CA PRO A 249 60.403 0.691 -80.210 1.00145.90 C
ATOM 760 C PRO A 249 59.100 1.060 -79.520 1.00145.90 C
ATOM 761 O PRO A 249 58.218 1.685 -80.115 1.00145.90 O
ATOM 762 CB PRO A 249 60.582 1.447 -81.531 1.00145.90 C
ATOM 763 CG PRO A 249 60.070 0.506 -82.572 1.00145.90 C
ATOM 764 CD PRO A 249 60.402 -0.872 -82.088 1.00145.90 C
ATOM 765 N LEU A 250 58.978 0.681 -78.254 1.00144.67 N
ATOM 766 CA LEU A 250 57.727 0.861 -77.538 1.00144.67 C
ATOM 767 C LEU A 250 57.607 2.276 -76.991 1.00144.67 C
ATOM 768 O LEU A 250 58.600 2.992 -76.843 1.00144.67 O
ATOM 769 CB LEU A 250 57.622 -0.147 -76.395 1.00144.67 C
ATOM 770 N TYR A 251 56.377 2.669 -76.685 1.00148.13 N
ATOM 771 CA TYR A 251 56.077 3.931 -76.026 1.00148.13 C
ATOM 772 C TYR A 251 56.125 3.707 -74.515 1.00148.13 C
ATOM 773 O TYR A 251 56.711 2.729 -74.044 1.00148.13 O
ATOM 774 CB TYR A 251 54.724 4.457 -76.505 1.00148.13 C
ATOM 775 CG TYR A 251 54.695 4.748 -77.980 1.00148.13 C
ATOM 776 CD1 TYR A 251 55.275 5.902 -78.489 1.00148.13 C
ATOM 777 CD2 TYR A 251 54.087 3.868 -78.866 1.00148.13 C
ATOM 778 CE1 TYR A 251 55.255 6.171 -79.844 1.00148.13 C
ATOM 779 CE2 TYR A 251 54.059 4.128 -80.222 1.00148.13 C
ATOM 780 CZ TYR A 251 54.644 5.282 -80.705 1.00148.13 C
ATOM 781 OH TYR A 251 54.618 5.549 -82.055 1.00148.13 O
ATOM 782 N CYS A 252 55.561 4.628 -73.736 1.00142.30 N
ATOM 783 CA CYS A 252 55.305 4.353 -72.328 1.00142.30 C
ATOM 784 C CYS A 252 54.289 3.223 -72.198 1.00142.30 C
ATOM 785 O CYS A 252 53.501 2.969 -73.108 1.00142.30 O
ATOM 786 CB CYS A 252 54.800 5.610 -71.621 1.00142.30 C
ATOM 787 SG CYS A 252 53.233 6.249 -72.253 1.00142.30 S
ATOM 788 N LEU A 253 54.320 2.524 -71.071 1.00131.86 N
ATOM 789 CA LEU A 253 53.530 1.313 -70.900 1.00131.86 C
ATOM 790 C LEU A 253 52.468 1.523 -69.834 1.00131.86 C
ATOM 791 O LEU A 253 52.655 2.322 -68.911 1.00131.86 O
ATOM 792 CB LEU A 253 54.407 0.120 -70.511 1.00131.86 C
ATOM 793 CG LEU A 253 55.149 -0.693 -71.573 1.00131.86 C
ATOM 794 CD1 LEU A 253 56.333 0.054 -72.149 1.00131.86 C
ATOM 795 CD2 LEU A 253 55.605 -2.000 -70.961 1.00131.86 C
ATOM 796 N ASP A 254 51.358 0.804 -69.967 1.00125.63 N
ATOM 797 CA ASP A 254 50.405 0.646 -68.879 1.00125.63 C
ATOM 798 C ASP A 254 50.911 -0.484 -67.996 1.00125.63 C
ATOM 799 O ASP A 254 50.835 -1.657 -68.375 1.00125.63 O
ATOM 800 CB ASP A 254 49.006 0.342 -69.408 1.00125.63 C
ATOM 801 N ASN A 255 51.428 -0.131 -66.825 1.00121.25 N
ATOM 802 CA ASN A 255 52.138 -1.086 -65.976 1.00121.25 C
ATOM 803 C ASN A 255 51.164 -1.799 -65.040 1.00121.25 C
ATOM 804 O ASN A 255 51.201 -1.661 -63.820 1.00121.25 O
ATOM 805 CB ASN A 255 53.240 -0.377 -65.200 1.00121.25 C
ATOM 806 N ASN A 256 50.270 -2.577 -65.648 1.00110.90 N
ATOM 807 CA ASN A 256 49.256 -3.290 -64.895 1.00110.90 C
ATOM 808 C ASN A 256 49.076 -4.736 -65.334 1.00110.90 C
ATOM 809 O ASN A 256 48.476 -5.517 -64.590 1.00110.90 O
ATOM 810 CB ASN A 256 47.914 -2.560 -65.010 1.00110.90 C
ATOM 811 CG ASN A 256 47.075 -2.692 -63.768 1.00110.90 C
ATOM 812 OD1 ASN A 256 46.110 -1.957 -63.588 1.00110.90 O
ATOM 813 ND2 ASN A 256 47.462 -3.597 -62.880 1.00110.90 N
ATOM 814 N HIS A 257 49.569 -5.106 -66.510 1.00109.22 N
ATOM 815 CA HIS A 257 49.403 -6.449 -67.032 1.00109.22 C
ATOM 816 C HIS A 257 50.318 -7.434 -66.309 1.00109.22 C
ATOM 817 O HIS A 257 51.231 -7.052 -65.576 1.00109.22 O
ATOM 818 CB HIS A 257 49.682 -6.463 -68.531 1.00109.22 C
ATOM 819 CG HIS A 257 48.692 -5.679 -69.336 1.00109.22 C
ATOM 820 ND1 HIS A 257 47.436 -6.157 -69.636 1.00109.22 N
ATOM 821 CD2 HIS A 257 48.770 -4.450 -69.898 1.00109.22 C
ATOM 822 CE1 HIS A 257 46.785 -5.261 -70.355 1.00109.22 C
ATOM 823 NE2 HIS A 257 47.572 -4.215 -70.527 1.00109.22 N
ATOM 824 N THR A 258 50.052 -8.722 -66.521 1.00106.75 N
ATOM 825 CA THR A 258 50.822 -9.791 -65.896 1.00106.75 C
ATOM 826 C THR A 258 51.958 -10.278 -66.790 1.00106.75 C
ATOM 827 O THR A 258 53.052 -10.574 -66.301 1.00106.75 O
ATOM 828 CB THR A 258 49.889 -10.948 -65.527 1.00106.75 C
ATOM 829 OG1 THR A 258 48.868 -10.462 -64.651 1.00106.75 O
ATOM 830 CG2 THR A 258 50.629 -12.060 -64.808 1.00106.75 C
ATOM 831 N HIS A 259 51.741 -10.340 -68.099 1.00109.10 N
ATOM 832 CA HIS A 259 52.793 -10.715 -69.039 1.00109.10 C
ATOM 833 C HIS A 259 52.650 -9.828 -70.262 1.00109.10 C
ATOM 834 O HIS A 259 51.531 -9.579 -70.715 1.00109.10 O
ATOM 835 CB HIS A 259 52.699 -12.185 -69.428 1.00109.10 C
ATOM 836 CG HIS A 259 52.861 -13.121 -68.275 1.00109.10 C
ATOM 837 ND1 HIS A 259 54.085 -13.398 -67.709 1.00109.10 N
ATOM 838 CD2 HIS A 259 51.950 -13.832 -67.572 1.00109.10 C
ATOM 839 CE1 HIS A 259 53.924 -14.249 -66.712 1.00109.10 C
ATOM 840 NE2 HIS A 259 52.637 -14.527 -66.607 1.00109.10 N
ATOM 841 N LEU A 260 53.766 -9.336 -70.784 1.00114.81 N
ATOM 842 CA LEU A 260 53.753 -8.522 -71.995 1.00114.81 C
ATOM 843 C LEU A 260 54.995 -8.859 -72.813 1.00114.81 C
ATOM 844 O LEU A 260 56.116 -8.869 -72.303 1.00114.81 O
ATOM 845 CB LEU A 260 53.638 -7.037 -71.636 1.00114.81 C
ATOM 846 CG LEU A 260 54.639 -6.346 -70.715 1.00114.81 C
ATOM 847 CD1 LEU A 260 55.766 -5.701 -71.505 1.00114.81 C
ATOM 848 CD2 LEU A 260 53.926 -5.325 -69.847 1.00114.81 C
ATOM 849 N LEU A 261 54.778 -9.182 -74.084 1.00122.61 N
ATOM 850 CA LEU A 261 55.827 -9.678 -74.973 1.00122.61 C
ATOM 851 C LEU A 261 55.816 -8.827 -76.238 1.00122.61 C
ATOM 852 O LEU A 261 54.830 -8.790 -76.971 1.00122.61 O
ATOM 853 CB LEU A 261 55.616 -11.152 -75.297 1.00122.61 C
ATOM 854 CG LEU A 261 56.047 -12.229 -74.298 1.00122.61 C
ATOM 855 CD1 LEU A 261 55.098 -12.365 -73.113 1.00122.61 C
ATOM 856 CD2 LEU A 261 56.193 -13.558 -75.012 1.00122.61 C
ATOM 857 N LEU A 262 56.928 -8.147 -76.505 1.00129.41 N
ATOM 858 CA LEU A 262 57.056 -7.304 -77.686 1.00129.41 C
ATOM 859 C LEU A 262 58.195 -7.794 -78.565 1.00129.41 C
ATOM 860 O LEU A 262 59.156 -8.394 -78.071 1.00129.41 O
ATOM 861 CB LEU A 262 57.270 -5.844 -77.298 1.00129.41 C
ATOM 862 CG LEU A 262 56.027 -5.198 -76.693 1.00129.41 C
ATOM 863 CD1 LEU A 262 56.344 -3.805 -76.190 1.00129.41 C
ATOM 864 CD2 LEU A 262 54.911 -5.159 -77.728 1.00129.41 C
ATOM 865 N VAL A 263 58.078 -7.539 -79.863 1.00131.01 N
ATOM 866 CA VAL A 263 59.058 -7.996 -80.838 1.00131.01 C
ATOM 867 C VAL A 263 59.893 -6.831 -81.353 1.00131.01 C
ATOM 868 O VAL A 263 59.918 -6.553 -82.552 1.00131.01 O
ATOM 869 CB VAL A 263 58.374 -8.723 -82.005 1.00131.01 C
ATOM 870 N ILE A 273 55.120 -2.001 -87.847 1.00140.28 N
ATOM 871 CA ILE A 273 54.016 -2.231 -86.929 1.00140.28 C
ATOM 872 C ILE A 273 53.133 -3.349 -87.455 1.00140.28 C
ATOM 873 O ILE A 273 51.932 -3.167 -87.638 1.00140.28 O
ATOM 874 CB ILE A 273 53.198 -0.951 -86.705 1.00140.28 C
ATOM 875 N GLU A 274 53.735 -4.508 -87.699 1.00144.47 N
ATOM 876 CA GLU A 274 53.021 -5.686 -88.171 1.00144.47 C
ATOM 877 C GLU A 274 52.859 -6.661 -87.015 1.00144.47 C
ATOM 878 O GLU A 274 53.814 -6.893 -86.265 1.00144.47 O
ATOM 879 CB GLU A 274 53.768 -6.354 -89.326 1.00144.47 C
ATOM 880 N ALA A 275 51.641 -7.194 -86.850 1.00140.89 N
ATOM 881 CA ALA A 275 51.389 -8.144 -85.770 1.00140.89 C
ATOM 882 C ALA A 275 52.180 -9.430 -85.963 1.00140.89 C
ATOM 883 O ALA A 275 53.088 -9.727 -85.178 1.00140.89 O
ATOM 884 CB ALA A 275 49.893 -8.443 -85.681 1.00140.89 C
ATOM 885 N LYS A 276 51.822 -10.226 -86.975 1.00140.90 N
ATOM 886 CA LYS A 276 52.642 -11.273 -87.592 1.00140.90 C
ATOM 887 C LYS A 276 53.041 -12.445 -86.692 1.00140.90 C
ATOM 888 O LYS A 276 53.651 -13.404 -87.173 1.00140.90 O
ATOM 889 CB LYS A 276 53.910 -10.654 -88.189 1.00140.90 C
ATOM 890 N VAL A 277 52.728 -12.382 -85.400 1.00134.46 N
ATOM 891 CA VAL A 277 52.849 -13.514 -84.490 1.00134.46 C
ATOM 892 C VAL A 277 51.577 -13.697 -83.676 1.00134.46 C
ATOM 893 O VAL A 277 51.326 -14.779 -83.145 1.00134.46 O
ATOM 894 CB VAL A 277 54.075 -13.360 -83.562 1.00134.46 C
ATOM 895 CG1 VAL A 277 55.377 -13.500 -84.331 1.00134.46 C
ATOM 896 CG2 VAL A 277 54.032 -12.025 -82.841 1.00134.46 C
ATOM 897 N ARG A 278 50.789 -12.625 -83.574 1.00130.43 N
ATOM 898 CA ARG A 278 49.501 -12.571 -82.898 1.00130.43 C
ATOM 899 C ARG A 278 48.561 -13.578 -83.542 1.00130.43 C
ATOM 900 O ARG A 278 48.120 -14.549 -82.910 1.00130.43 O
ATOM 901 CB ARG A 278 48.945 -11.150 -83.019 1.00130.43 C
ATOM 902 CG ARG A 278 47.768 -10.766 -82.147 1.00130.43 C
ATOM 903 CD ARG A 278 47.405 -9.323 -82.477 1.00130.43 C
ATOM 904 NE ARG A 278 46.355 -8.751 -81.641 1.00130.43 N
ATOM 905 CZ ARG A 278 46.595 -8.050 -80.538 1.00130.43 C
ATOM 906 NH1 ARG A 278 47.842 -7.838 -80.152 1.00130.43 N
ATOM 907 NH2 ARG A 278 45.597 -7.546 -79.829 1.00130.43 N
ATOM 908 N THR A 279 48.298 -13.353 -84.826 1.00131.97 N
ATOM 909 CA THR A 279 47.499 -14.237 -85.661 1.00131.97 C
ATOM 910 C THR A 279 48.117 -15.623 -85.768 1.00131.97 C
ATOM 911 O THR A 279 47.393 -16.620 -85.834 1.00131.97 O
ATOM 912 CB THR A 279 47.342 -13.626 -87.047 1.00131.97 C
ATOM 913 OG1 THR A 279 48.635 -13.477 -87.645 1.00131.97 O
ATOM 914 CG2 THR A 279 46.683 -12.264 -86.944 1.00131.97 C
ATOM 915 N GLN A 280 49.450 -15.696 -85.775 1.00132.45 N
ATOM 916 CA GLN A 280 50.119 -16.990 -85.869 1.00132.45 C
ATOM 917 C GLN A 280 49.922 -17.810 -84.601 1.00132.45 C
ATOM 918 O GLN A 280 49.663 -19.018 -84.669 1.00132.45 O
ATOM 919 CB GLN A 280 51.605 -16.791 -86.158 1.00132.45 C
ATOM 920 CG GLN A 280 51.881 -16.151 -87.504 1.00132.45 C
ATOM 921 CD GLN A 280 51.486 -17.040 -88.660 1.00132.45 C
ATOM 922 OE1 GLN A 280 51.673 -18.254 -88.613 1.00132.45 O
ATOM 923 NE2 GLN A 280 50.936 -16.440 -89.707 1.00132.45 N
ATOM 924 N LEU A 281 50.019 -17.167 -83.435 1.00129.02 N
ATOM 925 CA LEU A 281 49.723 -17.842 -82.176 1.00129.02 C
ATOM 926 C LEU A 281 48.266 -18.274 -82.091 1.00129.02 C
ATOM 927 O LEU A 281 47.977 -19.384 -81.619 1.00129.02 O
ATOM 928 CB LEU A 281 50.058 -16.927 -80.999 1.00129.02 C
ATOM 929 CG LEU A 281 49.827 -17.489 -79.597 1.00129.02 C
ATOM 930 CD1 LEU A 281 50.741 -18.671 -79.344 1.00129.02 C
ATOM 931 CD2 LEU A 281 50.025 -16.412 -78.547 1.00129.02 C
ATOM 932 N GLU A 282 47.348 -17.427 -82.563 1.00131.26 N
ATOM 933 CA GLU A 282 45.935 -17.786 -82.554 1.00131.26 C
ATOM 934 C GLU A 282 45.637 -18.950 -83.493 1.00131.26 C
ATOM 935 O GLU A 282 44.816 -19.815 -83.170 1.00131.26 O
ATOM 936 CB GLU A 282 45.098 -16.566 -82.918 1.00131.26 C
ATOM 937 CG GLU A 282 45.198 -15.464 -81.888 1.00131.26 C
ATOM 938 CD GLU A 282 44.775 -15.913 -80.509 1.00131.26 C
ATOM 939 OE1 GLU A 282 43.787 -16.667 -80.400 1.00131.26 O
ATOM 940 OE2 GLU A 282 45.426 -15.501 -79.530 1.00131.26 O
ATOM 941 N LYS A 283 46.313 -19.006 -84.643 1.00130.27 N
ATOM 942 CA LYS A 283 46.125 -20.134 -85.551 1.00130.27 C
ATOM 943 C LYS A 283 46.789 -21.393 -85.011 1.00130.27 C
ATOM 944 O LYS A 283 46.373 -22.510 -85.342 1.00130.27 O
ATOM 945 CB LYS A 283 46.666 -19.791 -86.938 1.00130.27 C
ATOM 946 N TYR A 284 47.828 -21.237 -84.183 1.00130.94 N
ATOM 947 CA TYR A 284 48.417 -22.403 -83.530 1.00130.94 C
ATOM 948 C TYR A 284 47.477 -22.991 -82.491 1.00130.94 C
ATOM 949 O TYR A 284 47.289 -24.211 -82.435 1.00130.94 O
ATOM 950 CB TYR A 284 49.747 -22.051 -82.873 1.00130.94 C
ATOM 951 CG TYR A 284 50.325 -23.213 -82.093 1.00130.94 C
ATOM 952 CD1 TYR A 284 50.850 -24.319 -82.746 1.00130.94 C
ATOM 953 CD2 TYR A 284 50.344 -23.204 -80.702 1.00130.94 C
ATOM 954 CE1 TYR A 284 51.373 -25.386 -82.038 1.00130.94 C
ATOM 955 CE2 TYR A 284 50.866 -24.267 -79.987 1.00130.94 C
ATOM 956 CZ TYR A 284 51.381 -25.351 -80.661 1.00130.94 C
ATOM 957 OH TYR A 284 51.903 -26.406 -79.951 1.00130.94 O
ATOM 958 N ILE A 285 46.887 -22.141 -81.652 1.00127.42 N
ATOM 959 CA ILE A 285 45.997 -22.646 -80.609 1.00127.42 C
ATOM 960 C ILE A 285 44.665 -23.084 -81.219 1.00127.42 C
ATOM 961 O ILE A 285 43.924 -23.885 -80.634 1.00127.42 O
ATOM 962 CB ILE A 285 45.831 -21.584 -79.506 1.00127.42 C
ATOM 963 CG1 ILE A 285 47.205 -21.152 -79.018 1.00127.42 C
ATOM 964 CG2 ILE A 285 45.176 -22.158 -78.278 1.00127.42 C
ATOM 965 CD1 ILE A 285 47.175 -19.926 -78.153 1.00127.42 C
ATOM 966 N SER A 286 44.360 -22.597 -82.429 1.00131.69 N
ATOM 967 CA SER A 286 43.264 -23.159 -83.215 1.00131.69 C
ATOM 968 C SER A 286 43.501 -24.631 -83.529 1.00131.69 C
ATOM 969 O SER A 286 42.555 -25.426 -83.560 1.00131.69 O
ATOM 970 CB SER A 286 43.089 -22.370 -84.511 1.00131.69 C
ATOM 971 OG SER A 286 42.723 -21.028 -84.255 1.00131.69 O
ATOM 972 N GLU A 287 44.753 -25.011 -83.763 1.00131.07 N
ATOM 973 CA GLU A 287 45.110 -26.391 -84.052 1.00131.07 C
ATOM 974 C GLU A 287 45.535 -27.168 -82.811 1.00131.07 C
ATOM 975 O GLU A 287 46.107 -28.256 -82.942 1.00131.07 O
ATOM 976 CB GLU A 287 46.223 -26.433 -85.101 1.00131.07 C
ATOM 977 N ARG A 288 45.274 -26.645 -81.619 1.00134.98 N
ATOM 978 CA ARG A 288 45.687 -27.315 -80.399 1.00134.98 C
ATOM 979 C ARG A 288 44.751 -28.482 -80.094 1.00134.98 C
ATOM 980 O ARG A 288 43.546 -28.425 -80.347 1.00134.98 O
ATOM 981 CB ARG A 288 45.707 -26.317 -79.239 1.00134.98 C
ATOM 982 CG ARG A 288 46.224 -26.853 -77.915 1.00134.98 C
ATOM 983 CD ARG A 288 47.695 -27.195 -77.997 1.00134.98 C
ATOM 984 NE ARG A 288 48.207 -27.667 -76.716 1.00134.98 N
ATOM 985 CZ ARG A 288 49.417 -28.184 -76.543 1.00134.98 C
ATOM 986 NH1 ARG A 288 50.241 -28.296 -77.574 1.00134.98 N
ATOM 987 NH2 ARG A 288 49.802 -28.590 -75.341 1.00134.98 N
ATOM 988 N VAL A 289 45.322 -29.557 -79.554 1.00138.91 N
ATOM 989 CA VAL A 289 44.566 -30.739 -79.157 1.00138.91 C
ATOM 990 C VAL A 289 44.588 -30.845 -77.633 1.00138.91 C
ATOM 991 O VAL A 289 45.605 -30.552 -76.994 1.00138.91 O
ATOM 992 CB VAL A 289 45.107 -32.013 -79.845 1.00138.91 C
ATOM 993 CG1 VAL A 289 46.567 -32.292 -79.494 1.00138.91 C
ATOM 994 CG2 VAL A 289 44.231 -33.225 -79.541 1.00138.91 C
ATOM 995 N ILE A 290 43.434 -31.178 -77.049 1.00143.82 N
ATOM 996 CA ILE A 290 43.314 -31.453 -75.626 1.00143.82 C
ATOM 997 C ILE A 290 42.511 -32.739 -75.479 1.00143.82 C
ATOM 998 O ILE A 290 41.457 -32.880 -76.106 1.00143.82 O
ATOM 999 CB ILE A 290 42.641 -30.307 -74.850 1.00143.82 C
ATOM 1000 CG1 ILE A 290 43.555 -29.085 -74.795 1.00143.82 C
ATOM 1001 CG2 ILE A 290 42.253 -30.727 -73.433 1.00143.82 C
ATOM 1002 CD1 ILE A 290 42.918 -27.898 -74.147 1.00143.82 C
ATOM 1003 N PRO A 291 42.978 -33.720 -74.695 1.00144.90 N
ATOM 1004 CA PRO A 291 42.214 -34.972 -74.555 1.00144.90 C
ATOM 1005 C PRO A 291 40.893 -34.819 -73.814 1.00144.90 C
ATOM 1006 O PRO A 291 39.856 -35.261 -74.324 1.00144.90 O
ATOM 1007 CB PRO A 291 43.192 -35.887 -73.804 1.00144.90 C
ATOM 1008 CG PRO A 291 44.119 -34.956 -73.089 1.00144.90 C
ATOM 1009 CD PRO A 291 44.264 -33.763 -73.976 1.00144.90 C
ATOM 1010 N GLU A 292 40.888 -34.206 -72.631 1.00141.32 N
ATOM 1011 CA GLU A 292 39.651 -34.029 -71.871 1.00141.32 C
ATOM 1012 C GLU A 292 39.086 -32.632 -72.130 1.00141.32 C
ATOM 1013 O GLU A 292 39.037 -31.764 -71.257 1.00141.32 O
ATOM 1014 CB GLU A 292 39.897 -34.272 -70.388 1.00141.32 C
ATOM 1015 N SER A 293 38.643 -32.432 -73.368 1.00137.20 N
ATOM 1016 CA SER A 293 38.103 -31.155 -73.814 1.00137.20 C
ATOM 1017 C SER A 293 36.618 -31.302 -74.103 1.00137.20 C
ATOM 1018 O SER A 293 36.218 -32.149 -74.909 1.00137.20 O
ATOM 1019 CB SER A 293 38.836 -30.653 -75.062 1.00137.20 C
ATOM 1020 N ASN A 294 35.806 -30.474 -73.452 1.00128.99 N
ATOM 1021 CA ASN A 294 34.367 -30.461 -73.671 1.00128.99 C
ATOM 1022 C ASN A 294 33.983 -29.784 -74.975 1.00128.99 C
ATOM 1023 O ASN A 294 32.851 -29.952 -75.437 1.00128.99 O
ATOM 1024 CB ASN A 294 33.661 -29.762 -72.506 1.00128.99 C
ATOM 1025 N TYR A 295 34.899 -29.035 -75.581 1.00126.32 N
ATOM 1026 CA TYR A 295 34.651 -28.335 -76.829 1.00126.32 C
ATOM 1027 C TYR A 295 34.870 -29.234 -78.039 1.00126.32 C
ATOM 1028 O TYR A 295 34.418 -28.905 -79.140 1.00126.32 O
ATOM 1029 CB TYR A 295 35.546 -27.097 -76.898 1.00126.32 C
ATOM 1030 CG TYR A 295 35.318 -26.221 -78.096 1.00126.32 C
ATOM 1031 CD1 TYR A 295 34.194 -25.420 -78.182 1.00126.32 C
ATOM 1032 CD2 TYR A 295 36.224 -26.201 -79.143 1.00126.32 C
ATOM 1033 CE1 TYR A 295 33.977 -24.621 -79.277 1.00126.32 C
ATOM 1034 CE2 TYR A 295 36.020 -25.402 -80.245 1.00126.32 C
ATOM 1035 CZ TYR A 295 34.893 -24.612 -80.306 1.00126.32 C
ATOM 1036 OH TYR A 295 34.678 -23.809 -81.401 1.00126.32 O
ATOM 1037 N GLY A 296 35.508 -30.383 -77.849 1.00132.07 N
ATOM 1038 CA GLY A 296 35.742 -31.304 -78.936 1.00132.07 C
ATOM 1039 C GLY A 296 37.192 -31.534 -79.284 1.00132.07 C
ATOM 1040 O GLY A 296 37.478 -31.968 -80.405 1.00132.07 O
ATOM 1041 N GLY A 297 38.117 -31.247 -78.374 1.00132.29 N
ATOM 1042 CA GLY A 297 39.521 -31.457 -78.654 1.00132.29 C
ATOM 1043 C GLY A 297 40.191 -30.186 -79.122 1.00132.29 C
ATOM 1044 O GLY A 297 41.287 -30.218 -79.689 1.00132.29 O
ATOM 1045 N LYS A 298 39.527 -29.056 -78.906 1.00126.85 N
ATOM 1046 CA LYS A 298 40.042 -27.751 -79.285 1.00126.85 C
ATOM 1047 C LYS A 298 39.818 -26.776 -78.139 1.00126.85 C
ATOM 1048 O LYS A 298 39.368 -27.152 -77.055 1.00126.85 O
ATOM 1049 CB LYS A 298 39.374 -27.230 -80.562 1.00126.85 C
ATOM 1050 CG LYS A 298 39.721 -28.016 -81.809 1.00126.85 C
ATOM 1051 CD LYS A 298 39.042 -27.433 -83.032 1.00126.85 C
ATOM 1052 CE LYS A 298 39.391 -28.229 -84.280 1.00126.85 C
ATOM 1053 NZ LYS A 298 38.769 -27.662 -85.508 1.00126.85 N
ATOM 1054 N ILE A 299 40.163 -25.518 -78.379 1.00117.09 N
ATOM 1055 CA ILE A 299 39.958 -24.440 -77.416 1.00117.09 C
ATOM 1056 C ILE A 299 39.135 -23.352 -78.095 1.00117.09 C
ATOM 1057 O ILE A 299 39.451 -22.977 -79.234 1.00117.09 O
ATOM 1058 CB ILE A 299 41.292 -23.885 -76.903 1.00117.09 C
ATOM 1059 CG1 ILE A 299 42.030 -24.952 -76.109 1.00117.09 C
ATOM 1060 CG2 ILE A 299 41.082 -22.677 -76.021 1.00117.09 C
ATOM 1061 CD1 ILE A 299 43.436 -24.577 -75.762 1.00117.09 C
ATOM 1062 N PRO A 300 38.079 -22.845 -77.461 1.00115.62 N
ATOM 1063 CA PRO A 300 37.331 -21.722 -78.029 1.00115.62 C
ATOM 1064 C PRO A 300 38.155 -20.445 -78.102 1.00115.62 C
ATOM 1065 O PRO A 300 38.922 -20.120 -77.195 1.00115.62 O
ATOM 1066 CB PRO A 300 36.154 -21.568 -77.063 1.00115.62 C
ATOM 1067 CG PRO A 300 36.597 -22.225 -75.803 1.00115.62 C
ATOM 1068 CD PRO A 300 37.451 -23.363 -76.239 1.00115.62 C
ATOM 1069 N ILE A 301 37.987 -19.721 -79.206 1.00117.59 N
ATOM 1070 CA ILE A 301 38.721 -18.494 -79.490 1.00117.59 C
ATOM 1071 C ILE A 301 37.721 -17.450 -79.965 1.00117.59 C
ATOM 1072 O ILE A 301 37.029 -17.663 -80.965 1.00117.59 O
ATOM 1073 CB ILE A 301 39.802 -18.709 -80.567 1.00117.59 C
ATOM 1074 CG1 ILE A 301 40.846 -19.731 -80.114 1.00117.59 C
ATOM 1075 CG2 ILE A 301 40.459 -17.397 -80.921 1.00117.59 C
ATOM 1076 CD1 ILE A 301 41.754 -20.196 -81.212 1.00117.59 C
ATOM 1077 N VAL A 302 37.647 -16.323 -79.265 1.00111.91 N
ATOM 1078 CA VAL A 302 36.663 -15.290 -79.560 1.00111.91 C
ATOM 1079 C VAL A 302 37.375 -13.979 -79.856 1.00111.91 C
ATOM 1080 O VAL A 302 38.056 -13.424 -78.987 1.00111.91 O
ATOM 1081 CB VAL A 302 35.670 -15.103 -78.397 1.00111.91 C
ATOM 1082 CG1 VAL A 302 34.732 -13.956 -78.698 1.00111.91 C
ATOM 1083 CG2 VAL A 302 34.894 -16.373 -78.149 1.00111.91 C
ATOM 1084 N CYS A 303 37.198 -13.474 -81.075 1.00115.18 N
ATOM 1085 CA CYS A 303 37.726 -12.178 -81.485 1.00115.18 C
ATOM 1086 C CYS A 303 36.699 -11.106 -81.171 1.00115.18 C
ATOM 1087 O CYS A 303 35.496 -11.338 -81.307 1.00115.18 O
ATOM 1088 CB CYS A 303 38.057 -12.156 -82.974 1.00115.18 C
ATOM 1089 SG CYS A 303 39.388 -13.266 -83.433 1.00115.18 S
ATOM 1090 N PHE A 304 37.172 -9.938 -80.763 1.00110.01 N
ATOM 1091 CA PHE A 304 36.314 -8.904 -80.212 1.00110.01 C
ATOM 1092 C PHE A 304 36.607 -7.589 -80.924 1.00110.01 C
ATOM 1093 O PHE A 304 37.769 -7.283 -81.206 1.00110.01 O
ATOM 1094 CB PHE A 304 36.566 -8.776 -78.714 1.00110.01 C
ATOM 1095 CG PHE A 304 35.468 -8.111 -77.967 1.00110.01 C
ATOM 1096 CD1 PHE A 304 34.373 -8.843 -77.548 1.00110.01 C
ATOM 1097 CD2 PHE A 304 35.518 -6.759 -77.687 1.00110.01 C
ATOM 1098 CE1 PHE A 304 33.352 -8.246 -76.850 1.00110.01 C
ATOM 1099 CE2 PHE A 304 34.494 -6.148 -76.991 1.00110.01 C
ATOM 1100 CZ PHE A 304 33.409 -6.895 -76.570 1.00110.01 C
ATOM 1101 N ALA A 305 35.560 -6.814 -81.224 1.00116.52 N
ATOM 1102 CA ALA A 305 35.712 -5.562 -81.965 1.00116.52 C
ATOM 1103 C ALA A 305 34.941 -4.452 -81.251 1.00116.52 C
ATOM 1104 O ALA A 305 33.710 -4.450 -81.209 1.00116.52 O
ATOM 1105 CB ALA A 305 35.252 -5.720 -83.411 1.00116.52 C
ATOM 1106 N GLN A 306 35.679 -3.499 -80.696 1.00118.98 N
ATOM 1107 CA GLN A 306 35.077 -2.341 -80.052 1.00118.98 C
ATOM 1108 C GLN A 306 35.984 -1.121 -80.158 1.00118.98 C
ATOM 1109 O GLN A 306 35.515 -0.002 -80.365 1.00118.98 O
ATOM 1110 CB GLN A 306 34.771 -2.643 -78.586 1.00118.98 C
ATOM 1111 N GLY A 309 39.562 0.056 -87.272 1.00154.32 N
ATOM 1112 CA GLY A 309 40.842 0.427 -87.842 1.00154.32 C
ATOM 1113 C GLY A 309 41.256 -0.435 -89.018 1.00154.32 C
ATOM 1114 O GLY A 309 40.625 -1.451 -89.312 1.00154.32 O
ATOM 1115 N LYS A 310 42.324 -0.010 -89.696 1.00157.96 N
ATOM 1116 CA LYS A 310 42.835 -0.762 -90.837 1.00157.96 C
ATOM 1117 C LYS A 310 43.479 -2.067 -90.393 1.00157.96 C
ATOM 1118 O LYS A 310 43.215 -3.128 -90.971 1.00157.96 O
ATOM 1119 CB LYS A 310 43.833 0.094 -91.614 1.00157.96 C
ATOM 1120 CG LYS A 310 44.447 -0.585 -92.819 1.00157.96 C
ATOM 1121 CD LYS A 310 45.326 0.386 -93.576 1.00157.96 C
ATOM 1122 CE LYS A 310 46.594 0.682 -92.800 1.00157.96 C
ATOM 1123 NZ LYS A 310 47.519 1.554 -93.568 1.00157.96 N
ATOM 1124 N GLU A 311 44.323 -2.007 -89.360 1.00156.81 N
ATOM 1125 CA GLU A 311 44.894 -3.224 -88.795 1.00156.81 C
ATOM 1126 C GLU A 311 43.823 -4.056 -88.104 1.00156.81 C
ATOM 1127 O GLU A 311 43.927 -5.287 -88.043 1.00156.81 O
ATOM 1128 CB GLU A 311 46.018 -2.879 -87.820 1.00156.81 C
ATOM 1129 N THR A 312 42.777 -3.398 -87.590 1.00154.00 N
ATOM 1130 CA THR A 312 41.635 -4.115 -87.033 1.00154.00 C
ATOM 1131 C THR A 312 40.924 -4.930 -88.101 1.00154.00 C
ATOM 1132 O THR A 312 40.618 -6.108 -87.890 1.00154.00 O
ATOM 1133 CB THR A 312 40.660 -3.133 -86.382 1.00154.00 C
ATOM 1134 N LEU A 313 40.681 -4.328 -89.267 1.00153.14 N
ATOM 1135 CA LEU A 313 40.051 -5.060 -90.359 1.00153.14 C
ATOM 1136 C LEU A 313 40.976 -6.136 -90.915 1.00153.14 C
ATOM 1137 O LEU A 313 40.509 -7.192 -91.363 1.00153.14 O
ATOM 1138 CB LEU A 313 39.612 -4.083 -91.452 1.00153.14 C
ATOM 1139 CG LEU A 313 38.843 -4.614 -92.665 1.00153.14 C
ATOM 1140 CD1 LEU A 313 37.755 -3.649 -93.050 1.00153.14 C
ATOM 1141 CD2 LEU A 313 39.771 -4.789 -93.853 1.00153.14 C
ATOM 1142 N LYS A 314 42.290 -5.886 -90.896 1.00151.42 N
ATOM 1143 CA LYS A 314 43.247 -6.906 -91.315 1.00151.42 C
ATOM 1144 C LYS A 314 43.205 -8.114 -90.387 1.00151.42 C
ATOM 1145 O LYS A 314 43.198 -9.264 -90.848 1.00151.42 O
ATOM 1146 CB LYS A 314 44.654 -6.311 -91.363 1.00151.42 C
ATOM 1147 N SER A 315 43.133 -7.866 -89.077 1.00148.54 N
ATOM 1148 CA SER A 315 43.020 -8.952 -88.110 1.00148.54 C
ATOM 1149 C SER A 315 41.682 -9.670 -88.237 1.00148.54 C
ATOM 1150 O SER A 315 41.609 -10.886 -88.041 1.00148.54 O
ATOM 1151 CB SER A 315 43.208 -8.410 -86.695 1.00148.54 C
ATOM 1152 OG SER A 315 43.067 -9.437 -85.732 1.00148.54 O
ATOM 1153 N ILE A 316 40.620 -8.932 -88.582 1.00142.81 N
ATOM 1154 CA ILE A 316 39.309 -9.538 -88.830 1.00142.81 C
ATOM 1155 C ILE A 316 39.375 -10.496 -90.015 1.00142.81 C
ATOM 1156 O ILE A 316 38.900 -11.637 -89.939 1.00142.81 O
ATOM 1157 CB ILE A 316 38.245 -8.443 -89.036 1.00142.81 C
ATOM 1158 CG1 ILE A 316 37.869 -7.810 -87.693 1.00142.81 C
ATOM 1159 CG2 ILE A 316 37.019 -8.966 -89.770 1.00142.81 C
ATOM 1160 CD1 ILE A 316 37.034 -6.565 -87.820 1.00142.81 C
ATOM 1161 N ASN A 317 39.994 -10.049 -91.113 1.00139.11 N
ATOM 1162 CA ASN A 317 40.109 -10.881 -92.309 1.00139.11 C
ATOM 1163 C ASN A 317 40.965 -12.117 -92.059 1.00139.11 C
ATOM 1164 O ASN A 317 40.621 -13.217 -92.507 1.00139.11 O
ATOM 1165 CB ASN A 317 40.688 -10.062 -93.462 1.00139.11 C
ATOM 1166 N VAL A 318 42.060 -11.963 -91.309 1.00138.64 N
ATOM 1167 CA VAL A 318 42.933 -13.104 -91.037 1.00138.64 C
ATOM 1168 C VAL A 318 42.266 -14.077 -90.066 1.00138.64 C
ATOM 1169 O VAL A 318 42.369 -15.302 -90.220 1.00138.64 O
ATOM 1170 CB VAL A 318 44.302 -12.611 -90.528 1.00138.64 C
ATOM 1171 CG1 VAL A 318 45.178 -13.765 -90.083 1.00138.64 C
ATOM 1172 CG2 VAL A 318 45.014 -11.852 -91.630 1.00138.64 C
ATOM 1173 N ALA A 319 41.532 -13.553 -89.081 1.00136.17 N
ATOM 1174 CA ALA A 319 40.910 -14.411 -88.081 1.00136.17 C
ATOM 1175 C ALA A 319 39.748 -15.203 -88.664 1.00136.17 C
ATOM 1176 O ALA A 319 39.615 -16.404 -88.400 1.00136.17 O
ATOM 1177 CB ALA A 319 40.442 -13.567 -86.900 1.00136.17 C
ATOM 1178 N ILE A 320 38.900 -14.553 -89.465 1.00134.82 N
ATOM 1179 CA ILE A 320 37.813 -15.274 -90.120 1.00134.82 C
ATOM 1180 C ILE A 320 38.376 -16.201 -91.193 1.00134.82 C
ATOM 1181 O ILE A 320 37.819 -17.273 -91.469 1.00134.82 O
ATOM 1182 CB ILE A 320 36.782 -14.270 -90.672 1.00134.82 C
ATOM 1183 CG1 ILE A 320 36.203 -13.457 -89.519 1.00134.82 C
ATOM 1184 CG2 ILE A 320 35.622 -14.956 -91.369 1.00134.82 C
ATOM 1185 CD1 ILE A 320 35.350 -12.309 -89.960 1.00134.82 C
ATOM 1186 N LYS A 321 39.528 -15.832 -91.766 1.00135.88 N
ATOM 1187 CA LYS A 321 40.234 -16.713 -92.690 1.00135.88 C
ATOM 1188 C LYS A 321 40.695 -17.992 -91.999 1.00135.88 C
ATOM 1189 O LYS A 321 40.743 -19.060 -92.620 1.00135.88 O
ATOM 1190 CB LYS A 321 41.420 -15.962 -93.298 1.00135.88 C
ATOM 1191 CG LYS A 321 42.195 -16.709 -94.363 1.00135.88 C
ATOM 1192 CD LYS A 321 43.282 -15.824 -94.935 1.00135.88 C
ATOM 1193 CE LYS A 321 44.090 -16.546 -95.990 1.00135.88 C
ATOM 1194 NZ LYS A 321 45.149 -15.668 -96.557 1.00135.88 N
ATOM 1195 N SER A 322 41.010 -17.914 -90.710 1.00134.09 N
ATOM 1196 CA SER A 322 41.393 -19.100 -89.961 1.00134.09 C
ATOM 1197 C SER A 322 40.225 -19.738 -89.211 1.00134.09 C
ATOM 1198 O SER A 322 40.478 -20.519 -88.284 1.00134.09 O
ATOM 1199 CB SER A 322 42.525 -18.764 -88.987 1.00134.09 C
ATOM 1200 OG SER A 322 42.927 -19.914 -88.262 1.00134.09 O
ATOM 1201 N LYS A 323 38.987 -19.418 -89.603 1.00131.83 N
ATOM 1202 CA LYS A 323 37.746 -20.004 -89.076 1.00131.83 C
ATOM 1203 C LYS A 323 37.614 -19.795 -87.563 1.00131.83 C
ATOM 1204 O LYS A 323 37.616 -20.730 -86.764 1.00131.83 O
ATOM 1205 CB LYS A 323 37.637 -21.489 -89.444 1.00131.83 C
ATOM 1206 N ILE A 324 37.511 -18.523 -87.195 1.00129.27 N
ATOM 1207 CA ILE A 324 37.316 -18.114 -85.806 1.00129.27 C
ATOM 1208 C ILE A 324 36.119 -17.171 -85.749 1.00129.27 C
ATOM 1209 O ILE A 324 36.031 -16.242 -86.565 1.00129.27 O
ATOM 1210 CB ILE A 324 38.590 -17.463 -85.241 1.00129.27 C
ATOM 1211 CG1 ILE A 324 39.695 -18.506 -85.063 1.00129.27 C
ATOM 1212 CG2 ILE A 324 38.327 -16.751 -83.931 1.00129.27 C
ATOM 1213 CD1 ILE A 324 41.035 -17.915 -84.700 1.00129.27 C
ATOM 1214 N PRO A 325 35.170 -17.379 -84.835 1.00124.94 N
ATOM 1215 CA PRO A 325 34.029 -16.462 -84.730 1.00124.94 C
ATOM 1216 C PRO A 325 34.448 -15.098 -84.201 1.00124.94 C
ATOM 1217 O PRO A 325 35.496 -14.948 -83.573 1.00124.94 O
ATOM 1218 CB PRO A 325 33.095 -17.179 -83.752 1.00124.94 C
ATOM 1219 CG PRO A 325 33.998 -18.039 -82.940 1.00124.94 C
ATOM 1220 CD PRO A 325 35.078 -18.487 -83.872 1.00124.94 C
ATOM 1221 N CYS A 326 33.617 -14.093 -84.459 1.00124.15 N
ATOM 1222 CA CYS A 326 33.920 -12.726 -84.069 1.00124.15 C
ATOM 1223 C CYS A 326 32.683 -12.067 -83.484 1.00124.15 C
ATOM 1224 O CYS A 326 31.554 -12.405 -83.843 1.00124.15 O
ATOM 1225 CB CYS A 326 34.419 -11.911 -85.254 1.00124.15 C
ATOM 1226 SG CYS A 326 35.952 -12.516 -85.979 1.00124.15 S
ATOM 1227 N VAL A 327 32.910 -11.119 -82.580 1.00120.59 N
ATOM 1228 CA VAL A 327 31.850 -10.370 -81.919 1.00120.59 C
ATOM 1229 C VAL A 327 32.100 -8.890 -82.165 1.00120.59 C
ATOM 1230 O VAL A 327 33.214 -8.401 -81.947 1.00120.59 O
ATOM 1231 CB VAL A 327 31.796 -10.671 -80.408 1.00120.59 C
ATOM 1232 CG1 VAL A 327 30.799 -9.773 -79.713 1.00120.59 C
ATOM 1233 CG2 VAL A 327 31.428 -12.115 -80.176 1.00120.59 C
ATOM 1234 N VAL A 328 31.075 -8.188 -82.641 1.00124.25 N
ATOM 1235 CA VAL A 328 31.160 -6.770 -82.970 1.00124.25 C
ATOM 1236 C VAL A 328 30.055 -6.034 -82.225 1.00124.25 C
ATOM 1237 O VAL A 328 28.886 -6.433 -82.286 1.00124.25 O
ATOM 1238 CB VAL A 328 31.046 -6.543 -84.489 1.00124.25 C
ATOM 1239 CG1 VAL A 328 30.974 -5.064 -84.813 1.00124.25 C
ATOM 1240 CG2 VAL A 328 32.219 -7.180 -85.213 1.00124.25 C
ATOM 1241 N VAL A 329 30.420 -4.959 -81.532 1.00126.99 N
ATOM 1242 CA VAL A 329 29.473 -4.139 -80.788 1.00126.99 C
ATOM 1243 C VAL A 329 28.957 -3.047 -81.716 1.00126.99 C
ATOM 1244 O VAL A 329 29.747 -2.328 -82.341 1.00126.99 O
ATOM 1245 CB VAL A 329 30.125 -3.532 -79.536 1.00126.99 C
ATOM 1246 CG1 VAL A 329 29.133 -2.662 -78.778 1.00126.99 C
ATOM 1247 CG2 VAL A 329 30.671 -4.625 -78.653 1.00126.99 C
ATOM 1248 N GLU A 330 27.636 -2.921 -81.812 1.00134.66 N
ATOM 1249 CA GLU A 330 27.043 -1.858 -82.610 1.00134.66 C
ATOM 1250 C GLU A 330 27.137 -0.521 -81.885 1.00134.66 C
ATOM 1251 O GLU A 330 26.942 -0.431 -80.670 1.00134.66 O
ATOM 1252 CB GLU A 330 25.580 -2.172 -82.923 1.00134.66 C
ATOM 1253 N GLY A 331 27.434 0.527 -82.648 1.00144.13 N
ATOM 1254 CA GLY A 331 27.487 1.867 -82.107 1.00144.13 C
ATOM 1255 C GLY A 331 28.833 2.304 -81.574 1.00144.13 C
ATOM 1256 O GLY A 331 28.880 3.198 -80.718 1.00144.13 O
ATOM 1257 N SER A 332 29.929 1.707 -82.044 1.00148.30 N
ATOM 1258 CA SER A 332 31.247 2.097 -81.554 1.00148.30 C
ATOM 1259 C SER A 332 31.701 3.417 -82.167 1.00148.30 C
ATOM 1260 O SER A 332 32.637 4.051 -81.668 1.00148.30 O
ATOM 1261 CB SER A 332 32.261 0.990 -81.845 1.00148.30 C
ATOM 1262 OG SER A 332 33.553 1.344 -81.384 1.00148.30 O
ATOM 1263 N GLY A 333 31.056 3.847 -83.250 1.00151.53 N
ATOM 1264 CA GLY A 333 31.486 5.033 -83.958 1.00151.53 C
ATOM 1265 C GLY A 333 32.628 4.804 -84.917 1.00151.53 C
ATOM 1266 O GLY A 333 33.258 5.772 -85.355 1.00151.53 O
ATOM 1267 N ARG A 334 32.909 3.551 -85.260 1.00154.58 N
ATOM 1268 CA ARG A 334 34.068 3.204 -86.068 1.00154.58 C
ATOM 1269 C ARG A 334 33.646 2.381 -87.274 1.00154.58 C
ATOM 1270 O ARG A 334 32.459 2.313 -87.605 1.00154.58 O
ATOM 1271 CB ARG A 334 35.094 2.438 -85.231 1.00154.58 C
ATOM 1272 N ILE A 335 34.628 1.766 -87.939 1.00156.76 N
ATOM 1273 CA ILE A 335 34.369 0.895 -89.085 1.00156.76 C
ATOM 1274 C ILE A 335 33.547 -0.327 -88.671 1.00156.76 C
ATOM 1275 O ILE A 335 32.835 -0.924 -89.491 1.00156.76 O
ATOM 1276 CB ILE A 335 35.709 0.512 -89.748 1.00156.76 C
ATOM 1277 CG1 ILE A 335 35.510 -0.181 -91.092 1.00156.76 C
ATOM 1278 CG2 ILE A 335 36.568 -0.348 -88.836 1.00156.76 C
ATOM 1279 CD1 ILE A 335 36.780 -0.278 -91.876 1.00156.76 C
ATOM 1280 N ALA A 336 33.607 -0.698 -87.385 1.00154.19 N
ATOM 1281 CA ALA A 336 32.809 -1.806 -86.872 1.00154.19 C
ATOM 1282 C ALA A 336 31.317 -1.504 -86.947 1.00154.19 C
ATOM 1283 O ALA A 336 30.504 -2.413 -87.152 1.00154.19 O
ATOM 1284 CB ALA A 336 33.223 -2.119 -85.436 1.00154.19 C
ATOM 1285 N ASP A 337 30.941 -0.229 -86.806 1.00152.33 N
ATOM 1286 CA ASP A 337 29.549 0.162 -87.006 1.00152.33 C
ATOM 1287 C ASP A 337 29.133 -0.046 -88.458 1.00152.33 C
ATOM 1288 O ASP A 337 27.995 -0.441 -88.737 1.00152.33 O
ATOM 1289 CB ASP A 337 29.358 1.621 -86.594 1.00152.33 C
ATOM 1290 CG ASP A 337 27.897 2.008 -86.432 1.00152.33 C
ATOM 1291 OD1 ASP A 337 27.008 1.143 -86.568 1.00152.33 O
ATOM 1292 OD2 ASP A 337 27.636 3.199 -86.170 1.00152.33 O
ATOM 1293 N VAL A 338 30.055 0.185 -89.394 1.00156.91 N
ATOM 1294 CA VAL A 338 29.754 -0.034 -90.805 1.00156.91 C
ATOM 1295 C VAL A 338 29.614 -1.521 -91.098 1.00156.91 C
ATOM 1296 O VAL A 338 28.777 -1.931 -91.912 1.00156.91 O
ATOM 1297 CB VAL A 338 30.833 0.618 -91.689 1.00156.91 C
ATOM 1298 N ILE A 339 30.422 -2.350 -90.431 1.00157.72 N
ATOM 1299 CA ILE A 339 30.297 -3.798 -90.601 1.00157.72 C
ATOM 1300 C ILE A 339 28.994 -4.290 -89.980 1.00157.72 C
ATOM 1301 O ILE A 339 28.354 -5.218 -90.492 1.00157.72 O
ATOM 1302 CB ILE A 339 31.529 -4.512 -90.011 1.00157.72 C
ATOM 1303 CG1 ILE A 339 32.809 -3.977 -90.651 1.00157.72 C
ATOM 1304 CG2 ILE A 339 31.470 -6.016 -90.243 1.00157.72 C
ATOM 1305 CD1 ILE A 339 32.871 -4.166 -92.150 1.00157.72 C
ATOM 1306 N ALA A 340 28.558 -3.644 -88.895 1.00155.41 N
ATOM 1307 CA ALA A 340 27.293 -4.012 -88.266 1.00155.41 C
ATOM 1308 C ALA A 340 26.102 -3.614 -89.129 1.00155.41 C
ATOM 1309 O ALA A 340 25.114 -4.353 -89.216 1.00155.41 O
ATOM 1310 CB ALA A 340 27.190 -3.366 -86.886 1.00155.41 C
ATOM 1311 N SER A 341 26.174 -2.446 -89.770 1.00157.72 N
ATOM 1312 CA SER A 341 25.075 -2.004 -90.622 1.00157.72 C
ATOM 1313 C SER A 341 25.021 -2.803 -91.918 1.00157.72 C
ATOM 1314 O SER A 341 23.934 -3.099 -92.427 1.00157.72 O
ATOM 1315 CB SER A 341 25.208 -0.511 -90.918 1.00157.72 C
ATOM 1316 N LEU A 342 26.185 -3.165 -92.466 1.00161.90 N
ATOM 1317 CA LEU A 342 26.213 -3.931 -93.709 1.00161.90 C
ATOM 1318 C LEU A 342 25.778 -5.375 -93.488 1.00161.90 C
ATOM 1319 O LEU A 342 25.363 -6.055 -94.433 1.00161.90 O
ATOM 1320 CB LEU A 342 27.612 -3.887 -94.323 1.00161.90 C
ATOM 1321 N VAL A 343 25.875 -5.862 -92.255 1.00157.20 N
ATOM 1322 CA VAL A 343 25.494 -7.235 -91.940 1.00157.20 C
ATOM 1323 C VAL A 343 23.980 -7.398 -91.963 1.00157.20 C
ATOM 1324 O VAL A 343 23.466 -8.430 -92.394 1.00157.20 O
ATOM 1325 CB VAL A 343 26.059 -7.669 -90.580 1.00157.20 C
ATOM 1326 N SER A 351 30.577 -3.602-102.165 1.00244.11 N
ATOM 1327 CA SER A 351 30.237 -3.746-103.575 1.00244.11 C
ATOM 1328 C SER A 351 29.558 -2.486-104.094 1.00244.11 C
ATOM 1329 O SER A 351 28.510 -2.561-104.740 1.00244.11 O
ATOM 1330 CB SER A 351 29.334 -4.962-103.787 1.00244.11 C
ATOM 1331 N SER A 352 30.140 -1.336-103.724 1.00249.84 N
ATOM 1332 CA SER A 352 29.810 0.040-104.124 1.00249.84 C
ATOM 1333 C SER A 352 28.500 0.551-103.520 1.00249.84 C
ATOM 1334 O SER A 352 28.192 1.741-103.626 1.00249.84 O
ATOM 1335 CB SER A 352 29.780 0.204-105.652 1.00249.84 C
ATOM 1336 OG SER A 352 28.669 -0.453-106.236 1.00249.84 O
ATOM 1337 N CYS A 353 27.728 -0.328-102.879 1.00245.00 N
ATOM 1338 CA CYS A 353 26.754 0.124-101.896 1.00245.00 C
ATOM 1339 C CYS A 353 27.371 0.083-100.510 1.00245.00 C
ATOM 1340 O CYS A 353 27.018 0.880 -99.632 1.00245.00 O
ATOM 1341 CB CYS A 353 25.496 -0.739-101.958 1.00245.00 C
ATOM 1342 SG CYS A 353 24.569 -0.588-103.498 1.00245.00 S
ATOM 1343 N VAL A 354 28.306 -0.847-100.308 1.00247.09 N
ATOM 1344 CA VAL A 354 29.132 -0.860 -99.107 1.00247.09 C
ATOM 1345 C VAL A 354 30.004 0.388 -99.058 1.00247.09 C
ATOM 1346 O VAL A 354 30.140 1.028 -98.009 1.00247.09 O
ATOM 1347 CB VAL A 354 29.974 -2.150 -99.069 1.00247.09 C
ATOM 1348 CG1 VAL A 354 30.895 -2.165 -97.862 1.00247.09 C
ATOM 1349 CG2 VAL A 354 29.072 -3.376 -99.075 1.00247.09 C
ATOM 1350 N LYS A 355 30.588 0.764-100.201 1.00247.50 N
ATOM 1351 CA LYS A 355 31.407 1.971-100.265 1.00247.50 C
ATOM 1352 C LYS A 355 30.561 3.226-100.089 1.00247.50 C
ATOM 1353 O LYS A 355 31.047 4.243 -99.582 1.00247.50 O
ATOM 1354 CB LYS A 355 32.165 2.021-101.590 1.00247.50 C
ATOM 1355 N GLU A 356 29.296 3.175-100.509 1.00247.92 N
ATOM 1356 CA GLU A 356 28.382 4.275-100.224 1.00247.92 C
ATOM 1357 C GLU A 356 28.023 4.314 -98.744 1.00247.92 C
ATOM 1358 O GLU A 356 27.799 5.390 -98.178 1.00247.92 O
ATOM 1359 CB GLU A 356 27.123 4.147-101.078 1.00247.92 C
ATOM 1360 N SER A 357 27.967 3.146 -98.100 1.00243.04 N
ATOM 1361 CA SER A 357 27.643 3.094 -96.679 1.00243.04 C
ATOM 1362 C SER A 357 28.833 3.509 -95.822 1.00243.04 C
ATOM 1363 O SER A 357 28.663 3.870 -94.651 1.00243.04 O
ATOM 1364 CB SER A 357 27.175 1.690 -96.309 1.00243.04 C
ATOM 1365 OG SER A 357 26.888 1.604 -94.927 1.00243.04 O
ATOM 1366 N LEU A 358 30.045 3.420 -96.379 1.00249.57 N
ATOM 1367 CA LEU A 358 31.259 3.821 -95.667 1.00249.57 C
ATOM 1368 C LEU A 358 31.238 5.300 -95.296 1.00249.57 C
ATOM 1369 O LEU A 358 31.695 5.689 -94.215 1.00249.57 O
ATOM 1370 CB LEU A 358 32.501 3.517 -96.513 1.00249.57 C
ATOM 1371 CG LEU A 358 32.964 2.075 -96.729 1.00249.57 C
ATOM 1372 CD1 LEU A 358 34.138 2.026 -97.693 1.00249.57 C
ATOM 1373 CD2 LEU A 358 33.334 1.431 -95.408 1.00249.57 C
ATOM 1374 N LEU A 359 30.728 6.139 -96.198 1.00250.62 N
ATOM 1375 CA LEU A 359 30.683 7.585 -96.002 1.00250.62 C
ATOM 1376 C LEU A 359 29.773 7.982 -94.847 1.00250.62 C
ATOM 1377 O LEU A 359 30.017 8.993 -94.179 1.00250.62 O
ATOM 1378 CB LEU A 359 30.228 8.275 -97.288 1.00250.62 C
ATOM 1379 N ARG A 360 28.716 7.199 -94.614 1.00248.23 N
ATOM 1380 CA ARG A 360 27.819 7.474 -93.497 1.00248.23 C
ATOM 1381 C ARG A 360 28.500 7.204 -92.161 1.00248.23 C
ATOM 1382 O ARG A 360 28.214 7.875 -91.162 1.00248.23 O
ATOM 1383 CB ARG A 360 26.546 6.637 -93.629 1.00248.23 C
ATOM 1384 N PHE A 361 29.407 6.226 -92.124 1.00249.72 N
ATOM 1385 CA PHE A 361 30.070 5.882 -90.871 1.00249.72 C
ATOM 1386 C PHE A 361 31.185 6.867 -90.540 1.00249.72 C
ATOM 1387 O PHE A 361 31.148 7.531 -89.496 1.00249.72 O
ATOM 1388 CB PHE A 361 30.617 4.457 -90.947 1.00249.72 C
ATOM 1389 N LEU A 362 32.184 6.981 -91.416 1.00260.28 N
ATOM 1390 CA LEU A 362 33.328 7.847 -91.153 1.00260.28 C
ATOM 1391 C LEU A 362 33.864 8.439 -92.452 1.00260.28 C
ATOM 1392 O LEU A 362 34.545 7.747 -93.219 1.00260.28 O
ATOM 1393 CB LEU A 362 34.430 7.074 -90.427 1.00260.28 C
ATOM 1394 N PRO A 363 33.581 9.712 -92.732 1.00260.46 N
ATOM 1395 CA PRO A 363 34.077 10.325 -93.970 1.00260.46 C
ATOM 1396 C PRO A 363 35.529 10.769 -93.870 1.00260.46 C
ATOM 1397 O PRO A 363 36.168 11.043 -94.890 1.00260.46 O
ATOM 1398 CB PRO A 363 33.139 11.521 -94.163 1.00260.46 C
ATOM 1399 CG PRO A 363 32.732 11.887 -92.780 1.00260.46 C
ATOM 1400 CD PRO A 363 32.653 10.599 -92.008 1.00260.46 C
ATOM 1401 N ARG A 364 36.054 10.855 -92.645 1.00260.49 N
ATOM 1402 CA ARG A 364 37.416 11.347 -92.456 1.00260.49 C
ATOM 1403 C ARG A 364 38.446 10.320 -92.906 1.00260.49 C
ATOM 1404 O ARG A 364 39.496 10.680 -93.450 1.00260.49 O
ATOM 1405 CB ARG A 364 37.640 11.722 -90.991 1.00260.49 C
ATOM 1406 N THR A 365 38.162 9.035 -92.688 1.00259.44 N
ATOM 1407 CA THR A 365 39.122 7.996 -93.045 1.00259.44 C
ATOM 1408 C THR A 365 39.149 7.754 -94.549 1.00259.44 C
ATOM 1409 O THR A 365 40.208 7.471 -95.121 1.00259.44 O
ATOM 1410 CB THR A 365 38.793 6.701 -92.304 1.00259.44 C
ATOM 1411 N ILE A 366 37.994 7.862 -95.208 1.00258.74 N
ATOM 1412 CA ILE A 366 37.935 7.612 -96.646 1.00258.74 C
ATOM 1413 C ILE A 366 38.429 8.825 -97.424 1.00258.74 C
ATOM 1414 O ILE A 366 38.644 8.752 -98.641 1.00258.74 O
ATOM 1415 CB ILE A 366 36.508 7.217 -97.065 1.00258.74 C
ATOM 1416 CG1 ILE A 366 35.544 8.383 -96.851 1.00258.74 C
ATOM 1417 CG2 ILE A 366 36.043 6.009 -96.274 1.00258.74 C
ATOM 1418 CD1 ILE A 366 34.175 8.160 -97.455 1.00258.74 C
ATOM 1419 N SER A 367 38.603 9.960 -96.742 1.00258.60 N
ATOM 1420 CA SER A 367 39.009 11.188 -97.419 1.00258.60 C
ATOM 1421 C SER A 367 40.466 11.128 -97.864 1.00258.60 C
ATOM 1422 O SER A 367 40.764 11.255 -99.057 1.00258.60 O
ATOM 1423 CB SER A 367 38.780 12.388 -96.500 1.00258.60 C
ATOM 1424 OG SER A 367 39.623 12.324 -95.363 1.00258.60 O
ATOM 1425 N ARG A 368 41.386 10.915 -96.921 1.00253.10 N
ATOM 1426 CA ARG A 368 42.805 10.905 -97.265 1.00253.10 C
ATOM 1427 C ARG A 368 43.208 9.598 -97.936 1.00253.10 C
ATOM 1428 O ARG A 368 44.307 9.492 -98.491 1.00253.10 O
ATOM 1429 CB ARG A 368 43.648 11.145 -96.014 1.00253.10 C
ATOM 1430 N LEU A 369 42.341 8.587 -97.876 1.00249.95 N
ATOM 1431 CA LEU A 369 42.639 7.296 -98.480 1.00249.95 C
ATOM 1432 C LEU A 369 42.643 7.397-100.000 1.00249.95 C
ATOM 1433 O LEU A 369 42.017 8.286-100.583 1.00249.95 O
ATOM 1434 CB LEU A 369 41.618 6.252 -98.025 1.00249.95 C
ATOM 1435 N SER A 370 43.365 6.482-100.639 1.00240.71 N
ATOM 1436 CA SER A 370 43.467 6.450-102.088 1.00240.71 C
ATOM 1437 C SER A 370 42.356 5.570-102.663 1.00240.71 C
ATOM 1438 O SER A 370 41.529 5.013-101.935 1.00240.71 O
ATOM 1439 CB SER A 370 44.855 5.969-102.507 1.00240.71 C
ATOM 1440 N GLU A 371 42.327 5.442-103.991 1.00238.12 N
ATOM 1441 CA GLU A 371 41.310 4.617-104.634 1.00238.12 C
ATOM 1442 C GLU A 371 41.664 3.138-104.551 1.00238.12 C
ATOM 1443 O GLU A 371 40.773 2.287-104.438 1.00238.12 O
ATOM 1444 CB GLU A 371 41.130 5.048-106.089 1.00238.12 C
ATOM 1445 N GLU A 372 42.959 2.811-104.615 1.00233.16 N
ATOM 1446 CA GLU A 372 43.383 1.423-104.460 1.00233.16 C
ATOM 1447 C GLU A 372 43.144 0.932-103.038 1.00233.16 C
ATOM 1448 O GLU A 372 42.839 -0.247-102.823 1.00233.16 O
ATOM 1449 CB GLU A 372 44.856 1.278-104.839 1.00233.16 C
ATOM 1450 N GLU A 373 43.249 1.832-102.055 1.00235.51 N
ATOM 1451 CA GLU A 373 42.920 1.475-100.678 1.00235.51 C
ATOM 1452 C GLU A 373 41.426 1.227-100.518 1.00235.51 C
ATOM 1453 O GLU A 373 41.014 0.328 -99.775 1.00235.51 O
ATOM 1454 CB GLU A 373 43.387 2.573 -99.723 1.00235.51 C
ATOM 1455 N THR A 374 40.600 2.008-101.222 1.00232.66 N
ATOM 1456 CA THR A 374 39.159 1.771-101.210 1.00232.66 C
ATOM 1457 C THR A 374 38.814 0.449-101.886 1.00232.66 C
ATOM 1458 O THR A 374 37.923 -0.275-101.427 1.00232.66 O
ATOM 1459 CB THR A 374 38.428 2.928-101.891 1.00232.66 C
ATOM 1460 N GLU A 375 39.532 0.107-102.962 1.00229.64 N
ATOM 1461 CA GLU A 375 39.316 -1.175-103.630 1.00229.64 C
ATOM 1462 C GLU A 375 39.742 -2.340-102.744 1.00229.64 C
ATOM 1463 O GLU A 375 39.074 -3.383-102.712 1.00229.64 O
ATOM 1464 CB GLU A 375 40.071 -1.213-104.958 1.00229.64 C
ATOM 1465 N SER A 376 40.841 -2.172-102.004 1.00226.41 N
ATOM 1466 CA SER A 376 41.275 -3.205-101.069 1.00226.41 C
ATOM 1467 C SER A 376 40.288 -3.362 -99.918 1.00226.41 C
ATOM 1468 O SER A 376 40.030 -4.485 -99.468 1.00226.41 O
ATOM 1469 CB SER A 376 42.670 -2.882-100.540 1.00226.41 C
ATOM 1470 OG SER A 376 43.096 -3.859 -99.606 1.00226.41 O
ATOM 1471 N TRP A 377 39.714 -2.249 -99.441 1.00225.01 N
ATOM 1472 CA TRP A 377 38.691 -2.325 -98.398 1.00225.01 C
ATOM 1473 C TRP A 377 37.438 -3.032 -98.890 1.00225.01 C
ATOM 1474 O TRP A 377 36.857 -3.844 -98.163 1.00225.01 O
ATOM 1475 CB TRP A 377 38.316 -0.935 -97.892 1.00225.01 C
ATOM 1476 CG TRP A 377 39.318 -0.285 -97.020 1.00225.01 C
ATOM 1477 CD1 TRP A 377 40.521 -0.788 -96.631 1.00225.01 C
ATOM 1478 CD2 TRP A 377 39.175 0.976 -96.366 1.00225.01 C
ATOM 1479 NE1 TRP A 377 41.156 0.103 -95.801 1.00225.01 N
ATOM 1480 CE2 TRP A 377 40.346 1.194 -95.619 1.00225.01 C
ATOM 1481 CE3 TRP A 377 38.173 1.952 -96.351 1.00225.01 C
ATOM 1482 CZ2 TRP A 377 40.545 2.350 -94.862 1.00225.01 C
ATOM 1483 CZ3 TRP A 377 38.370 3.097 -95.603 1.00225.01 C
ATOM 1484 CH2 TRP A 377 39.547 3.287 -94.868 1.00225.01 C
ATOM 1485 N ILE A 378 36.999 -2.724-100.113 1.00219.14 N
ATOM 1486 CA ILE A 378 35.830 -3.392-100.680 1.00219.14 C
ATOM 1487 C ILE A 378 36.088 -4.883-100.871 1.00219.14 C
ATOM 1488 O ILE A 378 35.231 -5.708-100.524 1.00219.14 O
ATOM 1489 CB ILE A 378 35.418 -2.704-101.995 1.00219.14 C
ATOM 1490 CG1 ILE A 378 34.861 -1.310-101.711 1.00219.14 C
ATOM 1491 CG2 ILE A 378 34.386 -3.522-102.762 1.00219.14 C
ATOM 1492 CD1 ILE A 378 34.677 -0.472-102.953 1.00219.14 C
ATOM 1493 N LYS A 379 37.285 -5.251-101.344 1.00210.68 N
ATOM 1494 CA LYS A 379 37.631 -6.661-101.510 1.00210.68 C
ATOM 1495 C LYS A 379 37.697 -7.388-100.170 1.00210.68 C
ATOM 1496 O LYS A 379 37.196 -8.513-100.043 1.00210.68 O
ATOM 1497 CB LYS A 379 38.962 -6.786-102.251 1.00210.68 C
ATOM 1498 N TRP A 380 38.260 -6.745 -99.145 1.00203.85 N
ATOM 1499 CA TRP A 380 38.407 -7.408 -97.854 1.00203.85 C
ATOM 1500 C TRP A 380 37.077 -7.509 -97.117 1.00203.85 C
ATOM 1501 O TRP A 380 36.831 -8.491 -96.411 1.00203.85 O
ATOM 1502 CB TRP A 380 39.440 -6.672 -97.003 1.00203.85 C
ATOM 1503 N ILE A 381 36.202 -6.511 -97.267 1.00196.74 N
ATOM 1504 CA ILE A 381 34.886 -6.583 -96.637 1.00196.74 C
ATOM 1505 C ILE A 381 34.007 -7.603 -97.355 1.00196.74 C
ATOM 1506 O ILE A 381 33.240 -8.339 -96.718 1.00196.74 O
ATOM 1507 CB ILE A 381 34.253 -5.177 -96.578 1.00196.74 C
ATOM 1508 CG1 ILE A 381 34.981 -4.322 -95.540 1.00196.74 C
ATOM 1509 CG2 ILE A 381 32.768 -5.213 -96.251 1.00196.74 C
ATOM 1510 CD1 ILE A 381 34.581 -2.873 -95.559 1.00196.74 C
ATOM 1511 N LYS A 382 34.147 -7.711 -98.682 1.00199.14 N
ATOM 1512 CA LYS A 382 33.420 -8.743 -99.419 1.00199.14 C
ATOM 1513 C LYS A 382 33.937 -10.136 -99.076 1.00199.14 C
ATOM 1514 O LYS A 382 33.178 -11.112 -99.098 1.00199.14 O
ATOM 1515 CB LYS A 382 33.524 -8.484-100.922 1.00199.14 C
ATOM 1516 N GLU A 383 35.226 -10.246 -98.753 1.00191.88 N
ATOM 1517 CA GLU A 383 35.742 -11.504 -98.228 1.00191.88 C
ATOM 1518 C GLU A 383 35.270 -11.737 -96.795 1.00191.88 C
ATOM 1519 O GLU A 383 35.148 -12.884 -96.352 1.00191.88 O
ATOM 1520 CB GLU A 383 37.268 -11.512 -98.304 1.00191.88 C
ATOM 1521 N VAL A 384 34.996 -10.659 -96.060 1.00185.99 N
ATOM 1522 CA VAL A 384 34.599 -10.736 -94.658 1.00185.99 C
ATOM 1523 C VAL A 384 33.147 -11.175 -94.545 1.00185.99 C
ATOM 1524 O VAL A 384 32.817 -12.074 -93.764 1.00185.99 O
ATOM 1525 CB VAL A 384 34.811 -9.390 -93.944 1.00185.99 C
ATOM 1526 N LEU A 385 32.268 -10.549 -95.330 1.00177.88 N
ATOM 1527 CA LEU A 385 30.833 -10.797 -95.230 1.00177.88 C
ATOM 1528 C LEU A 385 30.430 -11.962 -96.137 1.00177.88 C
ATOM 1529 O LEU A 385 29.250 -12.146 -96.453 1.00177.88 O
ATOM 1530 CB LEU A 385 30.070 -9.503 -95.558 1.00177.88 C
ATOM 1531 CG LEU A 385 28.601 -9.290 -95.167 1.00177.88 C
ATOM 1532 CD1 LEU A 385 28.452 -9.346 -93.661 1.00177.88 C
ATOM 1533 CD2 LEU A 385 28.075 -7.971 -95.702 1.00177.88 C
ATOM 1534 N GLU A 386 31.414 -12.760 -96.564 1.00175.89 N
ATOM 1535 CA GLU A 386 31.120 -13.977 -97.313 1.00175.89 C
ATOM 1536 C GLU A 386 30.382 -14.992 -96.450 1.00175.89 C
ATOM 1537 O GLU A 386 29.522 -15.731 -96.944 1.00175.89 O
ATOM 1538 CB GLU A 386 32.415 -14.578 -97.862 1.00175.89 C
ATOM 1539 N SER A 387 30.701 -15.041 -95.161 1.00164.25 N
ATOM 1540 CA SER A 387 30.046 -15.947 -94.226 1.00164.25 C
ATOM 1541 C SER A 387 29.353 -15.140 -93.136 1.00164.25 C
ATOM 1542 O SER A 387 30.028 -14.656 -92.211 1.00164.25 O
ATOM 1543 CB SER A 387 31.063 -16.909 -93.613 1.00164.25 C
ATOM 1544 OG SER A 387 32.007 -16.200 -92.834 1.00164.25 O
ATOM 1545 N PRO A 388 28.029 -14.961 -93.194 1.00155.59 N
ATOM 1546 CA PRO A 388 27.360 -14.179 -92.141 1.00155.59 C
ATOM 1547 C PRO A 388 27.277 -14.912 -90.820 1.00155.59 C
ATOM 1548 O PRO A 388 27.203 -14.269 -89.765 1.00155.59 O
ATOM 1549 CB PRO A 388 25.964 -13.924 -92.728 1.00155.59 C
ATOM 1550 CG PRO A 388 26.113 -14.139 -94.190 1.00155.59 C
ATOM 1551 CD PRO A 388 27.134 -15.223 -94.330 1.00155.59 C
ATOM 1552 N HIS A 389 27.289 -16.247 -90.850 1.00143.01 N
ATOM 1553 CA HIS A 389 27.040 -17.028 -89.643 1.00143.01 C
ATOM 1554 C HIS A 389 28.205 -16.948 -88.666 1.00143.01 C
ATOM 1555 O HIS A 389 28.019 -17.126 -87.457 1.00143.01 O
ATOM 1556 CB HIS A 389 26.760 -18.480 -90.017 1.00143.01 C
ATOM 1557 CG HIS A 389 27.926 -19.171 -90.644 1.00143.01 C
ATOM 1558 ND1 HIS A 389 28.252 -19.019 -91.973 1.00143.01 N
ATOM 1559 CD2 HIS A 389 28.853 -20.006 -90.121 1.00143.01 C
ATOM 1560 CE1 HIS A 389 29.326 -19.738 -92.244 1.00143.01 C
ATOM 1561 NE2 HIS A 389 29.709 -20.349 -91.138 1.00143.01 N
ATOM 1562 N LEU A 390 29.413 -16.681 -89.165 1.00138.91 N
ATOM 1563 CA LEU A 390 30.577 -16.686 -88.286 1.00138.91 C
ATOM 1564 C LEU A 390 30.641 -15.426 -87.433 1.00138.91 C
ATOM 1565 O LEU A 390 31.100 -15.472 -86.287 1.00138.91 O
ATOM 1566 CB LEU A 390 31.856 -16.856 -89.100 1.00138.91 C
ATOM 1567 CG LEU A 390 32.016 -18.230 -89.752 1.00138.91 C
ATOM 1568 CD1 LEU A 390 33.271 -18.285 -90.597 1.00138.91 C
ATOM 1569 CD2 LEU A 390 32.043 -19.315 -88.698 1.00138.91 C
ATOM 1570 N LEU A 391 30.198 -14.295 -87.964 1.00134.92 N
ATOM 1571 CA LEU A 391 30.211 -13.080 -87.171 1.00134.92 C
ATOM 1572 C LEU A 391 28.936 -12.974 -86.346 1.00134.92 C
ATOM 1573 O LEU A 391 27.903 -13.555 -86.683 1.00134.92 O
ATOM 1574 CB LEU A 391 30.387 -11.852 -88.065 1.00134.92 C
ATOM 1575 CG LEU A 391 29.344 -11.430 -89.102 1.00134.92 C
ATOM 1576 CD1 LEU A 391 28.355 -10.389 -88.564 1.00134.92 C
ATOM 1577 CD2 LEU A 391 30.042 -10.914 -90.347 1.00134.92 C
ATOM 1578 N THR A 392 29.016 -12.202 -85.268 1.00128.06 N
ATOM 1579 CA THR A 392 27.882 -11.978 -84.383 1.00128.06 C
ATOM 1580 C THR A 392 27.931 -10.547 -83.869 1.00128.06 C
ATOM 1581 O THR A 392 28.986 -10.065 -83.457 1.00128.06 O
ATOM 1582 CB THR A 392 27.898 -12.939 -83.184 1.00128.06 C
ATOM 1583 OG1 THR A 392 27.876 -14.293 -83.653 1.00128.06 O
ATOM 1584 CG2 THR A 392 26.691 -12.696 -82.293 1.00128.06 C
ATOM 1585 N VAL A 393 26.793 -9.863 -83.895 1.00126.95 N
ATOM 1586 CA VAL A 393 26.744 -8.481 -83.435 1.00126.95 C
ATOM 1587 C VAL A 393 25.826 -8.296 -82.234 1.00126.95 C
ATOM 1588 O VAL A 393 24.674 -8.727 -82.246 1.00126.95 O
ATOM 1589 CB VAL A 393 26.298 -7.532 -84.559 1.00126.95 C
ATOM 1590 CG1 VAL A 393 26.268 -6.097 -84.055 1.00126.95 C
ATOM 1591 CG2 VAL A 393 27.225 -7.663 -85.756 1.00126.95 C
ATOM 1592 N ILE A 394 26.350 -7.652 -81.198 1.00124.36 N
ATOM 1593 CA ILE A 394 25.588 -7.393 -79.987 1.00124.36 C
ATOM 1594 C ILE A 394 24.461 -6.405 -80.264 1.00124.36 C
ATOM 1595 O ILE A 394 24.643 -5.437 -81.001 1.00124.36 O
ATOM 1596 CB ILE A 394 26.491 -6.827 -78.876 1.00124.36 C
ATOM 1597 CG1 ILE A 394 27.776 -7.650 -78.767 1.00124.36 C
ATOM 1598 CG2 ILE A 394 25.754 -6.796 -77.545 1.00124.36 C
ATOM 1599 CD1 ILE A 394 28.725 -7.160 -77.696 1.00124.36 C
ATOM 1600 N LYS A 395 23.300 -6.651 -79.669 1.00124.52 N
ATOM 1601 CA LYS A 395 22.150 -5.774 -79.845 1.00124.52 C
ATOM 1602 C LYS A 395 22.407 -4.420 -79.196 1.00124.52 C
ATOM 1603 O LYS A 395 23.059 -4.334 -78.156 1.00124.52 O
ATOM 1604 CB LYS A 395 20.892 -6.411 -79.254 1.00124.52 C
ATOM 1605 N ILE A 396 21.893 -3.363 -79.815 1.00130.70 N
ATOM 1606 CA ILE A 396 22.067 -2.014 -79.294 1.00130.70 C
ATOM 1607 C ILE A 396 21.414 -1.870 -77.923 1.00130.70 C
ATOM 1608 O ILE A 396 21.963 -1.229 -77.028 1.00130.70 O
ATOM 1609 CB ILE A 396 21.482 -0.957 -80.250 1.00130.70 C
ATOM 1610 N GLU A 397 20.238 -2.469 -77.765 1.00138.92 N
ATOM 1611 CA GLU A 397 19.511 -2.410 -76.503 1.00138.92 C
ATOM 1612 C GLU A 397 20.121 -3.352 -75.474 1.00138.92 C
ATOM 1613 O GLU A 397 19.435 -4.212 -74.923 1.00138.92 O
ATOM 1614 CB GLU A 397 18.037 -2.756 -76.717 1.00138.92 C
ATOM 1615 N GLU A 402 23.220 -9.884 -68.548 1.00127.89 N
ATOM 1616 CA GLU A 402 23.941 -11.045 -69.047 1.00127.89 C
ATOM 1617 C GLU A 402 24.003 -11.103 -70.566 1.00127.89 C
ATOM 1618 O GLU A 402 23.984 -12.201 -71.130 1.00127.89 O
ATOM 1619 CB GLU A 402 23.306 -12.327 -68.505 1.00127.89 C
ATOM 1620 N ILE A 403 24.063 -9.954 -71.241 1.00121.98 N
ATOM 1621 CA ILE A 403 24.109 -9.961 -72.700 1.00121.98 C
ATOM 1622 C ILE A 403 25.465 -10.443 -73.200 1.00121.98 C
ATOM 1623 O ILE A 403 25.570 -10.991 -74.304 1.00121.98 O
ATOM 1624 CB ILE A 403 23.762 -8.568 -73.257 1.00121.98 C
ATOM 1625 CG1 ILE A 403 24.703 -7.504 -72.688 1.00121.98 C
ATOM 1626 CG2 ILE A 403 22.311 -8.234 -72.973 1.00121.98 C
ATOM 1627 CD1 ILE A 403 24.585 -6.165 -73.366 1.00121.98 C
ATOM 1628 N VAL A 404 26.517 -10.266 -72.397 1.00117.38 N
ATOM 1629 CA VAL A 404 27.868 -10.583 -72.855 1.00117.38 C
ATOM 1630 C VAL A 404 28.064 -12.089 -72.928 1.00117.38 C
ATOM 1631 O VAL A 404 28.524 -12.624 -73.946 1.00117.38 O
ATOM 1632 CB VAL A 404 28.914 -9.925 -71.939 1.00117.38 C
ATOM 1633 CG1 VAL A 404 30.312 -10.328 -72.364 1.00117.38 C
ATOM 1634 CG2 VAL A 404 28.762 -8.422 -71.971 1.00117.38 C
ATOM 1635 N SER A 405 27.713 -12.792 -71.845 1.00114.77 N
ATOM 1636 CA SER A 405 27.816 -14.247 -71.825 1.00114.77 C
ATOM 1637 C SER A 405 26.880 -14.874 -72.841 1.00114.77 C
ATOM 1638 O SER A 405 27.234 -15.864 -73.492 1.00114.77 O
ATOM 1639 CB SER A 405 27.500 -14.779 -70.431 1.00114.77 C
ATOM 1640 OG SER A 405 26.137 -14.566 -70.123 1.00114.77 O
ATOM 1641 N ASN A 406 25.696 -14.279 -73.011 1.00113.60 N
ATOM 1642 CA ASN A 406 24.744 -14.759 -74.005 1.00113.60 C
ATOM 1643 C ASN A 406 25.308 -14.624 -75.413 1.00113.60 C
ATOM 1644 O ASN A 406 25.226 -15.564 -76.212 1.00113.60 O
ATOM 1645 CB ASN A 406 23.432 -13.988 -73.878 1.00113.60 C
ATOM 1646 CG ASN A 406 22.288 -14.645 -74.627 1.00113.60 C
ATOM 1647 OD1 ASN A 406 22.445 -15.708 -75.225 1.00113.60 O
ATOM 1648 ND2 ASN A 406 21.125 -14.008 -74.597 1.00113.60 N
ATOM 1649 N ALA A 407 25.932 -13.482 -75.712 1.00112.88 N
ATOM 1650 CA ALA A 407 26.470 -13.254 -77.047 1.00112.88 C
ATOM 1651 C ALA A 407 27.657 -14.163 -77.333 1.00112.88 C
ATOM 1652 O ALA A 407 27.751 -14.742 -78.424 1.00112.88 O
ATOM 1653 CB ALA A 407 26.867 -11.789 -77.202 1.00112.88 C
ATOM 1654 N ILE A 408 28.553 -14.320 -76.352 1.00109.06 N
ATOM 1655 CA ILE A 408 29.733 -15.162 -76.541 1.00109.06 C
ATOM 1656 C ILE A 408 29.331 -16.618 -76.720 1.00109.06 C
ATOM 1657 O ILE A 408 29.799 -17.296 -77.647 1.00109.06 O
ATOM 1658 CB ILE A 408 30.712 -14.983 -75.366 1.00109.06 C
ATOM 1659 CG1 ILE A 408 31.289 -13.571 -75.370 1.00109.06 C
ATOM 1660 CG2 ILE A 408 31.842 -15.985 -75.445 1.00109.06 C
ATOM 1661 CD1 ILE A 408 32.069 -13.222 -74.130 1.00109.06 C
ATOM 1662 N SER A 409 28.423 -17.106 -75.871 1.00107.06 N
ATOM 1663 CA SER A 409 28.001 -18.496 -75.953 1.00107.06 C
ATOM 1664 C SER A 409 27.199 -18.762 -77.215 1.00107.06 C
ATOM 1665 O SER A 409 27.325 -19.832 -77.816 1.00107.06 O
ATOM 1666 CB SER A 409 27.181 -18.858 -74.725 1.00107.06 C
ATOM 1667 OG SER A 409 25.993 -18.096 -74.689 1.00107.06 O
ATOM 1668 N PHE A 410 26.398 -17.789 -77.653 1.00109.65 N
ATOM 1669 CA PHE A 410 25.618 -17.980 -78.868 1.00109.65 C
ATOM 1670 C PHE A 410 26.509 -17.998 -80.100 1.00109.65 C
ATOM 1671 O PHE A 410 26.303 -18.815 -81.008 1.00109.65 O
ATOM 1672 CB PHE A 410 24.559 -16.892 -78.978 1.00109.65 C
ATOM 1673 CG PHE A 410 23.720 -17.000 -80.204 1.00109.65 C
ATOM 1674 CD1 PHE A 410 22.796 -18.021 -80.333 1.00109.65 C
ATOM 1675 CD2 PHE A 410 23.841 -16.073 -81.223 1.00109.65 C
ATOM 1676 CE1 PHE A 410 22.015 -18.124 -81.465 1.00109.65 C
ATOM 1677 CE2 PHE A 410 23.061 -16.165 -82.356 1.00109.65 C
ATOM 1678 CZ PHE A 410 22.148 -17.194 -82.478 1.00109.65 C
ATOM 1679 N ALA A 411 27.529 -17.133 -80.132 1.00109.54 N
ATOM 1680 CA ALA A 411 28.473 -17.145 -81.244 1.00109.54 C
ATOM 1681 C ALA A 411 29.285 -18.431 -81.263 1.00109.54 C
ATOM 1682 O ALA A 411 29.534 -19.002 -82.334 1.00109.54 O
ATOM 1683 CB ALA A 411 29.394 -15.932 -81.160 1.00109.54 C
ATOM 1684 N LEU A 412 29.674 -18.921 -80.085 1.00105.13 N
ATOM 1685 CA LEU A 412 30.470 -20.138 -80.027 1.00105.13 C
ATOM 1686 C LEU A 412 29.643 -21.359 -80.412 1.00105.13 C
ATOM 1687 O LEU A 412 30.143 -22.273 -81.081 1.00105.13 O
ATOM 1688 CB LEU A 412 31.057 -20.298 -78.632 1.00105.13 C
ATOM 1689 CG LEU A 412 32.067 -21.426 -78.496 1.00105.13 C
ATOM 1690 CD1 LEU A 412 33.249 -21.114 -79.376 1.00105.13 C
ATOM 1691 CD2 LEU A 412 32.482 -21.566 -77.053 1.00105.13 C
ATOM 1692 N TYR A 413 28.365 -21.378 -80.025 1.00108.06 N
ATOM 1693 CA TYR A 413 27.493 -22.470 -80.437 1.00108.06 C
ATOM 1694 C TYR A 413 27.219 -22.421 -81.929 1.00108.06 C
ATOM 1695 O TYR A 413 27.127 -23.469 -82.576 1.00108.06 O
ATOM 1696 CB TYR A 413 26.183 -22.436 -79.660 1.00108.06 C
ATOM 1697 CG TYR A 413 25.225 -23.497 -80.121 1.00108.06 C
ATOM 1698 CD1 TYR A 413 25.487 -24.834 -79.880 1.00108.06 C
ATOM 1699 CD2 TYR A 413 24.062 -23.164 -80.796 1.00108.06 C
ATOM 1700 CE1 TYR A 413 24.623 -25.817 -80.302 1.00108.06 C
ATOM 1701 CE2 TYR A 413 23.185 -24.142 -81.223 1.00108.06 C
ATOM 1702 CZ TYR A 413 23.473 -25.469 -80.972 1.00108.06 C
ATOM 1703 OH TYR A 413 22.610 -26.457 -81.390 1.00108.06 O
ATOM 1704 N LYS A 414 27.095 -21.212 -82.490 1.00110.58 N
ATOM 1705 CA LYS A 414 26.949 -21.065 -83.935 1.00110.58 C
ATOM 1706 C LYS A 414 28.161 -21.613 -84.673 1.00110.58 C
ATOM 1707 O LYS A 414 28.016 -22.325 -85.673 1.00110.58 O
ATOM 1708 CB LYS A 414 26.735 -19.597 -84.295 1.00110.58 C
ATOM 1709 CG LYS A 414 25.297 -19.138 -84.204 1.00110.58 C
ATOM 1710 CD LYS A 414 25.138 -17.758 -84.812 1.00110.58 C
ATOM 1711 N ALA A 415 29.359 -21.316 -84.172 1.00112.16 N
ATOM 1712 CA ALA A 415 30.594 -21.813 -84.767 1.00112.16 C
ATOM 1713 C ALA A 415 30.698 -23.331 -84.688 1.00112.16 C
ATOM 1714 O ALA A 415 31.038 -23.988 -85.681 1.00112.16 O
ATOM 1715 CB ALA A 415 31.803 -21.175 -84.089 1.00112.16 C
ATOM 1716 N PHE A 416 30.395 -23.898 -83.521 1.00112.60 N
ATOM 1717 CA PHE A 416 30.520 -25.341 -83.363 1.00112.60 C
ATOM 1718 C PHE A 416 29.429 -26.094 -84.114 1.00112.60 C
ATOM 1719 O PHE A 416 29.620 -27.242 -84.527 1.00112.60 O
ATOM 1720 CB PHE A 416 30.516 -25.711 -81.881 1.00112.60 C
ATOM 1721 CG PHE A 416 30.716 -27.172 -81.630 1.00112.60 C
ATOM 1722 CD1 PHE A 416 31.932 -27.769 -81.913 1.00112.60 C
ATOM 1723 CD2 PHE A 416 29.701 -27.945 -81.100 1.00112.60 C
ATOM 1724 CE1 PHE A 416 32.127 -29.115 -81.688 1.00112.60 C
ATOM 1725 CE2 PHE A 416 29.891 -29.291 -80.866 1.00112.60 C
ATOM 1726 CZ PHE A 416 31.107 -29.875 -81.160 1.00112.60 C
ATOM 1727 N SER A 417 28.277 -25.456 -84.318 1.00118.39 N
ATOM 1728 CA SER A 417 27.233 -26.087 -85.115 1.00118.39 C
ATOM 1729 C SER A 417 27.558 -26.013 -86.600 1.00118.39 C
ATOM 1730 O SER A 417 27.294 -26.962 -87.347 1.00118.39 O
ATOM 1731 CB SER A 417 25.887 -25.433 -84.821 1.00118.39 C
ATOM 1732 OG SER A 417 25.512 -25.645 -83.473 1.00118.39 O
ATOM 1733 N THR A 418 28.137 -24.895 -87.047 1.00128.95 N
ATOM 1734 CA THR A 418 28.501 -24.762 -88.454 1.00128.95 C
ATOM 1735 C THR A 418 29.719 -25.609 -88.798 1.00128.95 C
ATOM 1736 O THR A 418 29.979 -25.873 -89.978 1.00128.95 O
ATOM 1737 CB THR A 418 28.762 -23.296 -88.795 1.00128.95 C
ATOM 1738 N ASN A 419 30.502 -26.002 -87.787 1.00131.70 N
ATOM 1739 CA ASN A 419 31.565 -26.980 -88.006 1.00131.70 C
ATOM 1740 C ASN A 419 30.999 -28.307 -88.495 1.00131.70 C
ATOM 1741 O ASN A 419 31.516 -28.900 -89.449 1.00131.70 O
ATOM 1742 CB ASN A 419 32.371 -27.181 -86.723 1.00131.70 C
ATOM 1743 CG ASN A 419 33.328 -26.042 -86.454 1.00131.70 C
ATOM 1744 OD1 ASN A 419 34.022 -25.580 -87.357 1.00131.70 O
ATOM 1745 ND2 ASN A 419 33.364 -25.576 -85.213 1.00131.70 N
ATOM 1746 N GLU A 420 29.952 -28.801 -87.827 1.00135.64 N
ATOM 1747 CA GLU A 420 29.135 -29.960 -88.195 1.00135.64 C
ATOM 1748 C GLU A 420 29.903 -31.275 -88.280 1.00135.64 C
ATOM 1749 O GLU A 420 29.354 -32.266 -88.780 1.00135.64 O
ATOM 1750 CB GLU A 420 28.391 -29.732 -89.517 1.00135.64 C
ATOM 1751 N HIS A 421 31.156 -31.322 -87.819 1.00140.99 N
ATOM 1752 CA HIS A 421 31.849 -32.600 -87.708 1.00140.99 C
ATOM 1753 C HIS A 421 31.262 -33.424 -86.573 1.00140.99 C
ATOM 1754 O HIS A 421 31.236 -34.659 -86.632 1.00140.99 O
ATOM 1755 CB HIS A 421 33.346 -32.370 -87.499 1.00140.99 C
ATOM 1756 N ASP A 422 30.786 -32.752 -85.531 1.00140.01 N
ATOM 1757 CA ASP A 422 30.018 -33.370 -84.464 1.00140.01 C
ATOM 1758 C ASP A 422 28.525 -33.100 -84.593 1.00140.01 C
ATOM 1759 O ASP A 422 27.870 -32.837 -83.579 1.00140.01 O
ATOM 1760 CB ASP A 422 30.520 -32.877 -83.103 1.00140.01 C
ATOM 1761 N ARG A 423 27.984 -33.120 -85.814 1.00140.28 N
ATOM 1762 CA ARG A 423 26.555 -32.891 -86.006 1.00140.28 C
ATOM 1763 C ARG A 423 25.730 -34.035 -85.424 1.00140.28 C
ATOM 1764 O ARG A 423 24.704 -33.807 -84.771 1.00140.28 O
ATOM 1765 CB ARG A 423 26.252 -32.706 -87.493 1.00140.28 C
ATOM 1766 N ASP A 424 26.164 -35.277 -85.651 1.00130.40 N
ATOM 1767 CA ASP A 424 25.510 -36.411 -85.003 1.00130.40 C
ATOM 1768 C ASP A 424 25.827 -36.444 -83.514 1.00130.40 C
ATOM 1769 O ASP A 424 25.017 -36.916 -82.710 1.00130.40 O
ATOM 1770 CB ASP A 424 25.934 -37.716 -85.673 1.00130.40 C
ATOM 1771 N ASN A 425 26.999 -35.937 -83.131 1.00122.84 N
ATOM 1772 CA ASN A 425 27.408 -35.874 -81.729 1.00122.84 C
ATOM 1773 C ASN A 425 26.774 -34.643 -81.090 1.00122.84 C
ATOM 1774 O ASN A 425 27.413 -33.617 -80.846 1.00122.84 O
ATOM 1775 CB ASN A 425 28.925 -35.854 -81.607 1.00122.84 C
ATOM 1776 N TRP A 426 25.487 -34.775 -80.776 1.00117.08 N
ATOM 1777 CA TRP A 426 24.727 -33.742 -80.085 1.00117.08 C
ATOM 1778 C TRP A 426 25.144 -33.640 -78.626 1.00117.08 C
ATOM 1779 O TRP A 426 24.829 -32.659 -77.948 1.00117.08 O
ATOM 1780 CB TRP A 426 23.233 -34.048 -80.184 1.00117.08 C
ATOM 1781 CG TRP A 426 22.876 -35.394 -79.619 1.00117.08 C
ATOM 1782 CD1 TRP A 426 22.885 -36.585 -80.281 1.00117.08 C
ATOM 1783 CD2 TRP A 426 22.457 -35.685 -78.280 1.00117.08 C
ATOM 1784 NE1 TRP A 426 22.502 -37.599 -79.440 1.00117.08 N
ATOM 1785 CE2 TRP A 426 22.231 -37.072 -78.205 1.00117.08 C
ATOM 1786 CE3 TRP A 426 22.250 -34.908 -77.139 1.00117.08 C
ATOM 1787 CZ2 TRP A 426 21.809 -37.698 -77.035 1.00117.08 C
ATOM 1788 CZ3 TRP A 426 21.831 -35.530 -75.978 1.00117.08 C
ATOM 1789 CH2 TRP A 426 21.615 -36.910 -75.936 1.00117.08 C
ATOM 1790 N ASN A 427 25.856 -34.658 -78.149 1.00106.48 N
ATOM 1791 CA ASN A 427 26.353 -34.752 -76.789 1.00106.48 C
ATOM 1792 C ASN A 427 27.294 -33.615 -76.422 1.00106.48 C
ATOM 1793 O ASN A 427 27.285 -33.161 -75.275 1.00106.48 O
ATOM 1794 CB ASN A 427 27.077 -36.092 -76.617 1.00106.48 C
ATOM 1795 CG ASN A 427 27.267 -36.482 -75.173 1.00106.48 C
ATOM 1796 OD1 ASN A 427 26.814 -35.798 -74.261 1.00106.48 O
ATOM 1797 ND2 ASN A 427 27.951 -37.595 -74.957 1.00106.48 N
ATOM 1798 N GLY A 428 28.083 -33.123 -77.375 1.00103.21 N
ATOM 1799 CA GLY A 428 28.980 -32.020 -77.074 1.00103.21 C
ATOM 1800 C GLY A 428 28.258 -30.692 -76.960 1.00103.21 C
ATOM 1801 O GLY A 428 28.662 -29.823 -76.180 1.00103.21 O
ATOM 1802 N GLN A 429 27.181 -30.516 -77.734 1.00104.18 N
ATOM 1803 CA GLN A 429 26.430 -29.265 -77.691 1.00104.18 C
ATOM 1804 C GLN A 429 25.718 -29.100 -76.358 1.00104.18 C
ATOM 1805 O GLN A 429 25.530 -27.976 -75.878 1.00104.18 O
ATOM 1806 CB GLN A 429 25.419 -29.209 -78.834 1.00104.18 C
ATOM 1807 CG GLN A 429 26.034 -29.195 -80.216 1.00104.18 C
ATOM 1808 CD GLN A 429 24.992 -29.073 -81.312 1.00104.18 C
ATOM 1809 OE1 GLN A 429 23.797 -28.999 -81.040 1.00104.18 O
ATOM 1810 NE2 GLN A 429 25.442 -29.059 -82.559 1.00104.18 N
ATOM 1811 N LEU A 430 25.340 -30.214 -75.729 1.00 98.26 N
ATOM 1812 CA LEU A 430 24.679 -30.134 -74.435 1.00 98.26 C
ATOM 1813 C LEU A 430 25.659 -29.720 -73.350 1.00 98.26 C
ATOM 1814 O LEU A 430 25.327 -28.904 -72.487 1.00 98.26 O
ATOM 1815 CB LEU A 430 24.026 -31.468 -74.094 1.00 98.26 C
ATOM 1816 CG LEU A 430 23.090 -31.414 -72.897 1.00 98.26 C
ATOM 1817 CD1 LEU A 430 21.953 -30.473 -73.212 1.00 98.26 C
ATOM 1818 CD2 LEU A 430 22.564 -32.793 -72.617 1.00 98.26 C
ATOM 1819 N LYS A 431 26.888 -30.238 -73.401 1.00 93.07 N
ATOM 1820 CA LYS A 431 27.912 -29.786 -72.465 1.00 93.07 C
ATOM 1821 C LYS A 431 28.301 -28.339 -72.736 1.00 93.07 C
ATOM 1822 O LYS A 431 28.625 -27.590 -71.806 1.00 93.07 O
ATOM 1823 CB LYS A 431 29.135 -30.693 -72.545 1.00 93.07 C
ATOM 1824 CG LYS A 431 28.894 -32.087 -72.015 1.00 93.07 C
ATOM 1825 CD LYS A 431 30.161 -32.907 -72.055 1.00 93.07 C
ATOM 1826 CE LYS A 431 29.927 -34.312 -71.550 1.00 93.07 C
ATOM 1827 NZ LYS A 431 31.175 -35.111 -71.616 1.00 93.07 N
ATOM 1828 N LEU A 432 28.256 -27.929 -74.005 1.00 92.87 N
ATOM 1829 CA LEU A 432 28.560 -26.548 -74.355 1.00 92.87 C
ATOM 1830 C LEU A 432 27.513 -25.592 -73.799 1.00 92.87 C
ATOM 1831 O LEU A 432 27.853 -24.538 -73.254 1.00 92.87 O
ATOM 1832 CB LEU A 432 28.659 -26.413 -75.868 1.00 92.87 C
ATOM 1833 CG LEU A 432 29.081 -25.030 -76.335 1.00 92.87 C
ATOM 1834 CD1 LEU A 432 30.460 -24.724 -75.809 1.00 92.87 C
ATOM 1835 CD2 LEU A 432 29.060 -24.978 -77.843 1.00 92.87 C
ATOM 1836 N LEU A 433 26.234 -25.959 -73.900 1.00 91.27 N
ATOM 1837 CA LEU A 433 25.176 -25.144 -73.309 1.00 91.27 C
ATOM 1838 C LEU A 433 25.033 -25.414 -71.818 1.00 91.27 C
ATOM 1839 O LEU A 433 24.177 -24.823 -71.151 1.00 91.27 O
ATOM 1840 CB LEU A 433 23.858 -25.402 -74.029 1.00 91.27 C
ATOM 1841 CG LEU A 433 23.817 -24.858 -75.448 1.00 91.27 C
ATOM 1842 CD1 LEU A 433 22.610 -25.377 -76.189 1.00 91.27 C
ATOM 1843 CD2 LEU A 433 23.791 -23.348 -75.380 1.00 91.27 C
ATOM 1844 N LEU A 434 25.820 -26.346 -71.290 1.00 84.15 N
ATOM 1845 CA LEU A 434 25.892 -26.513 -69.846 1.00 84.15 C
ATOM 1846 C LEU A 434 26.952 -25.607 -69.234 1.00 84.15 C
ATOM 1847 O LEU A 434 26.768 -25.095 -68.123 1.00 84.15 O
ATOM 1848 CB LEU A 434 26.165 -27.975 -69.516 1.00 84.15 C
ATOM 1849 CG LEU A 434 26.401 -28.333 -68.052 1.00 84.15 C
ATOM 1850 CD1 LEU A 434 25.216 -27.964 -67.198 1.00 84.15 C
ATOM 1851 CD2 LEU A 434 26.685 -29.811 -67.933 1.00 84.15 C
ATOM 1852 N GLU A 435 28.066 -25.392 -69.942 1.00 95.18 N
ATOM 1853 CA GLU A 435 29.140 -24.565 -69.395 1.00 95.18 C
ATOM 1854 C GLU A 435 28.715 -23.112 -69.263 1.00 95.18 C
ATOM 1855 O GLU A 435 28.885 -22.503 -68.204 1.00 95.18 O
ATOM 1856 CB GLU A 435 30.392 -24.673 -70.260 1.00 95.18 C
ATOM 1857 CG GLU A 435 31.093 -26.003 -70.144 1.00 95.18 C
ATOM 1858 CD GLU A 435 31.709 -26.199 -68.780 1.00 95.18 C
ATOM 1859 OE1 GLU A 435 32.150 -25.196 -68.178 1.00 95.18 O
ATOM 1860 OE2 GLU A 435 31.747 -27.353 -68.305 1.00 95.18 O
ATOM 1861 N TRP A 436 28.149 -22.546 -70.317 1.00 88.30 N
ATOM 1862 CA TRP A 436 27.488 -21.256 -70.238 1.00 88.30 C
ATOM 1863 C TRP A 436 26.005 -21.497 -70.020 1.00 88.30 C
ATOM 1864 O TRP A 436 25.391 -22.280 -70.747 1.00 88.30 O
ATOM 1865 CB TRP A 436 27.720 -20.446 -71.507 1.00 88.30 C
ATOM 1866 CG TRP A 436 29.124 -19.997 -71.663 1.00 88.30 C
ATOM 1867 CD1 TRP A 436 29.651 -18.805 -71.276 1.00 88.30 C
ATOM 1868 CD2 TRP A 436 30.195 -20.748 -72.218 1.00 88.30 C
ATOM 1869 NE1 TRP A 436 30.988 -18.760 -71.572 1.00 88.30 N
ATOM 1870 CE2 TRP A 436 31.345 -19.946 -72.151 1.00 88.30 C
ATOM 1871 CE3 TRP A 436 30.295 -22.022 -72.772 1.00 88.30 C
ATOM 1872 CZ2 TRP A 436 32.575 -20.375 -72.616 1.00 88.30 C
ATOM 1873 CZ3 TRP A 436 31.516 -22.446 -73.231 1.00 88.30 C
ATOM 1874 CH2 TRP A 436 32.640 -21.628 -73.153 1.00 88.30 C
ATOM 1875 N ASN A 437 25.436 -20.836 -69.021 1.00 89.08 N
ATOM 1876 CA ASN A 437 24.059 -21.100 -68.614 1.00 89.08 C
ATOM 1877 C ASN A 437 23.118 -20.489 -69.643 1.00 89.08 C
ATOM 1878 O ASN A 437 22.910 -19.276 -69.670 1.00 89.08 O
ATOM 1879 CB ASN A 437 23.805 -20.539 -67.221 1.00 89.08 C
ATOM 1880 CG ASN A 437 22.505 -21.030 -66.612 1.00 89.08 C
ATOM 1881 OD1 ASN A 437 21.760 -21.791 -67.224 1.00 89.08 O
ATOM 1882 ND2 ASN A 437 22.230 -20.591 -65.392 1.00 89.08 N
ATOM 1883 N GLN A 438 22.550 -21.334 -70.505 1.00 99.66 N
ATOM 1884 CA GLN A 438 21.474 -20.942 -71.416 1.00 99.66 C
ATOM 1885 C GLN A 438 20.411 -22.039 -71.416 1.00 99.66 C
ATOM 1886 O GLN A 438 20.599 -23.114 -71.984 1.00 99.66 O
ATOM 1887 CB GLN A 438 21.983 -20.677 -72.821 1.00 99.66 C
ATOM 1888 CG GLN A 438 22.740 -19.397 -72.978 1.00 99.66 C
ATOM 1889 CD GLN A 438 23.065 -19.135 -74.418 1.00 99.66 C
ATOM 1890 OE1 GLN A 438 22.809 -19.970 -75.279 1.00 99.66 O
ATOM 1891 NE2 GLN A 438 23.608 -17.961 -74.698 1.00 99.66 N
ATOM 1892 N LEU A 439 19.285 -21.760 -70.762 1.00100.24 N
ATOM 1893 CA LEU A 439 18.219 -22.750 -70.697 1.00100.24 C
ATOM 1894 C LEU A 439 17.424 -22.801 -71.992 1.00100.24 C
ATOM 1895 O LEU A 439 17.226 -23.882 -72.560 1.00100.24 O
ATOM 1896 CB LEU A 439 17.289 -22.450 -69.527 1.00100.24 C
ATOM 1897 CG LEU A 439 16.139 -23.446 -69.409 1.00100.24 C
ATOM 1898 CD1 LEU A 439 16.669 -24.831 -69.105 1.00100.24 C
ATOM 1899 CD2 LEU A 439 15.137 -23.001 -68.362 1.00100.24 C
ATOM 1900 N ASP A 440 16.961 -21.640 -72.471 1.00101.82 N
ATOM 1901 CA ASP A 440 15.912 -21.599 -73.489 1.00101.82 C
ATOM 1902 C ASP A 440 16.413 -22.085 -74.839 1.00101.82 C
ATOM 1903 O ASP A 440 15.708 -22.823 -75.540 1.00101.82 O
ATOM 1904 CB ASP A 440 15.355 -20.182 -73.607 1.00101.82 C
ATOM 1905 N LEU A 441 17.628 -21.687 -75.219 1.00100.13 N
ATOM 1906 CA LEU A 441 18.205 -22.162 -76.469 1.00100.13 C
ATOM 1907 C LEU A 441 18.482 -23.658 -76.420 1.00100.13 C
ATOM 1908 O LEU A 441 18.328 -24.350 -77.434 1.00100.13 O
ATOM 1909 CB LEU A 441 19.477 -21.377 -76.779 1.00100.13 C
ATOM 1910 CG LEU A 441 20.186 -21.674 -78.097 1.00100.13 C
ATOM 1911 CD1 LEU A 441 19.257 -21.409 -79.257 1.00100.13 C
ATOM 1912 CD2 LEU A 441 21.428 -20.820 -78.220 1.00100.13 C
ATOM 1913 N ALA A 442 18.839 -24.176 -75.245 1.00 99.43 N
ATOM 1914 CA ALA A 442 19.052 -25.608 -75.089 1.00 99.43 C
ATOM 1915 C ALA A 442 17.754 -26.391 -75.174 1.00 99.43 C
ATOM 1916 O ALA A 442 17.737 -27.494 -75.731 1.00 99.43 O
ATOM 1917 CB ALA A 442 19.740 -25.895 -73.758 1.00 99.43 C
ATOM 1918 N SER A 443 16.665 -25.847 -74.633 1.00107.58 N
ATOM 1919 CA SER A 443 15.387 -26.542 -74.716 1.00107.58 C
ATOM 1920 C SER A 443 14.807 -26.477 -76.120 1.00107.58 C
ATOM 1921 O SER A 443 14.168 -27.434 -76.568 1.00107.58 O
ATOM 1922 CB SER A 443 14.396 -25.952 -73.717 1.00107.58 C
ATOM 1923 OG SER A 443 14.056 -24.624 -74.072 1.00107.58 O
ATOM 1924 N ASP A 444 15.025 -25.370 -76.827 1.00106.63 N
ATOM 1925 CA ASP A 444 14.481 -25.232 -78.171 1.00106.63 C
ATOM 1926 C ASP A 444 15.277 -26.017 -79.206 1.00106.63 C
ATOM 1927 O ASP A 444 14.685 -26.657 -80.081 1.00106.63 O
ATOM 1928 CB ASP A 444 14.424 -23.755 -78.566 1.00106.63 C
ATOM 1929 N GLU A 445 16.607 -25.996 -79.126 1.00102.00 N
ATOM 1930 CA GLU A 445 17.418 -26.608 -80.170 1.00102.00 C
ATOM 1931 C GLU A 445 17.492 -28.125 -80.050 1.00102.00 C
ATOM 1932 O GLU A 445 17.077 -28.842 -80.964 1.00102.00 O
ATOM 1933 CB GLU A 445 18.828 -26.017 -80.152 1.00102.00 C
ATOM 1934 N ILE A 446 18.010 -28.626 -78.927 1.00101.59 N
ATOM 1935 CA ILE A 446 18.384 -30.036 -78.851 1.00101.59 C
ATOM 1936 C ILE A 446 17.165 -30.916 -78.615 1.00101.59 C
ATOM 1937 O ILE A 446 17.000 -31.958 -79.260 1.00101.59 O
ATOM 1938 CB ILE A 446 19.442 -30.247 -77.754 1.00101.59 C
ATOM 1939 CG1 ILE A 446 20.670 -29.392 -78.024 1.00101.59 C
ATOM 1940 CG2 ILE A 446 19.866 -31.693 -77.696 1.00101.59 C
ATOM 1941 CD1 ILE A 446 21.656 -29.393 -76.879 1.00101.59 C
ATOM 1942 N PHE A 447 16.321 -30.511 -77.674 1.00103.32 N
ATOM 1943 CA PHE A 447 15.154 -31.310 -77.313 1.00103.32 C
ATOM 1944 C PHE A 447 13.919 -31.202 -78.207 1.00103.32 C
ATOM 1945 O PHE A 447 12.833 -30.860 -77.741 1.00103.32 O
ATOM 1946 CB PHE A 447 14.789 -31.090 -75.843 1.00103.32 C
ATOM 1947 CG PHE A 447 15.811 -31.631 -74.886 1.00103.32 C
ATOM 1948 CD1 PHE A 447 15.923 -32.993 -74.672 1.00103.32 C
ATOM 1949 CD2 PHE A 447 16.667 -30.782 -74.210 1.00103.32 C
ATOM 1950 CE1 PHE A 447 16.865 -33.501 -73.801 1.00103.32 C
ATOM 1951 CE2 PHE A 447 17.611 -31.281 -73.334 1.00103.32 C
ATOM 1952 CZ PHE A 447 17.711 -32.643 -73.129 1.00103.32 C
ATOM 1953 N THR A 448 14.094 -31.499 -79.491 1.00113.84 N
ATOM 1954 CA THR A 448 12.980 -31.505 -80.430 1.00113.84 C
ATOM 1955 C THR A 448 12.404 -32.908 -80.318 1.00113.84 C
ATOM 1956 O THR A 448 13.157 -33.871 -80.157 1.00113.84 O
ATOM 1957 CB THR A 448 13.446 -31.257 -81.872 1.00113.84 C
ATOM 1958 OG1 THR A 448 14.149 -32.408 -82.353 1.00113.84 O
ATOM 1959 CG2 THR A 448 14.358 -30.041 -81.933 1.00113.84 C
ATOM 1960 N ASN A 449 11.085 -33.051 -80.406 1.00113.05 N
ATOM 1961 CA ASN A 449 10.510 -34.386 -80.242 1.00113.05 C
ATOM 1962 C ASN A 449 11.033 -35.385 -81.272 1.00113.05 C
ATOM 1963 O ASN A 449 10.634 -36.555 -81.252 1.00113.05 O
ATOM 1964 CB ASN A 449 8.985 -34.307 -80.315 1.00113.05 C
ATOM 1965 N ASP A 450 11.914 -34.951 -82.177 1.00121.84 N
ATOM 1966 CA ASP A 450 12.443 -35.858 -83.188 1.00121.84 C
ATOM 1967 C ASP A 450 13.399 -36.882 -82.584 1.00121.84 C
ATOM 1968 O ASP A 450 13.123 -38.086 -82.613 1.00121.84 O
ATOM 1969 CB ASP A 450 13.141 -35.056 -84.286 1.00121.84 C
ATOM 1970 N ARG A 451 14.502 -36.402 -82.015 1.00126.81 N
ATOM 1971 CA ARG A 451 15.521 -37.270 -81.420 1.00126.81 C
ATOM 1972 C ARG A 451 15.038 -38.143 -80.257 1.00126.81 C
ATOM 1973 O ARG A 451 14.060 -37.824 -79.581 1.00126.81 O
ATOM 1974 CB ARG A 451 16.730 -36.441 -80.980 1.00126.81 C
ATOM 1975 N ASN A 452 15.751 -39.245 -80.033 1.00125.66 N
ATOM 1976 CA ASN A 452 15.433 -40.187 -78.962 1.00125.66 C
ATOM 1977 C ASN A 452 16.566 -40.292 -77.946 1.00125.66 C
ATOM 1978 O ASN A 452 17.732 -40.431 -78.316 1.00125.66 O
ATOM 1979 CB ASN A 452 15.110 -41.566 -79.536 1.00125.66 C
ATOM 1980 CG ASN A 452 13.827 -41.575 -80.341 1.00125.66 C
ATOM 1981 OD1 ASN A 452 13.019 -40.651 -80.255 1.00125.66 O
ATOM 1982 ND2 ASN A 452 13.632 -42.625 -81.130 1.00125.66 N
ATOM 1983 N TRP A 453 16.217 -40.222 -76.666 1.00122.59 N
ATOM 1984 CA TRP A 453 17.206 -40.280 -75.592 1.00122.59 C
ATOM 1985 C TRP A 453 16.829 -41.235 -74.458 1.00122.59 C
ATOM 1986 O TRP A 453 15.652 -41.421 -74.154 1.00122.59 O
ATOM 1987 CB TRP A 453 17.440 -38.873 -75.034 1.00122.59 C
ATOM 1988 CG TRP A 453 16.328 -37.929 -75.371 1.00122.59 C
ATOM 1989 CD1 TRP A 453 15.051 -37.966 -74.896 1.00122.59 C
ATOM 1990 CD2 TRP A 453 16.386 -36.825 -76.279 1.00122.59 C
ATOM 1991 NE1 TRP A 453 14.312 -36.947 -75.445 1.00122.59 N
ATOM 1992 CE2 TRP A 453 15.110 -36.231 -76.297 1.00122.59 C
ATOM 1993 CE3 TRP A 453 17.396 -36.275 -77.075 1.00122.59 C
ATOM 1994 CZ2 TRP A 453 14.815 -35.117 -77.080 1.00122.59 C
ATOM 1995 CZ3 TRP A 453 17.102 -35.168 -77.850 1.00122.59 C
ATOM 1996 CH2 TRP A 453 15.823 -34.601 -77.847 1.00122.59 C
ATOM 1997 N GLU A 454 17.843 -41.835 -73.839 1.00113.33 N
ATOM 1998 CA GLU A 454 17.643 -42.758 -72.725 1.00113.33 C
ATOM 1999 C GLU A 454 18.218 -42.137 -71.456 1.00113.33 C
ATOM 2000 O GLU A 454 18.646 -40.984 -71.474 1.00113.33 O
ATOM 2001 CB GLU A 454 18.315 -44.101 -73.010 1.00113.33 C
ATOM 2002 N SER A 455 18.236 -42.888 -70.358 1.00107.50 N
ATOM 2003 CA SER A 455 18.770 -42.343 -69.113 1.00107.50 C
ATOM 2004 C SER A 455 20.293 -42.399 -69.092 1.00107.50 C
ATOM 2005 O SER A 455 20.950 -41.444 -68.654 1.00107.50 O
ATOM 2006 CB SER A 455 18.194 -43.105 -67.921 1.00107.50 C
ATOM 2007 N ALA A 456 20.865 -43.501 -69.592 1.00104.56 N
ATOM 2008 CA ALA A 456 22.315 -43.684 -69.595 1.00104.56 C
ATOM 2009 C ALA A 456 23.003 -42.693 -70.522 1.00104.56 C
ATOM 2010 O ALA A 456 24.197 -42.411 -70.368 1.00104.56 O
ATOM 2011 CB ALA A 456 22.659 -45.117 -70.001 1.00104.56 C
ATOM 2012 N ASP A 457 22.271 -42.171 -71.504 1.00104.56 N
ATOM 2013 CA ASP A 457 22.769 -41.038 -72.269 1.00104.56 C
ATOM 2014 C ASP A 457 22.897 -39.800 -71.391 1.00104.56 C
ATOM 2015 O ASP A 457 23.837 -39.014 -71.548 1.00104.56 O
ATOM 2016 CB ASP A 457 21.845 -40.764 -73.453 1.00104.56 C
ATOM 2017 N LEU A 458 21.929 -39.543 -70.519 1.00 95.90 N
ATOM 2018 CA LEU A 458 21.958 -38.297 -69.736 1.00 95.90 C
ATOM 2019 C LEU A 458 22.675 -38.297 -68.391 1.00 95.90 C
ATOM 2020 O LEU A 458 22.910 -37.242 -67.809 1.00 95.90 O
ATOM 2021 CB LEU A 458 20.533 -37.775 -69.537 1.00 95.90 C
ATOM 2022 CG LEU A 458 19.822 -37.304 -70.803 1.00 95.90 C
ATOM 2023 CD1 LEU A 458 18.424 -36.807 -70.475 1.00 95.90 C
ATOM 2024 CD2 LEU A 458 20.633 -36.214 -71.483 1.00 95.90 C
ATOM 2025 N GLN A 459 23.038 -39.472 -67.912 1.00 90.48 N
ATOM 2026 CA GLN A 459 23.683 -39.621 -66.599 1.00 90.48 C
ATOM 2027 C GLN A 459 24.908 -38.745 -66.334 1.00 90.48 C
ATOM 2028 O GLN A 459 24.965 -38.024 -65.326 1.00 90.48 O
ATOM 2029 CB GLN A 459 24.077 -41.086 -66.401 1.00 30.00 C
ATOM 2030 CG GLN A 459 22.899 -42.043 -66.333 1.00 30.00 C
ATOM 2031 CD GLN A 459 23.328 -43.490 -66.210 1.00 30.00 C
ATOM 2032 OE1 GLN A 459 24.431 -43.854 -66.618 1.00 30.00 O
ATOM 2033 NE2 GLN A 459 22.458 -44.321 -65.644 1.00 30.00 N
ATOM 2034 N ASP A 460 25.888 -38.806 -67.235 1.00 81.09 N
ATOM 2035 CA ASP A 460 27.143 -38.095 -67.024 1.00 81.09 C
ATOM 2036 C ASP A 460 26.957 -36.589 -67.135 1.00 81.09 C
ATOM 2037 O ASP A 460 27.628 -35.826 -66.436 1.00 81.09 O
ATOM 2038 CB ASP A 460 28.194 -38.581 -68.019 1.00 81.09 C
ATOM 2039 N VAL A 461 26.046 -36.150 -68.002 1.00 78.89 N
ATOM 2040 CA VAL A 461 25.727 -34.732 -68.089 1.00 78.89 C
ATOM 2041 C VAL A 461 24.956 -34.291 -66.852 1.00 78.89 C
ATOM 2042 O VAL A 461 25.118 -33.167 -66.364 1.00 78.89 O
ATOM 2043 CB VAL A 461 24.939 -34.466 -69.380 1.00 78.89 C
ATOM 2044 CG1 VAL A 461 24.645 -32.998 -69.540 1.00 78.89 C
ATOM 2045 CG2 VAL A 461 25.706 -34.997 -70.567 1.00 78.89 C
ATOM 2046 N MET A 462 24.122 -35.183 -66.318 1.00 79.10 N
ATOM 2047 CA MET A 462 23.320 -34.874 -65.141 1.00 79.10 C
ATOM 2048 C MET A 462 24.194 -34.663 -63.919 1.00 79.10 C
ATOM 2049 O MET A 462 23.914 -33.789 -63.086 1.00 79.10 O
ATOM 2050 CB MET A 462 22.339 -36.011 -64.891 1.00 79.10 C
ATOM 2051 CG MET A 462 21.318 -35.760 -63.820 1.00 79.10 C
ATOM 2052 SD MET A 462 20.134 -34.515 -64.328 1.00 79.10 S
ATOM 2053 CE MET A 462 19.422 -34.107 -62.748 1.00 79.10 C
ATOM 2054 N PHE A 463 25.259 -35.459 -63.801 1.00 68.01 N
ATOM 2055 CA PHE A 463 26.136 -35.360 -62.636 1.00 68.01 C
ATOM 2056 C PHE A 463 26.843 -34.012 -62.569 1.00 68.01 C
ATOM 2057 O PHE A 463 26.896 -33.382 -61.505 1.00 68.01 O
ATOM 2058 CB PHE A 463 27.161 -36.487 -62.647 1.00 68.01 C
ATOM 2059 CG PHE A 463 28.110 -36.431 -61.499 1.00 68.01 C
ATOM 2060 CD1 PHE A 463 27.694 -36.779 -60.233 1.00 68.01 C
ATOM 2061 CD2 PHE A 463 29.417 -36.026 -61.685 1.00 68.01 C
ATOM 2062 CE1 PHE A 463 28.566 -36.724 -59.169 1.00 68.01 C
ATOM 2063 CE2 PHE A 463 30.292 -35.967 -60.626 1.00 68.01 C
ATOM 2064 CZ PHE A 463 29.867 -36.318 -59.368 1.00 68.01 C
ATOM 2065 N THR A 464 27.373 -33.544 -63.697 1.00 68.50 N
ATOM 2066 CA THR A 464 28.085 -32.272 -63.696 1.00 68.50 C
ATOM 2067 C THR A 464 27.130 -31.105 -63.502 1.00 68.50 C
ATOM 2068 O THR A 464 27.519 -30.060 -62.972 1.00 68.50 O
ATOM 2069 CB THR A 464 28.873 -32.112 -64.989 1.00 68.50 C
ATOM 2070 OG1 THR A 464 27.975 -32.179 -66.098 1.00 68.50 O
ATOM 2071 CG2 THR A 464 29.904 -33.213 -65.119 1.00 68.50 C
ATOM 2072 N ALA A 465 25.872 -31.266 -63.910 1.00 64.74 N
ATOM 2073 CA ALA A 465 24.886 -30.226 -63.643 1.00 64.74 C
ATOM 2074 C ALA A 465 24.490 -30.221 -62.176 1.00 64.74 C
ATOM 2075 O ALA A 465 24.065 -29.195 -61.637 1.00 64.74 O
ATOM 2076 CB ALA A 465 23.662 -30.417 -64.531 1.00 64.74 C
ATOM 2077 N LEU A 466 24.595 -31.377 -61.521 1.00 61.78 N
ATOM 2078 CA LEU A 466 24.466 -31.403 -60.068 1.00 61.78 C
ATOM 2079 C LEU A 466 25.669 -30.773 -59.385 1.00 61.78 C
ATOM 2080 O LEU A 466 25.560 -30.307 -58.246 1.00 61.78 O
ATOM 2081 CB LEU A 466 24.277 -32.830 -59.562 1.00 61.78 C
ATOM 2082 CG LEU A 466 22.876 -33.271 -59.173 1.00 61.78 C
ATOM 2083 CD1 LEU A 466 22.493 -32.529 -57.924 1.00 61.78 C
ATOM 2084 CD2 LEU A 466 21.903 -32.964 -60.265 1.00 61.78 C
ATOM 2085 N VAL A 467 26.833 -30.788 -60.043 1.00 66.75 N
ATOM 2086 CA VAL A 467 28.050 -30.297 -59.396 1.00 66.75 C
ATOM 2087 C VAL A 467 27.994 -28.792 -59.179 1.00 66.75 C
ATOM 2088 O VAL A 467 28.142 -28.315 -58.049 1.00 66.75 O
ATOM 2089 CB VAL A 467 29.298 -30.700 -60.199 1.00 66.75 C
ATOM 2090 CG1 VAL A 467 30.508 -29.949 -59.697 1.00 66.75 C
ATOM 2091 CG2 VAL A 467 29.552 -32.178 -60.046 1.00 66.75 C
ATOM 2092 N LYS A 468 27.759 -28.018 -60.232 1.00 68.74 N
ATOM 2093 CA LYS A 468 27.895 -26.570 -60.138 1.00 68.74 C
ATOM 2094 C LYS A 468 26.588 -25.852 -60.518 1.00 68.74 C
ATOM 2095 O LYS A 468 26.485 -25.248 -61.586 1.00 68.74 O
ATOM 2096 CB LYS A 468 29.085 -26.126 -60.994 1.00 68.74 C
ATOM 2097 CG LYS A 468 29.122 -26.764 -62.384 1.00 68.74 C
ATOM 2098 CD LYS A 468 30.286 -26.269 -63.200 1.00 68.74 C
ATOM 2099 CE LYS A 468 30.283 -26.898 -64.580 1.00 68.74 C
ATOM 2100 NZ LYS A 468 31.420 -26.411 -65.409 1.00 68.74 N
ATOM 2101 N ASP A 469 25.638 -25.876 -59.568 1.00 66.85 N
ATOM 2102 CA ASP A 469 24.501 -24.946 -59.403 1.00 66.85 C
ATOM 2103 C ASP A 469 23.783 -24.556 -60.698 1.00 66.85 C
ATOM 2104 O ASP A 469 23.736 -23.387 -61.075 1.00 66.85 O
ATOM 2105 CB ASP A 469 24.956 -23.694 -58.655 1.00 66.85 C
ATOM 2106 N ARG A 470 23.217 -25.535 -61.393 1.00 66.29 N
ATOM 2107 CA ARG A 470 22.464 -25.274 -62.620 1.00 66.29 C
ATOM 2108 C ARG A 470 21.035 -25.774 -62.460 1.00 66.29 C
ATOM 2109 O ARG A 470 20.650 -26.787 -63.054 1.00 66.29 O
ATOM 2110 CB ARG A 470 23.147 -25.920 -63.824 1.00 66.29 C
ATOM 2111 CG ARG A 470 24.481 -25.299 -64.155 1.00 66.29 C
ATOM 2112 CD ARG A 470 24.308 -23.896 -64.697 1.00 66.29 C
ATOM 2113 NE ARG A 470 25.577 -23.312 -65.114 1.00 66.29 N
ATOM 2114 CZ ARG A 470 26.345 -22.568 -64.330 1.00 66.29 C
ATOM 2115 NH1 ARG A 470 25.972 -22.311 -63.086 1.00 66.29 N
ATOM 2116 NH2 ARG A 470 27.484 -22.075 -64.789 1.00 66.29 N
ATOM 2117 N PRO A 471 20.208 -25.057 -61.694 1.00 59.39 N
ATOM 2118 CA PRO A 471 18.922 -25.635 -61.266 1.00 59.39 C
ATOM 2119 C PRO A 471 17.875 -25.731 -62.365 1.00 59.39 C
ATOM 2120 O PRO A 471 17.151 -26.736 -62.436 1.00 59.39 O
ATOM 2121 CB PRO A 471 18.488 -24.687 -60.145 1.00 59.39 C
ATOM 2122 CG PRO A 471 19.116 -23.393 -60.500 1.00 59.39 C
ATOM 2123 CD PRO A 471 20.417 -23.706 -61.149 1.00 59.39 C
ATOM 2124 N LYS A 472 17.766 -24.708 -63.218 1.00 64.17 N
ATOM 2125 CA LYS A 472 16.896 -24.790 -64.386 1.00 64.17 C
ATOM 2126 C LYS A 472 17.342 -25.911 -65.302 1.00 64.17 C
ATOM 2127 O LYS A 472 16.523 -26.632 -65.893 1.00 64.17 O
ATOM 2128 CB LYS A 472 16.923 -23.467 -65.138 1.00 64.17 C
ATOM 2129 CG LYS A 472 16.337 -22.313 -64.378 1.00 64.17 C
ATOM 2130 CD LYS A 472 16.424 -21.051 -65.203 1.00 64.17 C
ATOM 2131 CE LYS A 472 15.915 -19.859 -64.426 1.00 64.17 C
ATOM 2132 NZ LYS A 472 16.031 -18.596 -65.197 1.00 64.17 N
ATOM 2133 N PHE A 473 18.646 -26.117 -65.368 1.00 70.36 N
ATOM 2134 CA PHE A 473 19.187 -27.176 -66.181 1.00 70.36 C
ATOM 2135 C PHE A 473 19.105 -28.518 -65.469 1.00 70.36 C
ATOM 2136 O PHE A 473 19.547 -29.518 -66.022 1.00 70.36 O
ATOM 2137 CB PHE A 473 20.624 -26.829 -66.544 1.00 70.36 C
ATOM 2138 CG PHE A 473 21.052 -27.348 -67.873 1.00 70.36 C
ATOM 2139 CD1 PHE A 473 20.704 -26.663 -69.024 1.00 70.36 C
ATOM 2140 CD2 PHE A 473 21.796 -28.506 -67.984 1.00 70.36 C
ATOM 2141 CE1 PHE A 473 21.091 -27.122 -70.252 1.00 70.36 C
ATOM 2142 CE2 PHE A 473 22.191 -28.968 -69.218 1.00 70.36 C
ATOM 2143 CZ PHE A 473 21.835 -28.278 -70.351 1.00 70.36 C
ATOM 2144 N VAL A 474 18.570 -28.556 -64.246 1.00 62.84 N
ATOM 2145 CA VAL A 474 18.126 -29.812 -63.656 1.00 62.84 C
ATOM 2146 C VAL A 474 16.647 -30.048 -63.937 1.00 62.84 C
ATOM 2147 O VAL A 474 16.255 -31.191 -64.211 1.00 62.84 O
ATOM 2148 CB VAL A 474 18.435 -29.820 -62.149 1.00 62.84 C
ATOM 2149 CG1 VAL A 474 17.844 -31.021 -61.451 1.00 62.84 C
ATOM 2150 CG2 VAL A 474 19.917 -29.826 -61.936 1.00 62.84 C
ATOM 2151 N ARG A 475 15.825 -28.983 -63.907 1.00 66.40 N
ATOM 2152 CA ARG A 475 14.409 -29.084 -64.285 1.00 66.40 C
ATOM 2153 C ARG A 475 14.235 -29.607 -65.701 1.00 66.40 C
ATOM 2154 O ARG A 475 13.280 -30.346 -65.980 1.00 66.40 O
ATOM 2155 CB ARG A 475 13.723 -27.724 -64.180 1.00 66.40 C
ATOM 2156 CG ARG A 475 13.542 -27.231 -62.785 1.00 66.40 C
ATOM 2157 CD ARG A 475 12.405 -27.935 -62.086 1.00 66.40 C
ATOM 2158 NE ARG A 475 11.116 -27.484 -62.586 1.00 66.40 N
ATOM 2159 CZ ARG A 475 10.450 -26.458 -62.069 1.00 66.40 C
ATOM 2160 NH1 ARG A 475 10.955 -25.800 -61.037 1.00 66.40 N
ATOM 2161 NH2 ARG A 475 9.279 -26.097 -62.573 1.00 66.40 N
ATOM 2162 N LEU A 476 15.151 -29.227 -66.599 1.00 79.48 N
ATOM 2163 CA LEU A 476 15.060 -29.661 -67.990 1.00 79.48 C
ATOM 2164 C LEU A 476 15.162 -31.177 -68.127 1.00 79.48 C
ATOM 2165 O LEU A 476 14.386 -31.788 -68.870 1.00 79.48 O
ATOM 2166 CB LEU A 476 16.142 -28.993 -68.827 1.00 79.48 C
ATOM 2167 CG LEU A 476 16.027 -29.323 -70.309 1.00 79.48 C
ATOM 2168 CD1 LEU A 476 14.718 -28.779 -70.827 1.00 79.48 C
ATOM 2169 CD2 LEU A 476 17.188 -28.764 -71.090 1.00 79.48 C
ATOM 2170 N PHE A 477 16.074 -31.812 -67.389 1.00 82.08 N
ATOM 2171 CA PHE A 477 16.213 -33.256 -67.546 1.00 82.08 C
ATOM 2172 C PHE A 477 15.082 -34.022 -66.878 1.00 82.08 C
ATOM 2173 O PHE A 477 14.710 -35.100 -67.353 1.00 82.08 O
ATOM 2174 CB PHE A 477 17.546 -33.744 -67.005 1.00 82.08 C
ATOM 2175 CG PHE A 477 18.718 -33.264 -67.782 1.00 82.08 C
ATOM 2176 CD1 PHE A 477 18.998 -33.783 -69.032 1.00 82.08 C
ATOM 2177 CD2 PHE A 477 19.566 -32.329 -67.249 1.00 82.08 C
ATOM 2178 CE1 PHE A 477 20.092 -33.340 -69.748 1.00 82.08 C
ATOM 2179 CE2 PHE A 477 20.658 -31.880 -67.954 1.00 82.08 C
ATOM 2180 CZ PHE A 477 20.925 -32.385 -69.201 1.00 82.08 C
ATOM 2181 N LEU A 478 14.523 -33.498 -65.788 1.00 77.73 N
ATOM 2182 CA LEU A 478 13.378 -34.170 -65.183 1.00 77.73 C
ATOM 2183 C LEU A 478 12.142 -34.055 -66.061 1.00 77.73 C
ATOM 2184 O LEU A 478 11.334 -34.987 -66.120 1.00 77.73 O
ATOM 2185 CB LEU A 478 13.101 -33.619 -63.792 1.00 77.73 C
ATOM 2186 CG LEU A 478 14.152 -34.016 -62.765 1.00 77.73 C
ATOM 2187 CD1 LEU A 478 13.838 -33.397 -61.422 1.00 77.73 C
ATOM 2188 CD2 LEU A 478 14.225 -35.522 -62.658 1.00 77.73 C
ATOM 2189 N GLU A 479 11.981 -32.933 -66.767 1.00 88.95 N
ATOM 2190 CA GLU A 479 10.864 -32.843 -67.701 1.00 88.95 C
ATOM 2191 C GLU A 479 11.121 -33.656 -68.964 1.00 88.95 C
ATOM 2192 O GLU A 479 10.176 -34.090 -69.630 1.00 88.95 O
ATOM 2193 CB GLU A 479 10.564 -31.388 -68.043 1.00 88.95 C
ATOM 2194 CG GLU A 479 9.960 -30.634 -66.883 1.00 88.95 C
ATOM 2195 CD GLU A 479 9.577 -29.225 -67.244 1.00 88.95 C
ATOM 2196 OE1 GLU A 479 9.893 -28.802 -68.372 1.00 88.95 O
ATOM 2197 OE2 GLU A 479 8.951 -28.544 -66.405 1.00 88.95 O
ATOM 2198 N ASN A 480 12.390 -33.887 -69.277 1.00 91.42 N
ATOM 2199 CA ASN A 480 12.739 -34.669 -70.452 1.00 91.42 C
ATOM 2200 C ASN A 480 12.797 -36.156 -70.138 1.00 91.42 C
ATOM 2201 O ASN A 480 13.056 -36.978 -71.014 1.00 91.42 O
ATOM 2202 CB ASN A 480 14.047 -34.179 -71.065 1.00 91.42 C
ATOM 2203 CG ASN A 480 13.868 -32.896 -71.849 1.00 91.42 C
ATOM 2204 OD1 ASN A 480 12.861 -32.714 -72.532 1.00 91.42 O
ATOM 2205 ND2 ASN A 480 14.840 -31.998 -71.751 1.00 91.42 N
ATOM 2206 N GLY A 481 12.560 -36.491 -68.875 1.00 86.81 N
ATOM 2207 CA GLY A 481 12.541 -37.876 -68.447 1.00 86.81 C
ATOM 2208 C GLY A 481 13.828 -38.478 -67.920 1.00 86.81 C
ATOM 2209 O GLY A 481 14.791 -38.665 -68.659 1.00 86.81 O
ATOM 2210 N LEU A 482 13.829 -38.787 -66.628 1.00 83.42 N
ATOM 2211 CA LEU A 482 14.961 -39.413 -65.970 1.00 83.42 C
ATOM 2212 C LEU A 482 14.488 -40.027 -64.664 1.00 83.42 C
ATOM 2213 O LEU A 482 13.746 -39.396 -63.907 1.00 83.42 O
ATOM 2214 CB LEU A 482 16.079 -38.400 -65.721 1.00 83.42 C
ATOM 2215 CG LEU A 482 17.325 -38.880 -64.992 1.00 83.42 C
ATOM 2216 CD1 LEU A 482 17.955 -40.038 -65.722 1.00 83.42 C
ATOM 2217 CD2 LEU A 482 18.294 -37.729 -64.901 1.00 83.42 C
ATOM 2218 N ASN A 483 14.917 -41.255 -64.406 1.00 78.64 N
ATOM 2219 CA ASN A 483 14.509 -41.989 -63.216 1.00 78.64 C
ATOM 2220 C ASN A 483 15.470 -41.649 -62.088 1.00 78.64 C
ATOM 2221 O ASN A 483 16.560 -42.222 -62.004 1.00 78.64 O
ATOM 2222 CB ASN A 483 14.493 -43.489 -63.490 1.00 78.64 C
ATOM 2223 CG ASN A 483 13.414 -43.887 -64.471 1.00 78.64 C
ATOM 2224 OD1 ASN A 483 12.288 -43.394 -64.405 1.00 78.64 O
ATOM 2225 ND2 ASN A 483 13.753 -44.779 -65.394 1.00 78.64 N
ATOM 2226 N LEU A 484 15.055 -40.724 -61.223 1.00 68.25 N
ATOM 2227 CA LEU A 484 15.992 -40.105 -60.294 1.00 68.25 C
ATOM 2228 C LEU A 484 16.376 -41.057 -59.171 1.00 68.25 C
ATOM 2229 O LEU A 484 17.505 -41.012 -58.672 1.00 68.25 O
ATOM 2230 CB LEU A 484 15.392 -38.816 -59.742 1.00 68.25 C
ATOM 2231 CG LEU A 484 16.320 -37.945 -58.901 1.00 68.25 C
ATOM 2232 CD1 LEU A 484 17.514 -37.555 -59.724 1.00 68.25 C
ATOM 2233 CD2 LEU A 484 15.596 -36.710 -58.459 1.00 68.25 C
ATOM 2234 N ARG A 485 15.463 -41.940 -58.772 1.00 72.37 N
ATOM 2235 CA ARG A 485 15.808 -42.946 -57.775 1.00 72.37 C
ATOM 2236 C ARG A 485 16.721 -44.008 -58.377 1.00 72.37 C
ATOM 2237 O ARG A 485 17.556 -44.595 -57.681 1.00 72.37 O
ATOM 2238 CB ARG A 485 14.537 -43.570 -57.204 1.00 72.37 C
ATOM 2239 CG ARG A 485 14.763 -44.482 -56.021 1.00 72.37 C
ATOM 2240 CD ARG A 485 13.454 -45.013 -55.484 1.00 72.37 C
ATOM 2241 NE ARG A 485 13.671 -45.971 -54.407 1.00 72.37 N
ATOM 2242 CZ ARG A 485 13.790 -45.638 -53.128 1.00 72.37 C
ATOM 2243 NH1 ARG A 485 13.702 -44.368 -52.765 1.00 72.37 N
ATOM 2244 NH2 ARG A 485 13.988 -46.574 -52.210 1.00 72.37 N
ATOM 2245 N LYS A 486 16.587 -44.252 -59.681 1.00 73.93 N
ATOM 2246 CA LYS A 486 17.466 -45.204 -60.352 1.00 73.93 C
ATOM 2247 C LYS A 486 18.850 -44.604 -60.569 1.00 73.93 C
ATOM 2248 O LYS A 486 19.842 -45.329 -60.705 1.00 73.93 O
ATOM 2249 CB LYS A 486 16.830 -45.628 -61.676 1.00 73.93 C
ATOM 2250 CG LYS A 486 17.505 -46.770 -62.411 1.00 73.93 C
ATOM 2251 CD LYS A 486 16.723 -47.139 -63.658 1.00 73.93 C
ATOM 2252 CE LYS A 486 17.393 -48.265 -64.417 1.00 73.93 C
ATOM 2253 NZ LYS A 486 16.632 -48.616 -65.644 1.00 73.93 N
ATOM 2254 N PHE A 487 18.937 -43.275 -60.577 1.00 71.78 N
ATOM 2255 CA PHE A 487 20.210 -42.607 -60.816 1.00 71.78 C
ATOM 2256 C PHE A 487 21.133 -42.703 -59.609 1.00 71.78 C
ATOM 2257 O PHE A 487 22.296 -43.098 -59.741 1.00 71.78 O
ATOM 2258 CB PHE A 487 19.950 -41.148 -61.176 1.00 71.78 C
ATOM 2259 CG PHE A 487 21.188 -40.348 -61.405 1.00 71.78 C
ATOM 2260 CD1 PHE A 487 21.914 -40.498 -62.568 1.00 71.78 C
ATOM 2261 CD2 PHE A 487 21.609 -39.425 -60.466 1.00 71.78 C
ATOM 2262 CE1 PHE A 487 23.046 -39.754 -62.783 1.00 71.78 C
ATOM 2263 CE2 PHE A 487 22.738 -38.680 -60.673 1.00 71.78 C
ATOM 2264 CZ PHE A 487 23.458 -38.842 -61.832 1.00 71.78 C
ATOM 2265 N LEU A 488 20.636 -42.340 -58.431 1.00 62.95 N
ATOM 2266 CA LEU A 488 21.489 -42.187 -57.260 1.00 62.95 C
ATOM 2267 C LEU A 488 21.948 -43.537 -56.724 1.00 62.95 C
ATOM 2268 O LEU A 488 21.148 -44.319 -56.208 1.00 62.95 O
ATOM 2269 CB LEU A 488 20.743 -41.428 -56.170 1.00 62.95 C
ATOM 2270 CG LEU A 488 20.328 -40.010 -56.534 1.00 62.95 C
ATOM 2271 CD1 LEU A 488 19.528 -39.408 -55.408 1.00 62.95 C
ATOM 2272 CD2 LEU A 488 21.535 -39.172 -56.838 1.00 62.95 C
ATOM 2273 N THR A 489 23.243 -43.801 -56.837 1.00 66.09 N
ATOM 2274 CA THR A 489 23.859 -44.987 -56.267 1.00 66.09 C
ATOM 2275 C THR A 489 24.858 -44.530 -55.221 1.00 66.09 C
ATOM 2276 O THR A 489 25.293 -43.376 -55.247 1.00 66.09 O
ATOM 2277 CB THR A 489 24.570 -45.816 -57.328 1.00 66.09 C
ATOM 2278 OG1 THR A 489 25.668 -45.061 -57.850 1.00 66.09 O
ATOM 2279 CG2 THR A 489 23.621 -46.141 -58.459 1.00 66.09 C
ATOM 2280 N THR A 490 25.232 -45.436 -54.316 1.00 66.36 N
ATOM 2281 CA THR A 490 26.129 -45.111 -53.210 1.00 66.36 C
ATOM 2282 C THR A 490 27.529 -44.713 -53.663 1.00 66.36 C
ATOM 2283 O THR A 490 28.258 -44.054 -52.916 1.00 66.36 O
ATOM 2284 CB THR A 490 26.221 -46.287 -52.247 1.00 66.36 C
ATOM 2285 OG1 THR A 490 26.726 -47.428 -52.945 1.00 66.36 O
ATOM 2286 CG2 THR A 490 24.857 -46.601 -51.690 1.00 66.36 C
ATOM 2287 N GLU A 491 27.922 -45.119 -54.872 1.00 67.43 N
ATOM 2288 CA GLU A 491 29.153 -44.602 -55.460 1.00 67.43 C
ATOM 2289 C GLU A 491 29.032 -43.113 -55.756 1.00 67.43 C
ATOM 2290 O GLU A 491 29.952 -42.336 -55.471 1.00 67.43 O
ATOM 2291 CB GLU A 491 29.490 -45.373 -56.735 1.00 67.43 C
ATOM 2292 N VAL A 492 27.888 -42.700 -56.307 1.00 61.52 N
ATOM 2293 CA VAL A 492 27.684 -41.307 -56.689 1.00 61.52 C
ATOM 2294 C VAL A 492 27.603 -40.418 -55.458 1.00 61.52 C
ATOM 2295 O VAL A 492 28.136 -39.304 -55.445 1.00 61.52 O
ATOM 2296 CB VAL A 492 26.427 -41.190 -57.566 1.00 61.52 C
ATOM 2297 CG1 VAL A 492 26.134 -39.750 -57.931 1.00 61.52 C
ATOM 2298 CG2 VAL A 492 26.609 -42.013 -58.810 1.00 61.52 C
ATOM 2299 N LEU A 493 26.992 -40.912 -54.382 1.00 61.18 N
ATOM 2300 CA LEU A 493 26.877 -40.088 -53.186 1.00 61.18 C
ATOM 2301 C LEU A 493 28.205 -39.976 -52.450 1.00 61.18 C
ATOM 2302 O LEU A 493 28.485 -38.947 -51.825 1.00 61.18 O
ATOM 2303 CB LEU A 493 25.800 -40.640 -52.268 1.00 61.18 C
ATOM 2304 CG LEU A 493 24.404 -40.515 -52.850 1.00 61.18 C
ATOM 2305 CD1 LEU A 493 23.425 -41.152 -51.907 1.00 61.18 C
ATOM 2306 CD2 LEU A 493 24.068 -39.063 -53.082 1.00 61.18 C
ATOM 2307 N ARG A 494 29.044 -41.010 -52.521 1.00 67.49 N
ATOM 2308 CA ARG A 494 30.399 -40.867 -52.002 1.00 67.49 C
ATOM 2309 C ARG A 494 31.204 -39.878 -52.834 1.00 67.49 C
ATOM 2310 O ARG A 494 31.910 -39.024 -52.281 1.00 67.49 O
ATOM 2311 CB ARG A 494 31.095 -42.224 -51.947 1.00 67.49 C
ATOM 2312 CG ARG A 494 30.616 -43.094 -50.808 1.00 67.49 C
ATOM 2313 CD ARG A 494 31.307 -44.436 -50.810 1.00 67.49 C
ATOM 2314 NE ARG A 494 30.871 -45.248 -49.681 1.00 67.49 N
ATOM 2315 CZ ARG A 494 31.225 -46.512 -49.487 1.00 67.49 C
ATOM 2316 NH1 ARG A 494 32.016 -47.121 -50.357 1.00 67.49 N
ATOM 2317 NH2 ARG A 494 30.778 -47.170 -48.428 1.00 67.49 N
ATOM 2318 N GLU A 495 31.060 -39.938 -54.162 1.00 58.70 N
ATOM 2319 CA GLU A 495 31.752 -38.989 -55.027 1.00 58.70 C
ATOM 2320 C GLU A 495 31.219 -37.575 -54.846 1.00 58.70 C
ATOM 2321 O GLU A 495 31.901 -36.599 -55.173 1.00 58.70 O
ATOM 2322 CB GLU A 495 31.625 -39.421 -56.486 1.00 58.70 C
ATOM 2323 N LEU A 496 29.997 -37.444 -54.334 1.00 55.20 N
ATOM 2324 CA LEU A 496 29.426 -36.122 -54.132 1.00 55.20 C
ATOM 2325 C LEU A 496 29.820 -35.545 -52.778 1.00 55.20 C
ATOM 2326 O LEU A 496 30.205 -34.374 -52.686 1.00 55.20 O
ATOM 2327 CB LEU A 496 27.910 -36.186 -54.262 1.00 55.20 C
ATOM 2328 CG LEU A 496 27.244 -34.818 -54.257 1.00 55.20 C
ATOM 2329 CD1 LEU A 496 27.684 -34.051 -55.471 1.00 55.20 C
ATOM 2330 CD2 LEU A 496 25.758 -34.963 -54.251 1.00 55.20 C
ATOM 2331 N TYR A 497 29.735 -36.348 -51.714 1.00 59.15 N
ATOM 2332 CA TYR A 497 30.041 -35.839 -50.379 1.00 59.15 C
ATOM 2333 C TYR A 497 31.538 -35.671 -50.147 1.00 59.15 C
ATOM 2334 O TYR A 497 31.950 -34.751 -49.434 1.00 59.15 O
ATOM 2335 CB TYR A 497 29.451 -36.753 -49.308 1.00 59.15 C
ATOM 2336 CG TYR A 497 28.029 -36.445 -48.926 1.00 59.15 C
ATOM 2337 CD1 TYR A 497 27.757 -35.484 -47.971 1.00 59.15 C
ATOM 2338 CD2 TYR A 497 26.966 -37.108 -49.505 1.00 59.15 C
ATOM 2339 CE1 TYR A 497 26.469 -35.194 -47.602 1.00 59.15 C
ATOM 2340 CE2 TYR A 497 25.668 -36.819 -49.137 1.00 59.15 C
ATOM 2341 CZ TYR A 497 25.433 -35.857 -48.188 1.00 59.15 C
ATOM 2342 OH TYR A 497 24.150 -35.557 -47.815 1.00 59.15 O
ATOM 2343 N THR A 498 32.373 -36.554 -50.698 1.00 60.49 N
ATOM 2344 CA THR A 498 33.797 -36.440 -50.395 1.00 60.49 C
ATOM 2345 C THR A 498 34.456 -35.328 -51.196 1.00 60.49 C
ATOM 2346 O THR A 498 35.376 -34.666 -50.706 1.00 60.49 O
ATOM 2347 CB THR A 498 34.506 -37.761 -50.650 1.00 60.49 C
ATOM 2348 OG1 THR A 498 34.304 -38.152 -52.013 1.00 60.49 O
ATOM 2349 CG2 THR A 498 33.977 -38.830 -49.721 1.00 60.49 C
ATOM 2350 N ASN A 499 34.002 -35.099 -52.423 1.00 60.84 N
ATOM 2351 CA ASN A 499 34.614 -34.098 -53.282 1.00 60.84 C
ATOM 2352 C ASN A 499 33.929 -32.743 -53.220 1.00 60.84 C
ATOM 2353 O ASN A 499 34.570 -31.746 -52.884 1.00 60.84 O
ATOM 2354 CB ASN A 499 34.635 -34.593 -54.728 1.00 60.84 C
ATOM 2355 CG ASN A 499 35.610 -35.718 -54.931 1.00 60.84 C
ATOM 2356 OD1 ASN A 499 36.700 -35.711 -54.366 1.00 60.84 O
ATOM 2357 ND2 ASN A 499 35.233 -36.690 -55.746 1.00 60.84 N
ATOM 2358 N ASN A 500 32.635 -32.678 -53.529 1.00 57.11 N
ATOM 2359 CA ASN A 500 31.970 -31.413 -53.807 1.00 57.11 C
ATOM 2360 C ASN A 500 31.304 -30.801 -52.586 1.00 57.11 C
ATOM 2361 O ASN A 500 30.342 -30.040 -52.729 1.00 57.11 O
ATOM 2362 CB ASN A 500 30.951 -31.603 -54.924 1.00 57.11 C
ATOM 2363 CG ASN A 500 31.599 -31.932 -56.232 1.00 57.11 C
ATOM 2364 OD1 ASN A 500 32.631 -31.369 -56.576 1.00 57.11 O
ATOM 2365 ND2 ASN A 500 31.008 -32.853 -56.973 1.00 57.11 N
ATOM 2366 N PHE A 501 31.785 -31.099 -51.391 1.00 49.60 N
ATOM 2367 CA PHE A 501 31.228 -30.542 -50.169 1.00 49.60 C
ATOM 2368 C PHE A 501 32.300 -29.663 -49.545 1.00 49.60 C
ATOM 2369 O PHE A 501 33.358 -30.162 -49.149 1.00 49.60 O
ATOM 2370 CB PHE A 501 30.796 -31.670 -49.237 1.00 49.60 C
ATOM 2371 CG PHE A 501 29.998 -31.228 -48.056 1.00 49.60 C
ATOM 2372 CD1 PHE A 501 28.688 -30.833 -48.208 1.00 49.60 C
ATOM 2373 CD2 PHE A 501 30.536 -31.264 -46.787 1.00 49.60 C
ATOM 2374 CE1 PHE A 501 27.943 -30.443 -47.121 1.00 49.60 C
ATOM 2375 CE2 PHE A 501 29.793 -30.880 -45.696 1.00 49.60 C
ATOM 2376 CZ PHE A 501 28.495 -30.469 -45.866 1.00 49.60 C
ATOM 2377 N SER A 502 32.035 -28.358 -49.481 1.00 54.36 N
ATOM 2378 CA SER A 502 33.056 -27.389 -49.099 1.00 54.36 C
ATOM 2379 C SER A 502 33.395 -27.501 -47.621 1.00 54.36 C
ATOM 2380 O SER A 502 32.508 -27.562 -46.768 1.00 54.36 O
ATOM 2381 CB SER A 502 32.579 -25.977 -49.406 1.00 54.36 C
ATOM 2382 OG SER A 502 31.494 -25.642 -48.570 1.00 54.36 O
ATOM 2383 N SER A 503 34.697 -27.484 -47.324 1.00 55.77 N
ATOM 2384 CA SER A 503 35.172 -27.852 -45.993 1.00 55.77 C
ATOM 2385 C SER A 503 34.846 -26.788 -44.956 1.00 55.77 C
ATOM 2386 O SER A 503 34.882 -27.060 -43.750 1.00 55.77 O
ATOM 2387 CB SER A 503 36.673 -28.111 -46.028 1.00 55.77 C
ATOM 2388 OG SER A 503 36.962 -29.226 -46.846 1.00 55.77 O
ATOM 2389 N LEU A 504 34.540 -25.569 -45.403 1.00 54.28 N
ATOM 2390 CA LEU A 504 34.075 -24.536 -44.483 1.00 54.28 C
ATOM 2391 C LEU A 504 32.737 -24.911 -43.859 1.00 54.28 C
ATOM 2392 O LEU A 504 32.550 -24.781 -42.642 1.00 54.28 O
ATOM 2393 CB LEU A 504 33.967 -23.206 -45.218 1.00 54.28 C
ATOM 2394 CG LEU A 504 33.481 -22.054 -44.352 1.00 54.28 C
ATOM 2395 CD1 LEU A 504 34.452 -21.821 -43.215 1.00 54.28 C
ATOM 2396 CD2 LEU A 504 33.332 -20.814 -45.198 1.00 54.28 C
ATOM 2397 N VAL A 505 31.806 -25.407 -44.679 1.00 52.09 N
ATOM 2398 CA VAL A 505 30.503 -25.830 -44.180 1.00 52.09 C
ATOM 2399 C VAL A 505 30.654 -27.047 -43.279 1.00 52.09 C
ATOM 2400 O VAL A 505 29.951 -27.185 -42.272 1.00 52.09 O
ATOM 2401 CB VAL A 505 29.555 -26.090 -45.366 1.00 52.09 C
ATOM 2402 CG1 VAL A 505 28.206 -26.571 -44.899 1.00 52.09 C
ATOM 2403 CG2 VAL A 505 29.387 -24.831 -46.176 1.00 52.09 C
ATOM 2404 N PHE A 506 31.623 -27.912 -43.588 1.00 54.21 N
ATOM 2405 CA PHE A 506 31.869 -29.076 -42.746 1.00 54.21 C
ATOM 2406 C PHE A 506 32.434 -28.682 -41.392 1.00 54.21 C
ATOM 2407 O PHE A 506 32.040 -29.247 -40.368 1.00 54.21 O
ATOM 2408 CB PHE A 506 32.811 -30.050 -43.441 1.00 54.21 C
ATOM 2409 CG PHE A 506 33.176 -31.226 -42.596 1.00 54.21 C
ATOM 2410 CD1 PHE A 506 32.242 -32.203 -42.319 1.00 54.21 C
ATOM 2411 CD2 PHE A 506 34.450 -31.356 -42.081 1.00 54.21 C
ATOM 2412 CE1 PHE A 506 32.568 -33.288 -41.536 1.00 54.21 C
ATOM 2413 CE2 PHE A 506 34.784 -32.440 -41.300 1.00 54.21 C
ATOM 2414 CZ PHE A 506 33.840 -33.408 -41.029 1.00 54.21 C
ATOM 2415 N LYS A 507 33.350 -27.712 -41.362 1.00 57.06 N
ATOM 2416 CA LYS A 507 33.864 -27.230 -40.083 1.00 57.06 C
ATOM 2417 C LYS A 507 32.773 -26.528 -39.287 1.00 57.06 C
ATOM 2418 O LYS A 507 32.710 -26.644 -38.055 1.00 57.06 O
ATOM 2419 CB LYS A 507 35.049 -26.294 -40.308 1.00 57.06 C
ATOM 2420 N ASN A 508 31.872 -25.839 -39.986 1.00 52.59 N
ATOM 2421 CA ASN A 508 30.790 -25.143 -39.305 1.00 52.59 C
ATOM 2422 C ASN A 508 29.796 -26.133 -38.708 1.00 52.59 C
ATOM 2423 O ASN A 508 29.325 -25.951 -37.578 1.00 52.59 O
ATOM 2424 CB ASN A 508 30.109 -24.199 -40.288 1.00 52.59 C
ATOM 2425 CG ASN A 508 29.310 -23.143 -39.602 1.00 52.59 C
ATOM 2426 OD1 ASN A 508 29.243 -23.113 -38.383 1.00 52.59 O
ATOM 2427 ND2 ASN A 508 28.718 -22.250 -40.378 1.00 52.59 N
ATOM 2428 N LEU A 509 29.492 -27.203 -39.443 1.00 53.44 N
ATOM 2429 CA LEU A 509 28.635 -28.259 -38.919 1.00 53.44 C
ATOM 2430 C LEU A 509 29.308 -28.988 -37.766 1.00 53.44 C
ATOM 2431 O LEU A 509 28.643 -29.388 -36.802 1.00 53.44 O
ATOM 2432 CB LEU A 509 28.280 -29.233 -40.037 1.00 53.44 C
ATOM 2433 CG LEU A 509 27.381 -30.394 -39.640 1.00 53.44 C
ATOM 2434 CD1 LEU A 509 26.055 -29.869 -39.175 1.00 53.44 C
ATOM 2435 CD2 LEU A 509 27.204 -31.346 -40.790 1.00 53.44 C
ATOM 2436 N GLN A 510 30.630 -29.156 -37.847 1.00 57.21 N
ATOM 2437 CA GLN A 510 31.402 -29.747 -36.761 1.00 57.21 C
ATOM 2438 C GLN A 510 31.287 -28.930 -35.485 1.00 57.21 C
ATOM 2439 O GLN A 510 31.180 -29.490 -34.388 1.00 57.21 O
ATOM 2440 CB GLN A 510 32.863 -29.869 -37.187 1.00 57.21 C
ATOM 2441 CG GLN A 510 33.786 -30.412 -36.128 1.00 57.21 C
ATOM 2442 CD GLN A 510 33.405 -31.799 -35.702 1.00 57.21 C
ATOM 2443 OE1 GLN A 510 32.845 -31.998 -34.626 1.00 57.21 O
ATOM 2444 NE2 GLN A 510 33.702 -32.775 -36.545 1.00 57.21 N
ATOM 2445 N ILE A 511 31.290 -27.605 -35.612 1.00 55.78 N
ATOM 2446 CA ILE A 511 31.070 -26.754 -34.445 1.00 55.78 C
ATOM 2447 C ILE A 511 29.636 -26.884 -33.939 1.00 55.78 C
ATOM 2448 O ILE A 511 29.399 -27.018 -32.729 1.00 55.78 O
ATOM 2449 CB ILE A 511 31.421 -25.295 -34.782 1.00 55.78 C
ATOM 2450 CG1 ILE A 511 32.906 -25.170 -35.102 1.00 55.78 C
ATOM 2451 CG2 ILE A 511 31.085 -24.377 -33.633 1.00 55.78 C
ATOM 2452 CD1 ILE A 511 33.289 -23.835 -35.687 1.00 55.78 C
ATOM 2453 N ALA A 512 28.669 -26.883 -34.863 1.00 55.29 N
ATOM 2454 CA ALA A 512 27.260 -26.839 -34.478 1.00 55.29 C
ATOM 2455 C ALA A 512 26.802 -28.145 -33.850 1.00 55.29 C
ATOM 2456 O ALA A 512 25.809 -28.172 -33.117 1.00 55.29 O
ATOM 2457 CB ALA A 512 26.396 -26.513 -35.690 1.00 55.29 C
ATOM 2458 N LYS A 513 27.497 -29.242 -34.143 1.00 59.27 N
ATOM 2459 CA LYS A 513 27.147 -30.512 -33.523 1.00 59.27 C
ATOM 2460 C LYS A 513 27.542 -30.525 -32.054 1.00 59.27 C
ATOM 2461 O LYS A 513 26.758 -30.940 -31.195 1.00 59.27 O
ATOM 2462 CB LYS A 513 27.826 -31.654 -34.275 1.00 59.27 C
ATOM 2463 CG LYS A 513 27.406 -33.077 -33.895 1.00 59.27 C
ATOM 2464 CD LYS A 513 28.339 -33.711 -32.872 1.00 59.27 C
ATOM 2465 CE LYS A 513 29.750 -33.704 -33.386 1.00 59.27 C
ATOM 2466 NZ LYS A 513 30.708 -34.368 -32.456 1.00 59.27 N
ATOM 2467 N ASN A 514 28.770 -30.103 -31.753 1.00 60.39 N
ATOM 2468 CA ASN A 514 29.266 -30.177 -30.384 1.00 60.39 C
ATOM 2469 C ASN A 514 28.635 -29.108 -29.509 1.00 60.39 C
ATOM 2470 O ASN A 514 28.322 -29.357 -28.341 1.00 60.39 O
ATOM 2471 CB ASN A 514 30.785 -30.046 -30.369 1.00 60.39 C
ATOM 2472 CG ASN A 514 31.473 -31.269 -30.911 1.00 60.39 C
ATOM 2473 OD1 ASN A 514 31.087 -32.393 -30.608 1.00 60.39 O
ATOM 2474 ND2 ASN A 514 32.495 -31.061 -31.727 1.00 60.39 N
ATOM 2475 N SER A 515 28.437 -27.911 -30.051 1.00 64.03 N
ATOM 2476 CA SER A 515 27.966 -26.829 -29.199 1.00 64.03 C
ATOM 2477 C SER A 515 26.462 -26.896 -28.953 1.00 64.03 C
ATOM 2478 O SER A 515 26.018 -26.781 -27.808 1.00 64.03 O
ATOM 2479 CB SER A 515 28.344 -25.490 -29.815 1.00 64.03 C
ATOM 2480 OG SER A 515 27.691 -25.334 -31.058 1.00 64.03 O
ATOM 2481 N TYR A 516 25.661 -27.088 -30.001 1.00 61.76 N
ATOM 2482 CA TYR A 516 24.202 -27.062 -29.891 1.00 61.76 C
ATOM 2483 C TYR A 516 23.651 -28.405 -30.376 1.00 61.76 C
ATOM 2484 O TYR A 516 23.358 -28.585 -31.557 1.00 61.76 O
ATOM 2485 CB TYR A 516 23.611 -25.910 -30.689 1.00 61.76 C
ATOM 2486 CG TYR A 516 24.102 -24.555 -30.261 1.00 61.76 C
ATOM 2487 CD1 TYR A 516 23.704 -24.006 -29.054 1.00 61.76 C
ATOM 2488 CD2 TYR A 516 24.922 -23.804 -31.086 1.00 61.76 C
ATOM 2489 CE1 TYR A 516 24.141 -22.762 -28.661 1.00 61.76 C
ATOM 2490 CE2 TYR A 516 25.364 -22.559 -30.707 1.00 61.76 C
ATOM 2491 CZ TYR A 516 24.968 -22.042 -29.493 1.00 61.76 C
ATOM 2492 OH TYR A 516 25.399 -20.798 -29.101 1.00 61.76 O
ATOM 2493 N ASN A 517 23.486 -29.342 -29.453 1.00 61.48 N
ATOM 2494 CA ASN A 517 23.202 -30.712 -29.847 1.00 61.48 C
ATOM 2495 C ASN A 517 21.714 -31.019 -29.736 1.00 61.48 C
ATOM 2496 O ASN A 517 21.019 -30.506 -28.858 1.00 61.48 O
ATOM 2497 CB ASN A 517 24.016 -31.670 -28.985 1.00 61.48 C
ATOM 2498 CG ASN A 517 24.109 -33.056 -29.576 1.00 61.48 C
ATOM 2499 OD1 ASN A 517 23.531 -33.343 -30.620 1.00 61.48 O
ATOM 2500 ND2 ASN A 517 24.864 -33.924 -28.918 1.00 61.48 N
ATOM 2501 N ASP A 518 21.228 -31.862 -30.648 1.00 56.04 N
ATOM 2502 CA ASP A 518 19.842 -32.309 -30.677 1.00 56.04 C
ATOM 2503 C ASP A 518 19.786 -33.683 -31.330 1.00 56.04 C
ATOM 2504 O ASP A 518 20.816 -34.280 -31.643 1.00 56.04 O
ATOM 2505 CB ASP A 518 18.939 -31.327 -31.429 1.00 56.04 C
ATOM 2506 N ALA A 519 18.569 -34.188 -31.531 1.00 54.90 N
ATOM 2507 CA ALA A 519 18.414 -35.536 -32.068 1.00 54.90 C
ATOM 2508 C ALA A 519 18.683 -35.570 -33.566 1.00 54.90 C
ATOM 2509 O ALA A 519 19.495 -36.375 -34.053 1.00 54.90 O
ATOM 2510 CB ALA A 519 17.013 -36.060 -31.763 1.00 54.90 C
ATOM 2511 N LEU A 520 17.989 -34.701 -34.311 1.00 46.52 N
ATOM 2512 CA LEU A 520 18.094 -34.675 -35.769 1.00 46.52 C
ATOM 2513 C LEU A 520 19.503 -34.349 -36.220 1.00 46.52 C
ATOM 2514 O LEU A 520 20.021 -34.975 -37.150 1.00 46.52 O
ATOM 2515 CB LEU A 520 17.120 -33.655 -36.344 1.00 46.52 C
ATOM 2516 CG LEU A 520 17.215 -33.511 -37.857 1.00 46.52 C
ATOM 2517 CD1 LEU A 520 16.864 -34.813 -38.515 1.00 46.52 C
ATOM 2518 CD2 LEU A 520 16.305 -32.431 -38.342 1.00 46.52 C
ATOM 2519 N LEU A 521 20.147 -33.395 -35.550 1.00 49.90 N
ATOM 2520 CA LEU A 521 21.482 -32.986 -35.957 1.00 49.90 C
ATOM 2521 C LEU A 521 22.494 -34.094 -35.700 1.00 49.90 C
ATOM 2522 O LEU A 521 23.419 -34.297 -36.497 1.00 49.90 O
ATOM 2523 CB LEU A 521 21.875 -31.713 -35.220 1.00 49.90 C
ATOM 2524 CG LEU A 521 23.116 -31.081 -35.820 1.00 49.90 C
ATOM 2525 CD1 LEU A 521 22.786 -30.602 -37.210 1.00 49.90 C
ATOM 2526 CD2 LEU A 521 23.600 -29.948 -34.960 1.00 49.90 C
ATOM 2527 N THR A 522 22.291 -34.857 -34.624 1.00 52.24 N
ATOM 2528 CA THR A 522 23.133 -36.015 -34.350 1.00 52.24 C
ATOM 2529 C THR A 522 22.973 -37.073 -35.426 1.00 52.24 C
ATOM 2530 O THR A 522 23.969 -37.625 -35.916 1.00 52.24 O
ATOM 2531 CB THR A 522 22.791 -36.599 -32.984 1.00 52.24 C
ATOM 2532 OG1 THR A 522 22.991 -35.602 -31.979 1.00 52.24 O
ATOM 2533 CG2 THR A 522 23.673 -37.787 -32.674 1.00 52.24 C
ATOM 2534 N PHE A 523 21.730 -37.341 -35.836 1.00 51.62 N
ATOM 2535 CA PHE A 523 21.509 -38.341 -36.877 1.00 51.62 C
ATOM 2536 C PHE A 523 22.081 -37.895 -38.218 1.00 51.62 C
ATOM 2537 O PHE A 523 22.619 -38.713 -38.976 1.00 51.62 O
ATOM 2538 CB PHE A 523 20.024 -38.637 -37.010 1.00 51.62 C
ATOM 2539 CG PHE A 523 19.720 -39.675 -38.027 1.00 51.62 C
ATOM 2540 CD1 PHE A 523 19.953 -41.006 -37.753 1.00 51.62 C
ATOM 2541 CD2 PHE A 523 19.218 -39.322 -39.264 1.00 51.62 C
ATOM 2542 CE1 PHE A 523 19.681 -41.972 -38.689 1.00 51.62 C
ATOM 2543 CE2 PHE A 523 18.947 -40.279 -40.206 1.00 51.62 C
ATOM 2544 CZ PHE A 523 19.179 -41.609 -39.920 1.00 51.62 C
ATOM 2545 N VAL A 524 22.001 -36.598 -38.515 1.00 51.15 N
ATOM 2546 CA VAL A 524 22.550 -36.096 -39.770 1.00 51.15 C
ATOM 2547 C VAL A 524 24.070 -36.175 -39.758 1.00 51.15 C
ATOM 2548 O VAL A 524 24.688 -36.556 -40.760 1.00 51.15 O
ATOM 2549 CB VAL A 524 22.038 -34.672 -40.048 1.00 51.15 C
ATOM 2550 CG1 VAL A 524 22.750 -34.054 -41.218 1.00 51.15 C
ATOM 2551 CG2 VAL A 524 20.572 -34.731 -40.362 1.00 51.15 C
ATOM 2552 N TRP A 525 24.693 -35.886 -38.612 1.00 58.40 N
ATOM 2553 CA TRP A 525 26.146 -35.990 -38.533 1.00 58.40 C
ATOM 2554 C TRP A 525 26.611 -37.434 -38.645 1.00 58.40 C
ATOM 2555 O TRP A 525 27.647 -37.705 -39.268 1.00 58.40 O
ATOM 2556 CB TRP A 525 26.648 -35.361 -37.238 1.00 58.40 C
ATOM 2557 CG TRP A 525 28.129 -35.350 -37.105 1.00 58.40 C
ATOM 2558 CD1 TRP A 525 29.020 -34.722 -37.915 1.00 58.40 C
ATOM 2559 CD2 TRP A 525 28.889 -35.963 -36.072 1.00 58.40 C
ATOM 2560 NE1 TRP A 525 30.297 -34.927 -37.465 1.00 58.40 N
ATOM 2561 CE2 TRP A 525 30.240 -35.690 -36.330 1.00 58.40 C
ATOM 2562 CE3 TRP A 525 28.558 -36.737 -34.959 1.00 58.40 C
ATOM 2563 CZ2 TRP A 525 31.261 -36.159 -35.513 1.00 58.40 C
ATOM 2564 CZ3 TRP A 525 29.566 -37.200 -34.149 1.00 58.40 C
ATOM 2565 CH2 TRP A 525 30.906 -36.910 -34.428 1.00 58.40 C
ATOM 2566 N LYS A 526 25.834 -38.376 -38.104 1.00 59.36 N
ATOM 2567 CA LYS A 526 26.198 -39.780 -38.263 1.00 59.36 C
ATOM 2568 C LYS A 526 26.043 -40.233 -39.707 1.00 59.36 C
ATOM 2569 O LYS A 526 26.868 -41.006 -40.204 1.00 59.36 O
ATOM 2570 CB LYS A 526 25.378 -40.661 -37.326 1.00 59.36 C
ATOM 2571 CG LYS A 526 25.682 -40.422 -35.861 1.00 59.36 C
ATOM 2572 CD LYS A 526 27.139 -40.699 -35.558 1.00 59.36 C
ATOM 2573 CE LYS A 526 27.440 -42.183 -35.624 1.00 59.36 C
ATOM 2574 NZ LYS A 526 28.858 -42.478 -35.272 1.00 59.36 N
ATOM 2575 N MET A 527 25.023 -39.730 -40.409 1.00 61.83 N
ATOM 2576 CA MET A 527 24.885 -40.044 -41.832 1.00 61.83 C
ATOM 2577 C MET A 527 26.033 -39.466 -42.652 1.00 61.83 C
ATOM 2578 O MET A 527 26.535 -40.111 -43.584 1.00 61.83 O
ATOM 2579 CB MET A 527 23.558 -39.516 -42.367 1.00 61.83 C
ATOM 2580 CG MET A 527 23.307 -39.887 -43.821 1.00 61.83 C
ATOM 2581 SD MET A 527 21.857 -39.101 -44.539 1.00 61.83 S
ATOM 2582 CE MET A 527 20.522 -39.974 -43.718 1.00 61.83 C
ATOM 2583 N VAL A 528 26.468 -38.253 -42.318 1.00 62.61 N
ATOM 2584 CA VAL A 528 27.534 -37.618 -43.088 1.00 62.61 C
ATOM 2585 C VAL A 528 28.860 -38.324 -42.850 1.00 62.61 C
ATOM 2586 O VAL A 528 29.623 -38.564 -43.792 1.00 62.61 O
ATOM 2587 CB VAL A 528 27.605 -36.116 -42.763 1.00 62.61 C
ATOM 2588 CG1 VAL A 528 28.835 -35.489 -43.366 1.00 62.61 C
ATOM 2589 CG2 VAL A 528 26.400 -35.427 -43.332 1.00 62.61 C
ATOM 2590 N GLU A 529 29.136 -38.727 -41.610 1.00 69.39 N
ATOM 2591 CA GLU A 529 30.380 -39.457 -41.384 1.00 69.39 C
ATOM 2592 C GLU A 529 30.285 -40.899 -41.857 1.00 69.39 C
ATOM 2593 O GLU A 529 31.312 -41.557 -42.047 1.00 69.39 O
ATOM 2594 CB GLU A 529 30.809 -39.390 -39.926 1.00 69.39 C
ATOM 2595 CG GLU A 529 31.446 -38.068 -39.605 1.00 69.39 C
ATOM 2596 CD GLU A 529 32.154 -38.069 -38.283 1.00 69.39 C
ATOM 2597 OE1 GLU A 529 31.992 -39.041 -37.519 1.00 69.39 O
ATOM 2598 OE2 GLU A 529 32.912 -37.111 -38.033 1.00 69.39 O
ATOM 2599 N ASP A 530 29.074 -41.415 -42.059 1.00 69.08 N
ATOM 2600 CA ASP A 530 28.965 -42.710 -42.717 1.00 69.08 C
ATOM 2601 C ASP A 530 29.283 -42.592 -44.200 1.00 69.08 C
ATOM 2602 O ASP A 530 29.982 -43.440 -44.762 1.00 69.08 O
ATOM 2603 CB ASP A 530 27.570 -43.293 -42.510 1.00 69.08 C
ATOM 2604 N PHE A 531 28.792 -41.537 -44.848 1.00 68.61 N
ATOM 2605 CA PHE A 531 29.093 -41.351 -46.265 1.00 68.61 C
ATOM 2606 C PHE A 531 30.515 -40.872 -46.508 1.00 68.61 C
ATOM 2607 O PHE A 531 31.032 -41.032 -47.618 1.00 68.61 O
ATOM 2608 CB PHE A 531 28.134 -40.359 -46.904 1.00 68.61 C
ATOM 2609 CG PHE A 531 26.860 -40.961 -47.383 1.00 68.61 C
ATOM 2610 CD1 PHE A 531 26.825 -41.609 -48.604 1.00 68.61 C
ATOM 2611 CD2 PHE A 531 25.694 -40.849 -46.654 1.00 68.61 C
ATOM 2612 CE1 PHE A 531 25.659 -42.158 -49.077 1.00 68.61 C
ATOM 2613 CE2 PHE A 531 24.518 -41.396 -47.135 1.00 68.61 C
ATOM 2614 CZ PHE A 531 24.500 -42.037 -48.343 1.00 68.61 C
ATOM 2615 N ARG A 532 31.152 -40.270 -45.504 1.00 66.79 N
ATOM 2616 CA ARG A 532 32.391 -39.538 -45.745 1.00 66.79 C
ATOM 2617 C ARG A 532 33.569 -40.480 -45.982 1.00 66.79 C
ATOM 2618 O ARG A 532 34.488 -40.153 -46.740 1.00 66.79 O
ATOM 2619 CB ARG A 532 32.650 -38.584 -44.575 1.00 66.79 C
ATOM 2620 CG ARG A 532 33.909 -37.756 -44.704 1.00 66.79 C
ATOM 2621 CD ARG A 532 33.889 -36.882 -45.946 1.00 66.79 C
ATOM 2622 NE ARG A 532 32.948 -35.776 -45.864 1.00 66.79 N
ATOM 2623 CZ ARG A 532 33.245 -34.603 -45.318 1.00 66.79 C
ATOM 2624 NH1 ARG A 532 34.445 -34.395 -44.803 1.00 66.79 N
ATOM 2625 NH2 ARG A 532 32.343 -33.638 -45.283 1.00 66.79 N
ATOM 2626 N ARG A 533 33.539 -41.666 -45.387 1.00 81.11 N
ATOM 2627 CA ARG A 533 34.614 -42.636 -45.571 1.00 81.11 C
ATOM 2628 C ARG A 533 34.607 -43.222 -46.978 1.00 81.11 C
ATOM 2629 O ARG A 533 34.801 -44.421 -47.161 1.00 81.11 O
ATOM 2630 CB ARG A 533 34.491 -43.754 -44.546 1.00 81.11 C
ATOM 2631 CG ARG A 533 34.664 -43.282 -43.132 1.00 81.11 C
ATOM 2632 CD ARG A 533 34.393 -44.412 -42.173 1.00 81.11 C
ATOM 2633 NE ARG A 533 34.460 -43.972 -40.787 1.00 81.11 N
ATOM 2634 CZ ARG A 533 34.153 -44.740 -39.747 1.00 81.11 C
ATOM 2635 NH1 ARG A 533 33.752 -45.988 -39.939 1.00 81.11 N
ATOM 2636 NH2 ARG A 533 34.243 -44.259 -38.516 1.00 81.11 N
ATOM 2637 N PRO A 555 21.844 -50.110 -48.834 1.00 96.04 N
ATOM 2638 CA PRO A 555 22.916 -50.836 -48.147 1.00 96.04 C
ATOM 2639 C PRO A 555 23.377 -50.152 -46.860 1.00 96.04 C
ATOM 2640 O PRO A 555 23.233 -50.743 -45.791 1.00 96.04 O
ATOM 2641 CB PRO A 555 24.035 -50.885 -49.193 1.00 96.04 C
ATOM 2642 CG PRO A 555 23.734 -49.785 -50.143 1.00 96.04 C
ATOM 2643 CD PRO A 555 22.247 -49.665 -50.177 1.00 96.04 C
ATOM 2644 N ILE A 556 23.924 -48.938 -46.952 1.00 86.43 N
ATOM 2645 CA ILE A 556 24.253 -48.200 -45.739 1.00 86.43 C
ATOM 2646 C ILE A 556 23.105 -47.275 -45.357 1.00 86.43 C
ATOM 2647 O ILE A 556 22.936 -46.928 -44.183 1.00 86.43 O
ATOM 2648 CB ILE A 556 25.596 -47.458 -45.902 1.00 86.43 C
ATOM 2649 CG1 ILE A 556 25.597 -46.501 -47.095 1.00 86.43 C
ATOM 2650 CG2 ILE A 556 26.735 -48.451 -46.061 1.00 86.43 C
ATOM 2651 CD1 ILE A 556 25.333 -45.077 -46.740 1.00 86.43 C
ATOM 2652 N THR A 557 22.308 -46.856 -46.339 1.00 77.11 N
ATOM 2653 CA THR A 557 21.041 -46.193 -46.068 1.00 77.11 C
ATOM 2654 C THR A 557 20.077 -46.465 -47.212 1.00 77.11 C
ATOM 2655 O THR A 557 20.477 -46.725 -48.350 1.00 77.11 O
ATOM 2656 CB THR A 557 21.198 -44.680 -45.859 1.00 77.11 C
ATOM 2657 OG1 THR A 557 19.930 -44.117 -45.504 1.00 77.11 O
ATOM 2658 CG2 THR A 557 21.703 -43.997 -47.111 1.00 77.11 C
ATOM 2659 N ARG A 558 18.800 -46.454 -46.871 1.00 69.36 N
ATOM 2660 CA ARG A 558 17.730 -46.300 -47.833 1.00 69.36 C
ATOM 2661 C ARG A 558 17.325 -44.829 -47.811 1.00 69.36 C
ATOM 2662 O ARG A 558 17.976 -44.016 -47.144 1.00 69.36 O
ATOM 2663 CB ARG A 558 16.609 -47.292 -47.512 1.00 69.36 C
ATOM 2664 CG ARG A 558 16.048 -47.183 -46.107 1.00 69.36 C
ATOM 2665 CD ARG A 558 15.113 -48.346 -45.780 1.00 69.36 C
ATOM 2666 NE ARG A 558 13.898 -48.329 -46.584 1.00 69.36 N
ATOM 2667 CZ ARG A 558 13.053 -49.348 -46.675 1.00 69.36 C
ATOM 2668 NH1 ARG A 558 13.293 -50.463 -46.006 1.00 69.36 N
ATOM 2669 NH2 ARG A 558 11.967 -49.250 -47.428 1.00 69.36 N
ATOM 2670 N HIS A 559 16.256 -44.492 -48.531 1.00 60.32 N
ATOM 2671 CA HIS A 559 15.868 -43.114 -48.824 1.00 60.32 C
ATOM 2672 C HIS A 559 17.005 -42.283 -49.414 1.00 60.32 C
ATOM 2673 O HIS A 559 17.599 -41.445 -48.705 1.00 60.32 O
ATOM 2674 CB HIS A 559 15.292 -42.429 -47.592 1.00 60.32 C
ATOM 2675 CG HIS A 559 14.049 -43.059 -47.055 1.00 60.32 C
ATOM 2676 ND1 HIS A 559 12.829 -42.949 -47.684 1.00 60.32 N
ATOM 2677 CD2 HIS A 559 13.825 -43.757 -45.917 1.00 60.32 C
ATOM 2678 CE1 HIS A 559 11.910 -43.573 -46.970 1.00 60.32 C
ATOM 2679 NE2 HIS A 559 12.489 -44.071 -45.893 1.00 60.32 N
ATOM 2680 N PRO A 560 17.373 -42.487 -50.679 1.00 53.22 N
ATOM 2681 CA PRO A 560 18.444 -41.659 -51.255 1.00 53.22 C
ATOM 2682 C PRO A 560 18.032 -40.225 -51.518 1.00 53.22 C
ATOM 2683 O PRO A 560 18.884 -39.321 -51.511 1.00 53.22 O
ATOM 2684 CB PRO A 560 18.775 -42.382 -52.563 1.00 53.22 C
ATOM 2685 CG PRO A 560 18.263 -43.747 -52.386 1.00 53.22 C
ATOM 2686 CD PRO A 560 17.025 -43.592 -51.581 1.00 53.22 C
ATOM 2687 N LEU A 561 16.746 -39.998 -51.780 1.00 44.27 N
ATOM 2688 CA LEU A 561 16.287 -38.667 -52.157 1.00 44.27 C
ATOM 2689 C LEU A 561 16.416 -37.686 -51.004 1.00 44.27 C
ATOM 2690 O LEU A 561 16.783 -36.525 -51.211 1.00 44.27 O
ATOM 2691 CB LEU A 561 14.850 -38.722 -52.656 1.00 44.27 C
ATOM 2692 CG LEU A 561 14.656 -38.887 -54.160 1.00 44.27 C
ATOM 2693 CD1 LEU A 561 15.279 -37.709 -54.853 1.00 44.27 C
ATOM 2694 CD2 LEU A 561 15.220 -40.176 -54.705 1.00 44.27 C
ATOM 2695 N GLN A 562 16.178 -38.147 -49.775 1.00 43.36 N
ATOM 2696 CA GLN A 562 16.431 -37.297 -48.618 1.00 43.36 C
ATOM 2697 C GLN A 562 17.917 -37.035 -48.421 1.00 43.36 C
ATOM 2698 O GLN A 562 18.297 -35.983 -47.900 1.00 43.36 O
ATOM 2699 CB GLN A 562 15.824 -37.907 -47.359 1.00 43.36 C
ATOM 2700 CG GLN A 562 14.347 -37.624 -47.183 1.00 43.36 C
ATOM 2701 CD GLN A 562 13.480 -38.473 -48.059 1.00 43.36 C
ATOM 2702 OE1 GLN A 562 13.926 -39.476 -48.606 1.00 43.36 O
ATOM 2703 NE2 GLN A 562 12.228 -38.074 -48.206 1.00 43.36 N
ATOM 2704 N ALA A 563 18.775 -37.957 -48.856 1.00 40.51 N
ATOM 2705 CA ALA A 563 20.207 -37.715 -48.736 1.00 40.51 C
ATOM 2706 C ALA A 563 20.655 -36.615 -49.684 1.00 40.51 C
ATOM 2707 O ALA A 563 21.389 -35.701 -49.281 1.00 40.51 O
ATOM 2708 CB ALA A 563 20.987 -38.997 -48.992 1.00 40.51 C
ATOM 2709 N LEU A 564 20.185 -36.656 -50.932 1.00 37.66 N
ATOM 2710 CA LEU A 564 20.512 -35.579 -51.863 1.00 37.66 C
ATOM 2711 C LEU A 564 19.874 -34.265 -51.435 1.00 37.66 C
ATOM 2712 O LEU A 564 20.476 -33.193 -51.584 1.00 37.66 O
ATOM 2713 CB LEU A 564 20.078 -35.954 -53.271 1.00 37.66 C
ATOM 2714 CG LEU A 564 20.357 -34.930 -54.359 1.00 37.66 C
ATOM 2715 CD1 LEU A 564 21.815 -34.650 -54.409 1.00 37.66 C
ATOM 2716 CD2 LEU A 564 19.903 -35.477 -55.678 1.00 37.66 C
ATOM 2717 N PHE A 565 18.684 -34.333 -50.838 1.00 32.66 N
ATOM 2718 CA PHE A 565 18.017 -33.125 -50.373 1.00 32.66 C
ATOM 2719 C PHE A 565 18.761 -32.468 -49.216 1.00 32.66 C
ATOM 2720 O PHE A 565 18.918 -31.242 -49.191 1.00 32.66 O
ATOM 2721 CB PHE A 565 16.590 -33.459 -49.973 1.00 32.66 C
ATOM 2722 CG PHE A 565 15.843 -32.311 -49.416 1.00 32.66 C
ATOM 2723 CD1 PHE A 565 15.446 -31.280 -50.224 1.00 32.66 C
ATOM 2724 CD2 PHE A 565 15.502 -32.281 -48.087 1.00 32.66 C
ATOM 2725 CE1 PHE A 565 14.749 -30.224 -49.715 1.00 32.66 C
ATOM 2726 CE2 PHE A 565 14.805 -31.230 -47.574 1.00 32.66 C
ATOM 2727 CZ PHE A 565 14.426 -30.201 -48.388 1.00 32.66 C
ATOM 2728 N ILE A 566 19.253 -33.260 -48.264 1.00 35.82 N
ATOM 2729 CA ILE A 566 19.978 -32.681 -47.137 1.00 35.82 C
ATOM 2730 C ILE A 566 21.338 -32.167 -47.587 1.00 35.82 C
ATOM 2731 O ILE A 566 21.818 -31.128 -47.102 1.00 35.82 O
ATOM 2732 CB ILE A 566 20.064 -33.711 -45.998 1.00 35.82 C
ATOM 2733 CG1 ILE A 566 18.681 -33.885 -45.392 1.00 35.82 C
ATOM 2734 CG2 ILE A 566 21.029 -33.314 -44.920 1.00 35.82 C
ATOM 2735 CD1 ILE A 566 18.593 -35.020 -44.440 1.00 35.82 C
ATOM 2736 N TRP A 567 21.939 -32.833 -48.580 1.00 40.01 N
ATOM 2737 CA TRP A 567 23.144 -32.301 -49.209 1.00 40.01 C
ATOM 2738 C TRP A 567 22.897 -30.945 -49.850 1.00 40.01 C
ATOM 2739 O TRP A 567 23.764 -30.068 -49.811 1.00 40.01 O
ATOM 2740 CB TRP A 567 23.655 -33.260 -50.271 1.00 40.01 C
ATOM 2741 CG TRP A 567 24.821 -32.714 -50.974 1.00 40.01 C
ATOM 2742 CD1 TRP A 567 26.073 -32.613 -50.494 1.00 40.01 C
ATOM 2743 CD2 TRP A 567 24.835 -32.114 -52.266 1.00 40.01 C
ATOM 2744 NE1 TRP A 567 26.888 -32.026 -51.419 1.00 40.01 N
ATOM 2745 CE2 TRP A 567 26.143 -31.702 -52.517 1.00 40.01 C
ATOM 2746 CE3 TRP A 567 23.866 -31.891 -53.235 1.00 40.01 C
ATOM 2747 CZ2 TRP A 567 26.514 -31.091 -53.696 1.00 40.01 C
ATOM 2748 CZ3 TRP A 567 24.237 -31.286 -54.407 1.00 40.01 C
ATOM 2749 CH2 TRP A 567 25.548 -30.892 -54.629 1.00 40.01 C
ATOM 2750 N SER A 568 21.726 -30.753 -50.445 1.00 37.40 N
ATOM 2751 CA SER A 568 21.456 -29.460 -51.060 1.00 37.40 C
ATOM 2752 C SER A 568 21.150 -28.397 -50.018 1.00 37.40 C
ATOM 2753 O SER A 568 21.486 -27.226 -50.208 1.00 37.40 O
ATOM 2754 CB SER A 568 20.308 -29.571 -52.052 1.00 37.40 C
ATOM 2755 OG SER A 568 19.997 -28.302 -52.593 1.00 37.40 O
ATOM 2756 N VAL A 569 20.509 -28.776 -48.912 1.00 32.54 N
ATOM 2757 CA VAL A 569 20.079 -27.759 -47.957 1.00 32.54 C
ATOM 2758 C VAL A 569 21.238 -27.288 -47.087 1.00 32.54 C
ATOM 2759 O VAL A 569 21.298 -26.109 -46.718 1.00 32.54 O
ATOM 2760 CB VAL A 569 18.892 -28.290 -47.134 1.00 32.54 C
ATOM 2761 CG1 VAL A 569 18.504 -27.370 -46.012 1.00 32.54 C
ATOM 2762 CG2 VAL A 569 17.709 -28.421 -48.033 1.00 32.54 C
ATOM 2763 N LEU A 570 22.207 -28.164 -46.798 1.00 34.35 N
ATOM 2764 CA LEU A 570 23.330 -27.757 -45.951 1.00 34.35 C
ATOM 2765 C LEU A 570 24.208 -26.689 -46.592 1.00 34.35 C
ATOM 2766 O LEU A 570 24.810 -25.885 -45.879 1.00 34.35 O
ATOM 2767 CB LEU A 570 24.193 -28.954 -45.581 1.00 34.35 C
ATOM 2768 CG LEU A 570 23.661 -29.867 -44.495 1.00 34.35 C
ATOM 2769 CD1 LEU A 570 24.572 -31.051 -44.342 1.00 34.35 C
ATOM 2770 CD2 LEU A 570 23.622 -29.073 -43.230 1.00 34.35 C
ATOM 2771 N GLN A 571 24.286 -26.637 -47.913 1.00 37.97 N
ATOM 2772 CA GLN A 571 25.167 -25.667 -48.544 1.00 37.97 C
ATOM 2773 C GLN A 571 24.487 -24.345 -48.871 1.00 37.97 C
ATOM 2774 O GLN A 571 25.106 -23.513 -49.541 1.00 37.97 O
ATOM 2775 CB GLN A 571 25.772 -26.242 -49.816 1.00 37.97 C
ATOM 2776 CG GLN A 571 26.721 -27.373 -49.578 1.00 37.97 C
ATOM 2777 CD GLN A 571 27.357 -27.836 -50.859 1.00 37.97 C
ATOM 2778 OE1 GLN A 571 27.060 -27.312 -51.926 1.00 37.97 O
ATOM 2779 NE2 GLN A 571 28.242 -28.817 -50.765 1.00 37.97 N
ATOM 2780 N ASN A 572 23.248 -24.140 -48.410 1.00 42.92 N
ATOM 2781 CA ASN A 572 22.438 -22.943 -48.690 1.00 42.92 C
ATOM 2782 C ASN A 572 22.289 -22.682 -50.184 1.00 42.92 C
ATOM 2783 O ASN A 572 22.581 -21.593 -50.676 1.00 42.92 O
ATOM 2784 CB ASN A 572 22.989 -21.706 -47.988 1.00 42.92 C
ATOM 2785 CG ASN A 572 22.847 -21.781 -46.499 1.00 42.92 C
ATOM 2786 OD1 ASN A 572 23.832 -21.882 -45.774 1.00 42.92 O
ATOM 2787 ND2 ASN A 572 21.618 -21.713 -46.024 1.00 42.92 N
ATOM 2788 N LYS A 573 21.838 -23.692 -50.918 1.00 43.16 N
ATOM 2789 CA LYS A 573 21.495 -23.527 -52.326 1.00 43.16 C
ATOM 2790 C LYS A 573 19.980 -23.440 -52.419 1.00 43.16 C
ATOM 2791 O LYS A 573 19.276 -24.404 -52.126 1.00 43.16 O
ATOM 2792 CB LYS A 573 22.039 -24.677 -53.157 1.00 43.16 C
ATOM 2793 CG LYS A 573 23.536 -24.687 -53.285 1.00 43.16 C
ATOM 2794 CD LYS A 573 23.979 -25.827 -54.172 1.00 43.16 C
ATOM 2795 CE LYS A 573 25.480 -25.835 -54.342 1.00 43.16 C
ATOM 2796 NZ LYS A 573 25.927 -26.980 -55.179 1.00 43.16 N
ATOM 2797 N LYS A 574 19.468 -22.280 -52.823 1.00 47.03 N
ATOM 2798 CA LYS A 574 18.023 -22.084 -52.837 1.00 47.03 C
ATOM 2799 C LYS A 574 17.383 -22.795 -54.018 1.00 47.03 C
ATOM 2800 O LYS A 574 16.557 -23.705 -53.849 1.00 47.03 O
ATOM 2801 CB LYS A 574 17.700 -20.594 -52.886 1.00 47.03 C
ATOM 2802 CG LYS A 574 18.078 -19.853 -51.633 1.00 47.03 C
ATOM 2803 CD LYS A 574 17.727 -18.384 -51.733 1.00 47.03 C
ATOM 2804 CE LYS A 574 18.137 -17.647 -50.472 1.00 47.03 C
ATOM 2805 NZ LYS A 574 17.809 -16.200 -50.534 1.00 47.03 N
ATOM 2806 N GLU A 575 17.773 -22.399 -55.228 1.00 43.71 N
ATOM 2807 CA GLU A 575 17.025 -22.794 -56.412 1.00 43.71 C
ATOM 2808 C GLU A 575 17.254 -24.253 -56.755 1.00 43.71 C
ATOM 2809 O GLU A 575 16.452 -24.857 -57.467 1.00 43.71 O
ATOM 2810 CB GLU A 575 17.393 -21.899 -57.588 1.00 43.71 C
ATOM 2811 N LEU A 576 18.336 -24.842 -56.262 1.00 40.71 N
ATOM 2812 CA LEU A 576 18.513 -26.272 -56.468 1.00 40.71 C
ATOM 2813 C LEU A 576 17.665 -27.064 -55.486 1.00 40.71 C
ATOM 2814 O LEU A 576 17.136 -28.129 -55.830 1.00 40.71 O
ATOM 2815 CB LEU A 576 19.992 -26.632 -56.351 1.00 40.71 C
ATOM 2816 CG LEU A 576 20.534 -27.985 -56.823 1.00 40.71 C
ATOM 2817 CD1 LEU A 576 20.416 -29.099 -55.801 1.00 40.71 C
ATOM 2818 CD2 LEU A 576 19.823 -28.372 -58.100 1.00 40.71 C
ATOM 2819 N SER A 577 17.515 -26.562 -54.263 1.00 40.93 N
ATOM 2820 CA SER A 577 16.761 -27.310 -53.270 1.00 40.93 C
ATOM 2821 C SER A 577 15.273 -27.241 -53.549 1.00 40.93 C
ATOM 2822 O SER A 577 14.549 -28.203 -53.281 1.00 40.93 O
ATOM 2823 CB SER A 577 17.042 -26.784 -51.878 1.00 40.93 C
ATOM 2824 OG SER A 577 16.462 -25.506 -51.750 1.00 40.93 O
ATOM 2825 N LYS A 578 14.800 -26.126 -54.111 1.00 43.86 N
ATOM 2826 CA LYS A 578 13.389 -26.057 -54.480 1.00 43.86 C
ATOM 2827 C LYS A 578 13.071 -27.008 -55.622 1.00 43.86 C
ATOM 2828 O LYS A 578 11.948 -27.510 -55.724 1.00 43.86 O
ATOM 2829 CB LYS A 578 13.001 -24.634 -54.852 1.00 43.86 C
ATOM 2830 CG LYS A 578 13.016 -23.701 -53.678 1.00 43.86 C
ATOM 2831 CD LYS A 578 12.631 -22.302 -54.080 1.00 43.86 C
ATOM 2832 CE LYS A 578 12.747 -21.382 -52.892 1.00 43.86 C
ATOM 2833 NZ LYS A 578 12.423 -19.977 -53.244 1.00 43.86 N
ATOM 2834 N VAL A 579 14.050 -27.276 -56.485 1.00 41.77 N
ATOM 2835 CA VAL A 579 13.853 -28.249 -57.551 1.00 41.77 C
ATOM 2836 C VAL A 579 13.860 -29.658 -56.995 1.00 41.77 C
ATOM 2837 O VAL A 579 12.969 -30.460 -57.294 1.00 41.77 O
ATOM 2838 CB VAL A 579 14.918 -28.067 -58.640 1.00 41.77 C
ATOM 2839 CG1 VAL A 579 14.878 -29.214 -59.611 1.00 41.77 C
ATOM 2840 CG2 VAL A 579 14.652 -26.786 -59.357 1.00 41.77 C
ATOM 2841 N ILE A 580 14.836 -29.978 -56.150 1.00 37.87 N
ATOM 2842 CA ILE A 580 14.927 -31.351 -55.678 1.00 37.87 C
ATOM 2843 C ILE A 580 13.879 -31.658 -54.611 1.00 37.87 C
ATOM 2844 O ILE A 580 13.659 -32.829 -54.290 1.00 37.87 O
ATOM 2845 CB ILE A 580 16.351 -31.634 -55.179 1.00 37.87 C
ATOM 2846 CG1 ILE A 580 16.679 -33.107 -55.335 1.00 37.87 C
ATOM 2847 CG2 ILE A 580 16.505 -31.252 -53.731 1.00 37.87 C
ATOM 2848 CD1 ILE A 580 16.732 -33.526 -56.766 1.00 37.87 C
ATOM 2849 N TRP A 581 13.189 -30.644 -54.083 1.00 38.04 N
ATOM 2850 CA TRP A 581 12.133 -30.897 -53.109 1.00 38.04 C
ATOM 2851 C TRP A 581 10.897 -31.488 -53.764 1.00 38.04 C
ATOM 2852 O TRP A 581 10.113 -32.183 -53.115 1.00 38.04 O
ATOM 2853 CB TRP A 581 11.771 -29.604 -52.392 1.00 38.04 C
ATOM 2854 CG TRP A 581 10.701 -29.751 -51.386 1.00 38.04 C
ATOM 2855 CD1 TRP A 581 10.777 -30.407 -50.211 1.00 38.04 C
ATOM 2856 CD2 TRP A 581 9.376 -29.245 -51.480 1.00 38.04 C
ATOM 2857 NE1 TRP A 581 9.583 -30.332 -49.548 1.00 38.04 N
ATOM 2858 CE2 TRP A 581 8.704 -29.620 -50.314 1.00 38.04 C
ATOM 2859 CE3 TRP A 581 8.694 -28.502 -52.439 1.00 38.04 C
ATOM 2860 CZ2 TRP A 581 7.388 -29.281 -50.078 1.00 38.04 C
ATOM 2861 CZ3 TRP A 581 7.391 -28.167 -52.205 1.00 38.04 C
ATOM 2862 CH2 TRP A 581 6.749 -28.552 -51.036 1.00 38.04 C
ATOM 2863 N GLU A 582 10.711 -31.242 -55.055 1.00 46.01 N
ATOM 2864 CA GLU A 582 9.481 -31.682 -55.697 1.00 46.01 C
ATOM 2865 C GLU A 582 9.546 -33.150 -56.095 1.00 46.01 C
ATOM 2866 O GLU A 582 8.585 -33.687 -56.651 1.00 46.01 O
ATOM 2867 CB GLU A 582 9.187 -30.812 -56.910 1.00 46.01 C
ATOM 2868 CG GLU A 582 8.876 -29.380 -56.548 1.00 46.01 C
ATOM 2869 CD GLU A 582 8.646 -28.515 -57.764 1.00 46.01 C
ATOM 2870 OE1 GLU A 582 8.789 -29.027 -58.893 1.00 46.01 O
ATOM 2871 OE2 GLU A 582 8.342 -27.318 -57.593 1.00 46.01 O
ATOM 2872 N GLN A 583 10.670 -33.814 -55.846 1.00 46.25 N
ATOM 2873 CA GLN A 583 10.766 -35.213 -56.236 1.00 46.25 C
ATOM 2874 C GLN A 583 10.727 -36.136 -55.029 1.00 46.25 C
ATOM 2875 O GLN A 583 10.626 -37.357 -55.183 1.00 46.25 O
ATOM 2876 CB GLN A 583 12.038 -35.440 -57.040 1.00 46.25 C
ATOM 2877 CG GLN A 583 12.118 -34.571 -58.259 1.00 46.25 C
ATOM 2878 CD GLN A 583 11.024 -34.864 -59.234 1.00 46.25 C
ATOM 2879 OE1 GLN A 583 10.658 -36.018 -59.444 1.00 46.25 O
ATOM 2880 NE2 GLN A 583 10.487 -33.821 -59.846 1.00 46.25 N
ATOM 2881 N THR A 584 10.821 -35.585 -53.822 1.00 45.48 N
ATOM 2882 CA THR A 584 10.902 -36.440 -52.647 1.00 45.48 C
ATOM 2883 C THR A 584 9.522 -36.965 -52.278 1.00 45.48 C
ATOM 2884 O THR A 584 8.500 -36.443 -52.724 1.00 45.48 O
ATOM 2885 CB THR A 584 11.525 -35.689 -51.474 1.00 45.48 C
ATOM 2886 OG1 THR A 584 11.765 -36.604 -50.403 1.00 45.48 O
ATOM 2887 CG2 THR A 584 10.610 -34.613 -50.986 1.00 45.48 C
ATOM 2888 N ARG A 585 9.496 -38.032 -51.482 1.00 48.64 N
ATOM 2889 CA ARG A 585 8.238 -38.731 -51.258 1.00 48.64 C
ATOM 2890 C ARG A 585 7.417 -38.065 -50.166 1.00 48.64 C
ATOM 2891 O ARG A 585 6.307 -37.591 -50.422 1.00 48.64 O
ATOM 2892 CB ARG A 585 8.506 -40.192 -50.918 1.00 48.64 C
ATOM 2893 CG ARG A 585 9.331 -40.903 -51.969 1.00 48.64 C
ATOM 2894 CD ARG A 585 8.612 -41.002 -53.304 1.00 48.64 C
ATOM 2895 NE ARG A 585 7.490 -41.934 -53.290 1.00 48.64 N
ATOM 2896 CZ ARG A 585 6.542 -41.961 -54.219 1.00 48.64 C
ATOM 2897 NH1 ARG A 585 6.576 -41.103 -55.226 1.00 48.64 N
ATOM 2898 NH2 ARG A 585 5.559 -42.843 -54.142 1.00 48.64 N
ATOM 2899 N GLY A 586 7.942 -38.004 -48.947 1.00 47.83 N
ATOM 2900 CA GLY A 586 7.195 -37.412 -47.855 1.00 47.83 C
ATOM 2901 C GLY A 586 7.405 -35.917 -47.818 1.00 47.83 C
ATOM 2902 O GLY A 586 8.402 -35.439 -47.277 1.00 47.83 O
ATOM 2903 N CYS A 587 6.449 -35.166 -48.363 1.00 47.07 N
ATOM 2904 CA CYS A 587 6.731 -33.795 -48.772 1.00 47.07 C
ATOM 2905 C CYS A 587 6.764 -32.850 -47.581 1.00 47.07 C
ATOM 2906 O CYS A 587 7.764 -32.150 -47.362 1.00 47.07 O
ATOM 2907 CB CYS A 587 5.694 -33.356 -49.793 1.00 47.07 C
ATOM 2908 SG CYS A 587 5.649 -34.477 -51.185 1.00 47.07 S
ATOM 2909 N THR A 588 5.689 -32.829 -46.788 1.00 43.32 N
ATOM 2910 CA THR A 588 5.631 -31.927 -45.643 1.00 43.32 C
ATOM 2911 C THR A 588 6.636 -32.323 -44.572 1.00 43.32 C
ATOM 2912 O THR A 588 7.190 -31.460 -43.878 1.00 43.32 O
ATOM 2913 CB THR A 588 4.220 -31.873 -45.072 1.00 43.32 C
ATOM 2914 OG1 THR A 588 4.219 -31.051 -43.905 1.00 43.32 O
ATOM 2915 CG2 THR A 588 3.707 -33.236 -44.724 1.00 43.32 C
ATOM 2916 N LEU A 589 6.940 -33.618 -44.473 1.00 43.21 N
ATOM 2917 CA LEU A 589 7.927 -34.073 -43.507 1.00 43.21 C
ATOM 2918 C LEU A 589 9.316 -33.608 -43.900 1.00 43.21 C
ATOM 2919 O LEU A 589 10.084 -33.147 -43.050 1.00 43.21 O
ATOM 2920 CB LEU A 589 7.883 -35.588 -43.399 1.00 43.21 C
ATOM 2921 CG LEU A 589 8.837 -36.146 -42.363 1.00 43.21 C
ATOM 2922 CD1 LEU A 589 8.447 -35.638 -41.004 1.00 43.21 C
ATOM 2923 CD2 LEU A 589 8.791 -37.646 -42.405 1.00 43.21 C
ATOM 2924 N ALA A 590 9.634 -33.675 -45.193 1.00 42.37 N
ATOM 2925 CA ALA A 590 10.939 -33.226 -45.658 1.00 42.37 C
ATOM 2926 C ALA A 590 11.082 -31.721 -45.528 1.00 42.37 C
ATOM 2927 O ALA A 590 12.158 -31.225 -45.164 1.00 42.37 O
ATOM 2928 CB ALA A 590 11.164 -33.656 -47.101 1.00 42.37 C
ATOM 2929 N ALA A 591 10.003 -30.982 -45.800 1.00 39.14 N
ATOM 2930 CA ALA A 591 10.046 -29.534 -45.640 1.00 39.14 C
ATOM 2931 C ALA A 591 10.277 -29.150 -44.188 1.00 39.14 C
ATOM 2932 O ALA A 591 11.114 -28.284 -43.884 1.00 39.14 O
ATOM 2933 CB ALA A 591 8.754 -28.917 -46.156 1.00 39.14 C
ATOM 2934 N LEU A 592 9.614 -29.844 -43.270 1.00 36.57 N
ATOM 2935 CA LEU A 592 9.743 -29.458 -41.878 1.00 36.57 C
ATOM 2936 C LEU A 592 11.087 -29.907 -41.312 1.00 36.57 C
ATOM 2937 O LEU A 592 11.660 -29.240 -40.437 1.00 36.57 O
ATOM 2938 CB LEU A 592 8.589 -30.041 -41.087 1.00 36.57 C
ATOM 2939 CG LEU A 592 8.370 -29.222 -39.837 1.00 36.57 C
ATOM 2940 CD1 LEU A 592 7.813 -27.896 -40.263 1.00 36.57 C
ATOM 2941 CD2 LEU A 592 7.431 -29.909 -38.917 1.00 36.57 C
ATOM 2942 N GLY A 593 11.628 -31.010 -41.832 1.00 38.94 N
ATOM 2943 CA GLY A 593 12.967 -31.417 -41.444 1.00 38.94 C
ATOM 2944 C GLY A 593 14.030 -30.445 -41.908 1.00 38.94 C
ATOM 2945 O GLY A 593 14.993 -30.176 -41.184 1.00 38.94 O
ATOM 2946 N ALA A 594 13.863 -29.895 -43.111 1.00 37.30 N
ATOM 2947 CA ALA A 594 14.787 -28.866 -43.575 1.00 37.30 C
ATOM 2948 C ALA A 594 14.701 -27.619 -42.709 1.00 37.30 C
ATOM 2949 O ALA A 594 15.721 -26.968 -42.449 1.00 37.30 O
ATOM 2950 CB ALA A 594 14.507 -28.520 -45.032 1.00 37.30 C
ATOM 2951 N SER A 595 13.498 -27.291 -42.224 1.00 37.82 N
ATOM 2952 CA SER A 595 13.371 -26.147 -41.322 1.00 37.82 C
ATOM 2953 C SER A 595 14.109 -26.381 -40.010 1.00 37.82 C
ATOM 2954 O SER A 595 14.855 -25.505 -39.544 1.00 37.82 O
ATOM 2955 CB SER A 595 11.912 -25.855 -41.020 1.00 37.82 C
ATOM 2956 OG SER A 595 11.408 -26.835 -40.140 1.00 37.82 O
ATOM 2957 N LYS A 596 13.934 -27.561 -39.407 1.00 36.83 N
ATOM 2958 CA LYS A 596 14.564 -27.805 -38.109 1.00 36.83 C
ATOM 2959 C LYS A 596 16.069 -27.994 -38.253 1.00 36.83 C
ATOM 2960 O LYS A 596 16.825 -27.788 -37.299 1.00 36.83 O
ATOM 2961 CB LYS A 596 13.923 -29.006 -37.419 1.00 36.83 C
ATOM 2962 CG LYS A 596 14.251 -29.133 -35.938 1.00 36.83 C
ATOM 2963 CD LYS A 596 15.325 -30.149 -35.655 1.00 36.83 C
ATOM 2964 CE LYS A 596 15.594 -30.252 -34.181 1.00 36.83 C
ATOM 2965 NZ LYS A 596 16.207 -28.992 -33.695 1.00 36.83 N
ATOM 2966 N LEU A 597 16.528 -28.352 -39.446 1.00 35.14 N
ATOM 2967 CA LEU A 597 17.965 -28.414 -39.673 1.00 35.14 C
ATOM 2968 C LEU A 597 18.559 -27.021 -39.825 1.00 35.14 C
ATOM 2969 O LEU A 597 19.625 -26.724 -39.266 1.00 35.14 O
ATOM 2970 CB LEU A 597 18.252 -29.258 -40.903 1.00 35.14 C
ATOM 2971 CG LEU A 597 19.713 -29.492 -41.212 1.00 35.14 C
ATOM 2972 CD1 LEU A 597 20.345 -30.215 -40.071 1.00 35.14 C
ATOM 2973 CD2 LEU A 597 19.804 -30.321 -42.451 1.00 35.14 C
ATOM 2974 N LEU A 598 17.883 -26.145 -40.567 1.00 34.60 N
ATOM 2975 CA LEU A 598 18.467 -24.838 -40.827 1.00 34.60 C
ATOM 2976 C LEU A 598 18.408 -23.928 -39.613 1.00 34.60 C
ATOM 2977 O LEU A 598 19.234 -23.021 -39.492 1.00 34.60 O
ATOM 2978 CB LEU A 598 17.797 -24.172 -42.012 1.00 34.60 C
ATOM 2979 CG LEU A 598 18.178 -24.812 -43.326 1.00 34.60 C
ATOM 2980 CD1 LEU A 598 17.445 -24.107 -44.431 1.00 34.60 C
ATOM 2981 CD2 LEU A 598 19.659 -24.719 -43.521 1.00 34.60 C
ATOM 2982 N LYS A 599 17.453 -24.143 -38.700 1.00 39.19 N
ATOM 2983 CA LYS A 599 17.494 -23.382 -37.448 1.00 39.19 C
ATOM 2984 C LYS A 599 18.755 -23.693 -36.649 1.00 39.19 C
ATOM 2985 O LYS A 599 19.438 -22.780 -36.159 1.00 39.19 O
ATOM 2986 CB LYS A 599 16.267 -23.665 -36.594 1.00 39.19 C
ATOM 2987 CG LYS A 599 14.962 -23.227 -37.182 1.00 39.19 C
ATOM 2988 CD LYS A 599 14.785 -21.741 -37.193 1.00 39.19 C
ATOM 2989 CE LYS A 599 13.393 -21.437 -37.706 1.00 39.19 C
ATOM 2990 NZ LYS A 599 13.091 -19.990 -37.773 1.00 39.19 N
ATOM 2991 N SER A 600 19.101 -24.974 -36.540 1.00 38.87 N
ATOM 2992 CA SER A 600 20.276 -25.356 -35.768 1.00 38.87 C
ATOM 2993 C SER A 600 21.557 -24.962 -36.481 1.00 38.87 C
ATOM 2994 O SER A 600 22.580 -24.716 -35.837 1.00 38.87 O
ATOM 2995 CB SER A 600 20.258 -26.852 -35.493 1.00 38.87 C
ATOM 2996 OG SER A 600 21.410 -27.232 -34.772 1.00 38.87 O
ATOM 2997 N MET A 601 21.531 -24.904 -37.810 1.00 41.08 N
ATOM 2998 CA MET A 601 22.662 -24.309 -38.517 1.00 41.08 C
ATOM 2999 C MET A 601 22.717 -22.803 -38.314 1.00 41.08 C
ATOM 3000 O MET A 601 23.785 -22.197 -38.422 1.00 41.08 O
ATOM 3001 CB MET A 601 22.592 -24.636 -40.000 1.00 41.08 C
ATOM 3002 CG MET A 601 23.078 -26.007 -40.348 1.00 41.08 C
ATOM 3003 SD MET A 601 24.852 -26.060 -40.161 1.00 41.08 S
ATOM 3004 CE MET A 601 25.302 -24.968 -41.501 1.00 41.08 C
ATOM 3005 N ALA A 602 21.574 -22.174 -38.049 1.00 42.10 N
ATOM 3006 CA ALA A 602 21.558 -20.724 -37.909 1.00 42.10 C
ATOM 3007 C ALA A 602 21.988 -20.288 -36.518 1.00 42.10 C
ATOM 3008 O ALA A 602 22.370 -19.131 -36.320 1.00 42.10 O
ATOM 3009 CB ALA A 602 20.169 -20.182 -38.227 1.00 42.10 C
ATOM 3010 N LYS A 603 21.923 -21.187 -35.534 1.00 50.03 N
ATOM 3011 CA LYS A 603 22.335 -20.801 -34.183 1.00 50.03 C
ATOM 3012 C LYS A 603 23.845 -20.642 -34.045 1.00 50.03 C
ATOM 3013 O LYS A 603 24.321 -20.158 -33.014 1.00 50.03 O
ATOM 3014 CB LYS A 603 21.856 -21.810 -33.147 1.00 50.03 C
ATOM 3015 CG LYS A 603 20.418 -21.707 -32.758 1.00 50.03 C
ATOM 3016 CD LYS A 603 20.165 -22.687 -31.642 1.00 50.03 C
ATOM 3017 CE LYS A 603 18.735 -22.657 -31.185 1.00 50.03 C
ATOM 3018 NZ LYS A 603 18.527 -23.648 -30.100 1.00 50.03 N
ATOM 3019 N VAL A 604 24.623 -21.079 -35.036 1.00 54.31 N
ATOM 3020 CA VAL A 604 26.067 -20.926 -34.932 1.00 54.31 C
ATOM 3021 C VAL A 604 26.420 -19.470 -35.200 1.00 54.31 C
ATOM 3022 O VAL A 604 25.636 -18.720 -35.794 1.00 54.31 O
ATOM 3023 CB VAL A 604 26.784 -21.881 -35.901 1.00 54.31 C
ATOM 3024 CG1 VAL A 604 26.767 -21.340 -37.306 1.00 54.31 C
ATOM 3025 CG2 VAL A 604 28.184 -22.208 -35.422 1.00 54.31 C
ATOM 3026 N LYS A 605 27.580 -19.038 -34.707 1.00 61.19 N
ATOM 3027 CA LYS A 605 27.992 -17.644 -34.802 1.00 61.19 C
ATOM 3028 C LYS A 605 29.429 -17.490 -35.272 1.00 61.19 C
ATOM 3029 O LYS A 605 30.099 -16.533 -34.879 1.00 61.19 O
ATOM 3030 CB LYS A 605 27.813 -16.949 -33.454 1.00 61.19 C
ATOM 3031 CG LYS A 605 26.370 -16.823 -32.998 1.00 61.19 C
ATOM 3032 CD LYS A 605 26.280 -16.229 -31.613 1.00 61.19 C
ATOM 3033 CE LYS A 605 24.851 -16.222 -31.113 1.00 61.19 C
ATOM 3034 NZ LYS A 605 24.762 -15.668 -29.738 1.00 61.19 N
ATOM 3035 N ASN A 606 29.929 -18.418 -36.083 1.00 57.88 N
ATOM 3036 CA ASN A 606 31.284 -18.282 -36.601 1.00 57.88 C
ATOM 3037 C ASN A 606 31.309 -17.367 -37.818 1.00 57.88 C
ATOM 3038 O ASN A 606 32.235 -16.568 -37.991 1.00 57.88 O
ATOM 3039 CB ASN A 606 31.844 -19.657 -36.947 1.00 57.88 C
ATOM 3040 CG ASN A 606 33.337 -19.648 -37.134 1.00 57.88 C
ATOM 3041 OD1 ASN A 606 33.993 -18.627 -36.962 1.00 57.88 O
ATOM 3042 ND2 ASN A 606 33.885 -20.796 -37.495 1.00 57.88 N
ATOM 3043 N ASP A 607 30.301 -17.473 -38.676 1.00 64.60 N
ATOM 3044 CA ASP A 607 30.214 -16.701 -39.911 1.00 64.60 C
ATOM 3045 C ASP A 607 28.769 -16.255 -40.066 1.00 64.60 C
ATOM 3046 O ASP A 607 27.861 -17.089 -40.106 1.00 64.60 O
ATOM 3047 CB ASP A 607 30.664 -17.540 -41.104 1.00 64.60 C
ATOM 3048 CG ASP A 607 30.868 -16.721 -42.359 1.00 64.60 C
ATOM 3049 OD1 ASP A 607 30.675 -15.488 -42.322 1.00 64.60 O
ATOM 3050 OD2 ASP A 607 31.226 -17.321 -43.394 1.00 64.60 O
ATOM 3051 N ILE A 608 28.553 -14.946 -40.166 1.00 58.76 N
ATOM 3052 CA ILE A 608 27.190 -14.430 -40.101 1.00 58.76 C
ATOM 3053 C ILE A 608 26.563 -14.387 -41.494 1.00 58.76 C
ATOM 3054 O ILE A 608 25.329 -14.421 -41.640 1.00 58.76 O
ATOM 3055 CB ILE A 608 27.192 -13.059 -39.398 1.00 58.76 C
ATOM 3056 CG1 ILE A 608 25.786 -12.641 -38.991 1.00 58.76 C
ATOM 3057 CG2 ILE A 608 27.837 -12.002 -40.258 1.00 58.76 C
ATOM 3058 CD1 ILE A 608 25.774 -11.512 -38.016 1.00 58.76 C
ATOM 3059 N ASN A 609 27.401 -14.385 -42.536 1.00 62.64 N
ATOM 3060 CA ASN A 609 26.911 -14.249 -43.905 1.00 62.64 C
ATOM 3061 C ASN A 609 26.133 -15.478 -44.349 1.00 62.64 C
ATOM 3062 O ASN A 609 25.121 -15.361 -45.046 1.00 62.64 O
ATOM 3063 CB ASN A 609 28.076 -14.001 -44.853 1.00 62.64 C
ATOM 3064 CG ASN A 609 28.683 -12.645 -44.666 1.00 62.64 C
ATOM 3065 OD1 ASN A 609 27.973 -11.658 -44.493 1.00 62.64 O
ATOM 3066 ND2 ASN A 609 30.007 -12.580 -44.696 1.00 62.64 N
ATOM 3067 N ALA A 610 26.593 -16.666 -43.964 1.00 62.38 N
ATOM 3068 CA ALA A 610 25.808 -17.860 -44.237 1.00 62.38 C
ATOM 3069 C ALA A 610 24.601 -17.935 -43.315 1.00 62.38 C
ATOM 3070 O ALA A 610 23.550 -18.463 -43.700 1.00 62.38 O
ATOM 3071 CB ALA A 610 26.676 -19.108 -44.096 1.00 62.38 C
ATOM 3072 N ALA A 611 24.725 -17.386 -42.103 1.00 60.04 N
ATOM 3073 CA ALA A 611 23.693 -17.567 -41.089 1.00 60.04 C
ATOM 3074 C ALA A 611 22.424 -16.798 -41.428 1.00 60.04 C
ATOM 3075 O ALA A 611 21.310 -17.303 -41.215 1.00 60.04 O
ATOM 3076 CB ALA A 611 24.220 -17.144 -39.724 1.00 60.04 C
ATOM 3077 N GLY A 612 22.569 -15.584 -41.965 1.00 64.17 N
ATOM 3078 CA GLY A 612 21.392 -14.826 -42.368 1.00 64.17 C
ATOM 3079 C GLY A 612 20.610 -15.499 -43.482 1.00 64.17 C
ATOM 3080 O GLY A 612 19.376 -15.619 -43.411 1.00 64.17 O
ATOM 3081 N GLU A 613 21.323 -15.998 -44.496 1.00 66.09 N
ATOM 3082 CA GLU A 613 20.674 -16.696 -45.598 1.00 66.09 C
ATOM 3083 C GLU A 613 20.055 -17.998 -45.128 1.00 66.09 C
ATOM 3084 O GLU A 613 19.007 -18.416 -45.635 1.00 66.09 O
ATOM 3085 CB GLU A 613 21.682 -16.971 -46.702 1.00 66.09 C
ATOM 3086 CG GLU A 613 22.285 -15.722 -47.277 1.00 66.09 C
ATOM 3087 CD GLU A 613 23.295 -16.019 -48.358 1.00 66.09 C
ATOM 3088 OE1 GLU A 613 23.549 -17.213 -48.617 1.00 66.09 O
ATOM 3089 OE2 GLU A 613 23.850 -15.061 -48.936 1.00 66.09 O
ATOM 3090 N SER A 614 20.670 -18.629 -44.129 1.00 52.74 N
ATOM 3091 CA SER A 614 20.137 -19.877 -43.609 1.00 52.74 C
ATOM 3092 C SER A 614 18.821 -19.650 -42.884 1.00 52.74 C
ATOM 3093 O SER A 614 17.870 -20.421 -43.057 1.00 52.74 O
ATOM 3094 CB SER A 614 21.152 -20.535 -42.686 1.00 52.74 C
ATOM 3095 OG SER A 614 20.639 -21.758 -42.197 1.00 52.74 O
ATOM 3096 N GLU A 615 18.730 -18.579 -42.095 1.00 57.37 N
ATOM 3097 CA GLU A 615 17.475 -18.348 -41.387 1.00 57.37 C
ATOM 3098 C GLU A 615 16.374 -17.905 -42.347 1.00 57.37 C
ATOM 3099 O GLU A 615 15.198 -18.268 -42.167 1.00 57.37 O
ATOM 3100 CB GLU A 615 17.671 -17.337 -40.264 1.00 57.37 C
ATOM 3101 CG GLU A 615 16.488 -17.257 -39.326 1.00 57.37 C
ATOM 3102 CD GLU A 615 16.768 -16.402 -38.118 1.00 57.37 C
ATOM 3103 OE1 GLU A 615 17.881 -15.850 -38.035 1.00 57.37 O
ATOM 3104 OE2 GLU A 615 15.882 -16.290 -37.246 1.00 57.37 O
ATOM 3105 N GLU A 616 16.743 -17.185 -43.416 1.00 61.87 N
ATOM 3106 CA GLU A 616 15.742 -16.838 -44.428 1.00 61.87 C
ATOM 3107 C GLU A 616 15.237 -18.068 -45.171 1.00 61.87 C
ATOM 3108 O GLU A 616 14.032 -18.189 -45.433 1.00 61.87 O
ATOM 3109 CB GLU A 616 16.292 -15.827 -45.425 1.00 61.87 C
ATOM 3110 CG GLU A 616 16.435 -14.434 -44.869 1.00 61.87 C
ATOM 3111 CD GLU A 616 16.934 -13.443 -45.902 1.00 61.87 C
ATOM 3112 OE1 GLU A 616 17.269 -13.871 -47.027 1.00 61.87 O
ATOM 3113 OE2 GLU A 616 16.994 -12.234 -45.592 1.00 61.87 O
ATOM 3114 N LEU A 617 16.136 -18.995 -45.511 1.00 45.35 N
ATOM 3115 CA LEU A 617 15.706 -20.213 -46.188 1.00 45.35 C
ATOM 3116 C LEU A 617 14.854 -21.080 -45.271 1.00 45.35 C
ATOM 3117 O LEU A 617 13.906 -21.736 -45.726 1.00 45.35 O
ATOM 3118 CB LEU A 617 16.917 -20.988 -46.691 1.00 45.35 C
ATOM 3119 CG LEU A 617 16.583 -22.196 -47.551 1.00 45.35 C
ATOM 3120 CD1 LEU A 617 15.879 -21.730 -48.785 1.00 45.35 C
ATOM 3121 CD2 LEU A 617 17.846 -22.895 -47.941 1.00 45.35 C
ATOM 3122 N ALA A 618 15.133 -21.044 -43.967 1.00 46.11 N
ATOM 3123 CA ALA A 618 14.324 -21.806 -43.021 1.00 46.11 C
ATOM 3124 C ALA A 618 12.902 -21.279 -42.947 1.00 46.11 C
ATOM 3125 O ALA A 618 11.942 -22.063 -42.970 1.00 46.11 O
ATOM 3126 CB ALA A 618 14.957 -21.774 -41.638 1.00 46.11 C
ATOM 3127 N ASN A 619 12.742 -19.955 -42.863 1.00 50.92 N
ATOM 3128 CA ASN A 619 11.390 -19.398 -42.837 1.00 50.92 C
ATOM 3129 C ASN A 619 10.665 -19.630 -44.158 1.00 50.92 C
ATOM 3130 O ASN A 619 9.448 -19.893 -44.174 1.00 50.92 O
ATOM 3131 CB ASN A 619 11.432 -17.913 -42.500 1.00 50.92 C
ATOM 3132 CG ASN A 619 11.746 -17.670 -41.053 1.00 50.92 C
ATOM 3133 OD1 ASN A 619 11.237 -18.367 -40.179 1.00 50.92 O
ATOM 3134 ND2 ASN A 619 12.593 -16.688 -40.783 1.00 50.92 N
ATOM 3135 N GLU A 620 11.404 -19.594 -45.270 1.00 50.67 N
ATOM 3136 CA GLU A 620 10.789 -19.844 -46.564 1.00 50.67 C
ATOM 3137 C GLU A 620 10.338 -21.289 -46.718 1.00 50.67 C
ATOM 3138 O GLU A 620 9.342 -21.541 -47.398 1.00 50.67 O
ATOM 3139 CB GLU A 620 11.758 -19.460 -47.674 1.00 50.67 C
ATOM 3140 CG GLU A 620 11.146 -19.448 -49.046 1.00 50.67 C
ATOM 3141 CD GLU A 620 12.097 -18.929 -50.085 1.00 50.67 C
ATOM 3142 OE1 GLU A 620 13.259 -18.647 -49.735 1.00 50.67 O
ATOM 3143 OE2 GLU A 620 11.677 -18.774 -51.247 1.00 50.67 O
ATOM 3144 N TYR A 621 11.005 -22.241 -46.076 1.00 39.98 N
ATOM 3145 CA TYR A 621 10.479 -23.603 -46.086 1.00 39.98 C
ATOM 3146 C TYR A 621 9.340 -23.825 -45.106 1.00 39.98 C
ATOM 3147 O TYR A 621 8.458 -24.651 -45.378 1.00 39.98 O
ATOM 3148 CB TYR A 621 11.578 -24.625 -45.825 1.00 39.98 C
ATOM 3149 CG TYR A 621 12.202 -25.122 -47.090 1.00 39.98 C
ATOM 3150 CD1 TYR A 621 11.595 -26.117 -47.815 1.00 39.98 C
ATOM 3151 CD2 TYR A 621 13.381 -24.599 -47.567 1.00 39.98 C
ATOM 3152 CE1 TYR A 621 12.139 -26.584 -48.970 1.00 39.98 C
ATOM 3153 CE2 TYR A 621 13.941 -25.061 -48.729 1.00 39.98 C
ATOM 3154 CZ TYR A 621 13.312 -26.056 -49.426 1.00 39.98 C
ATOM 3155 OH TYR A 621 13.870 -26.529 -50.586 1.00 39.98 O
ATOM 3156 N GLU A 622 9.322 -23.100 -43.986 1.00 48.50 N
ATOM 3157 CA GLU A 622 8.206 -23.241 -43.054 1.00 48.50 C
ATOM 3158 C GLU A 622 6.892 -22.783 -43.677 1.00 48.50 C
ATOM 3159 O GLU A 622 5.862 -23.464 -43.540 1.00 48.50 O
ATOM 3160 CB GLU A 622 8.474 -22.457 -41.780 1.00 48.50 C
ATOM 3161 CG GLU A 622 7.393 -22.644 -40.760 1.00 48.50 C
ATOM 3162 CD GLU A 622 7.547 -21.741 -39.559 1.00 48.50 C
ATOM 3163 OE1 GLU A 622 8.524 -20.964 -39.507 1.00 48.50 O
ATOM 3164 OE2 GLU A 622 6.666 -21.789 -38.674 1.00 48.50 O
ATOM 3165 N THR A 623 6.914 -21.656 -44.401 1.00 46.60 N
ATOM 3166 CA THR A 623 5.671 -21.177 -45.013 1.00 46.60 C
ATOM 3167 C THR A 623 5.200 -22.106 -46.125 1.00 46.60 C
ATOM 3168 O THR A 623 3.990 -22.281 -46.327 1.00 46.60 O
ATOM 3169 CB THR A 623 5.836 -19.770 -45.570 1.00 46.60 C
ATOM 3170 OG1 THR A 623 6.790 -19.792 -46.634 1.00 46.60 O
ATOM 3171 CG2 THR A 623 6.303 -18.822 -44.493 1.00 46.60 C
ATOM 3172 N ARG A 624 6.133 -22.744 -46.827 1.00 41.66 N
ATOM 3173 CA ARG A 624 5.739 -23.673 -47.875 1.00 41.66 C
ATOM 3174 C ARG A 624 5.130 -24.933 -47.285 1.00 41.66 C
ATOM 3175 O ARG A 624 4.149 -25.469 -47.822 1.00 41.66 O
ATOM 3176 CB ARG A 624 6.937 -24.002 -48.747 1.00 41.66 C
ATOM 3177 CG ARG A 624 6.609 -24.867 -49.919 1.00 41.66 C
ATOM 3178 CD ARG A 624 7.793 -24.924 -50.824 1.00 41.66 C
ATOM 3179 NE ARG A 624 8.066 -23.610 -51.382 1.00 41.66 N
ATOM 3180 CZ ARG A 624 9.152 -23.315 -52.078 1.00 41.66 C
ATOM 3181 NH1 ARG A 624 10.069 -24.242 -52.300 1.00 41.66 N
ATOM 3182 NH2 ARG A 624 9.325 -22.094 -52.552 1.00 41.66 N
ATOM 3183 N ALA A 625 5.654 -25.381 -46.145 1.00 38.37 N
ATOM 3184 CA ALA A 625 5.070 -26.536 -45.477 1.00 38.37 C
ATOM 3185 C ALA A 625 3.660 -26.241 -44.986 1.00 38.37 C
ATOM 3186 O ALA A 625 2.760 -27.080 -45.121 1.00 38.37 O
ATOM 3187 CB ALA A 625 5.950 -26.973 -44.317 1.00 38.37 C
ATOM 3188 N VAL A 626 3.431 -25.038 -44.455 1.00 40.27 N
ATOM 3189 CA VAL A 626 2.102 -24.775 -43.910 1.00 40.27 C
ATOM 3190 C VAL A 626 1.087 -24.559 -45.033 1.00 40.27 C
ATOM 3191 O VAL A 626 -0.076 -24.970 -44.913 1.00 40.27 O
ATOM 3192 CB VAL A 626 2.123 -23.615 -42.892 1.00 40.27 C
ATOM 3193 CG1 VAL A 626 2.389 -22.279 -43.518 1.00 40.27 C
ATOM 3194 CG2 VAL A 626 0.829 -23.561 -42.150 1.00 40.27 C
ATOM 3195 N GLU A 627 1.519 -24.002 -46.172 1.00 41.06 N
ATOM 3196 CA GLU A 627 0.593 -23.854 -47.292 1.00 41.06 C
ATOM 3197 C GLU A 627 0.219 -25.210 -47.883 1.00 41.06 C
ATOM 3198 O GLU A 627 -0.962 -25.461 -48.175 1.00 41.06 O
ATOM 3199 CB GLU A 627 1.192 -22.945 -48.362 1.00 41.06 C
ATOM 3200 N LEU A 628 1.205 -26.111 -48.015 1.00 40.62 N
ATOM 3201 CA LEU A 628 0.925 -27.461 -48.505 1.00 40.62 C
ATOM 3202 C LEU A 628 -0.010 -28.216 -47.577 1.00 40.62 C
ATOM 3203 O LEU A 628 -0.929 -28.900 -48.040 1.00 40.62 O
ATOM 3204 CB LEU A 628 2.217 -28.250 -48.682 1.00 40.62 C
ATOM 3205 CG LEU A 628 2.037 -29.723 -49.046 1.00 40.62 C
ATOM 3206 CD1 LEU A 628 1.365 -29.870 -50.386 1.00 40.62 C
ATOM 3207 CD2 LEU A 628 3.355 -30.434 -49.032 1.00 40.62 C
ATOM 3208 N PHE A 629 0.179 -28.091 -46.265 1.00 40.82 N
ATOM 3209 CA PHE A 629 -0.676 -28.879 -45.388 1.00 40.82 C
ATOM 3210 C PHE A 629 -2.072 -28.291 -45.274 1.00 40.82 C
ATOM 3211 O PHE A 629 -3.026 -29.042 -45.066 1.00 40.82 O
ATOM 3212 CB PHE A 629 -0.067 -29.032 -44.009 1.00 40.82 C
ATOM 3213 CG PHE A 629 -0.841 -29.944 -43.134 1.00 40.82 C
ATOM 3214 CD1 PHE A 629 -0.788 -31.300 -43.327 1.00 40.82 C
ATOM 3215 CD2 PHE A 629 -1.645 -29.444 -42.142 1.00 40.82 C
ATOM 3216 CE1 PHE A 629 -1.504 -32.139 -42.525 1.00 40.82 C
ATOM 3217 CE2 PHE A 629 -2.361 -30.273 -41.342 1.00 40.82 C
ATOM 3218 CZ PHE A 629 -2.298 -31.619 -41.537 1.00 40.82 C
ATOM 3219 N THR A 630 -2.228 -26.973 -45.429 1.00 43.93 N
ATOM 3220 CA THR A 630 -3.578 -26.417 -45.500 1.00 43.93 C
ATOM 3221 C THR A 630 -4.309 -26.913 -46.738 1.00 43.93 C
ATOM 3222 O THR A 630 -5.477 -27.337 -46.656 1.00 43.93 O
ATOM 3223 CB THR A 630 -3.524 -24.894 -45.485 1.00 43.93 C
ATOM 3224 OG1 THR A 630 -3.019 -24.459 -44.220 1.00 43.93 O
ATOM 3225 CG2 THR A 630 -4.893 -24.298 -45.693 1.00 43.93 C
ATOM 3226 N GLU A 631 -3.613 -26.930 -47.877 1.00 48.54 N
ATOM 3227 CA GLU A 631 -4.223 -27.440 -49.098 1.00 48.54 C
ATOM 3228 C GLU A 631 -4.574 -28.919 -48.982 1.00 48.54 C
ATOM 3229 O GLU A 631 -5.659 -29.334 -49.396 1.00 48.54 O
ATOM 3230 CB GLU A 631 -3.293 -27.200 -50.278 1.00 48.54 C
ATOM 3231 CG GLU A 631 -3.861 -27.665 -51.591 1.00 48.54 C
ATOM 3232 CD GLU A 631 -5.068 -26.865 -52.026 1.00 48.54 C
ATOM 3233 OE1 GLU A 631 -5.170 -25.671 -51.664 1.00 48.54 O
ATOM 3234 OE2 GLU A 631 -5.921 -27.433 -52.740 1.00 48.54 O
ATOM 3235 N CYS A 632 -3.710 -29.711 -48.348 1.00 48.09 N
ATOM 3236 CA CYS A 632 -3.986 -31.138 -48.209 1.00 48.09 C
ATOM 3237 C CYS A 632 -5.050 -31.401 -47.152 1.00 48.09 C
ATOM 3238 O CYS A 632 -5.719 -32.437 -47.177 1.00 48.09 O
ATOM 3239 CB CYS A 632 -2.697 -31.876 -47.873 1.00 48.09 C
ATOM 3240 SG CYS A 632 -2.837 -33.659 -47.803 1.00 48.09 S
ATOM 3241 N TYR A 633 -5.228 -30.476 -46.216 1.00 48.82 N
ATOM 3242 CA TYR A 633 -6.249 -30.669 -45.198 1.00 48.82 C
ATOM 3243 C TYR A 633 -7.606 -30.251 -45.721 1.00 48.82 C
ATOM 3244 O TYR A 633 -8.637 -30.562 -45.116 1.00 48.82 O
ATOM 3245 CB TYR A 633 -5.881 -29.875 -43.954 1.00 48.82 C
ATOM 3246 CG TYR A 633 -6.752 -30.124 -42.761 1.00 48.82 C
ATOM 3247 CD1 TYR A 633 -6.649 -31.301 -42.051 1.00 48.82 C
ATOM 3248 CD2 TYR A 633 -7.657 -29.175 -42.330 1.00 48.82 C
ATOM 3249 CE1 TYR A 633 -7.425 -31.534 -40.955 1.00 48.82 C
ATOM 3250 CE2 TYR A 633 -8.442 -29.403 -41.230 1.00 48.82 C
ATOM 3251 CZ TYR A 633 -8.318 -30.590 -40.548 1.00 48.82 C
ATOM 3252 OH TYR A 633 -9.088 -30.855 -39.444 1.00 48.82 O
ATOM 3253 N SER A 634 -7.622 -29.504 -46.825 1.00 49.58 N
ATOM 3254 CA SER A 634 -8.900 -29.118 -47.415 1.00 49.58 C
ATOM 3255 C SER A 634 -9.678 -30.315 -47.960 1.00 49.58 C
ATOM 3256 O SER A 634 -10.911 -30.315 -47.918 1.00 49.58 O
ATOM 3257 CB SER A 634 -8.693 -28.081 -48.510 1.00 49.58 C
ATOM 3258 OG SER A 634 -8.288 -26.848 -47.950 1.00 49.58 O
ATOM 3259 N ASN A 635 -8.996 -31.344 -48.472 1.00 52.14 N
ATOM 3260 CA ASN A 635 -9.741 -32.418 -49.128 1.00 52.14 C
ATOM 3261 C ASN A 635 -10.320 -33.423 -48.138 1.00 52.14 C
ATOM 3262 O ASN A 635 -11.541 -33.539 -48.008 1.00 52.14 O
ATOM 3263 CB ASN A 635 -8.877 -33.142 -50.155 1.00 52.14 C
ATOM 3264 CG ASN A 635 -8.740 -32.367 -51.433 1.00 52.14 C
ATOM 3265 OD1 ASN A 635 -9.617 -31.593 -51.792 1.00 52.14 O
ATOM 3266 ND2 ASN A 635 -7.696 -32.644 -52.177 1.00 52.14 N
ATOM 3267 N ASP A 636 -9.471 -34.156 -47.429 1.00 60.39 N
ATOM 3268 CA ASP A 636 -9.923 -35.331 -46.689 1.00 60.39 C
ATOM 3269 C ASP A 636 -9.283 -35.314 -45.314 1.00 60.39 C
ATOM 3270 O ASP A 636 -8.067 -35.468 -45.198 1.00 60.39 O
ATOM 3271 CB ASP A 636 -9.576 -36.618 -47.431 1.00 60.39 C
ATOM 3272 N GLU A 637 -10.103 -35.152 -44.277 1.00 66.93 N
ATOM 3273 CA GLU A 637 -9.568 -34.866 -42.953 1.00 66.93 C
ATOM 3274 C GLU A 637 -8.917 -36.094 -42.327 1.00 66.93 C
ATOM 3275 O GLU A 637 -7.869 -35.983 -41.674 1.00 66.93 O
ATOM 3276 CB GLU A 637 -10.677 -34.330 -42.056 1.00 66.93 C
ATOM 3277 CG GLU A 637 -10.182 -33.838 -40.718 1.00 66.93 C
ATOM 3278 CD GLU A 637 -11.286 -33.259 -39.870 1.00 66.93 C
ATOM 3279 OE1 GLU A 637 -12.451 -33.285 -40.315 1.00 66.93 O
ATOM 3280 OE2 GLU A 637 -10.987 -32.772 -38.760 1.00 66.93 O
ATOM 3281 N ASP A 638 -9.517 -37.271 -42.523 1.00 70.93 N
ATOM 3282 CA ASP A 638 -9.022 -38.488 -41.885 1.00 70.93 C
ATOM 3283 C ASP A 638 -7.651 -38.876 -42.413 1.00 70.93 C
ATOM 3284 O ASP A 638 -6.733 -39.181 -41.635 1.00 70.93 O
ATOM 3285 CB ASP A 638 -10.012 -39.624 -42.114 1.00 70.93 C
ATOM 3286 CG ASP A 638 -11.335 -39.378 -41.437 1.00 70.93 C
ATOM 3287 OD1 ASP A 638 -11.341 -38.695 -40.391 1.00 70.93 O
ATOM 3288 OD2 ASP A 638 -12.367 -39.857 -41.954 1.00 70.93 O
ATOM 3289 N LEU A 639 -7.488 -38.832 -43.732 1.00 64.34 N
ATOM 3290 CA LEU A 639 -6.201 -39.150 -44.327 1.00 64.34 C
ATOM 3291 C LEU A 639 -5.165 -38.081 -44.003 1.00 64.34 C
ATOM 3292 O LEU A 639 -3.978 -38.388 -43.864 1.00 64.34 O
ATOM 3293 CB LEU A 639 -6.364 -39.325 -45.829 1.00 64.34 C
ATOM 3294 CG LEU A 639 -7.200 -40.533 -46.221 1.00 64.34 C
ATOM 3295 CD1 LEU A 639 -7.399 -40.561 -47.718 1.00 64.34 C
ATOM 3296 CD2 LEU A 639 -6.520 -41.795 -45.744 1.00 64.34 C
ATOM 3297 N ALA A 640 -5.601 -36.833 -43.819 1.00 58.53 N
ATOM 3298 CA ALA A 640 -4.666 -35.774 -43.455 1.00 58.53 C
ATOM 3299 C ALA A 640 -4.135 -35.960 -42.040 1.00 58.53 C
ATOM 3300 O ALA A 640 -2.950 -35.731 -41.779 1.00 58.53 O
ATOM 3301 CB ALA A 640 -5.332 -34.411 -43.597 1.00 58.53 C
ATOM 3302 N GLU A 641 -4.977 -36.410 -41.115 1.00 61.12 N
ATOM 3303 CA GLU A 641 -4.477 -36.600 -39.757 1.00 61.12 C
ATOM 3304 C GLU A 641 -3.640 -37.865 -39.645 1.00 61.12 C
ATOM 3305 O GLU A 641 -2.657 -37.912 -38.885 1.00 61.12 O
ATOM 3306 CB GLU A 641 -5.633 -36.619 -38.777 1.00 61.12 C
ATOM 3307 CG GLU A 641 -6.275 -35.270 -38.662 1.00 61.12 C
ATOM 3308 CD GLU A 641 -7.452 -35.285 -37.740 1.00 61.12 C
ATOM 3309 OE1 GLU A 641 -7.821 -36.391 -37.294 1.00 61.12 O
ATOM 3310 OE2 GLU A 641 -8.005 -34.200 -37.466 1.00 61.12 O
ATOM 3311 N GLN A 642 -3.995 -38.894 -40.415 1.00 60.14 N
ATOM 3312 CA GLN A 642 -3.130 -40.063 -40.511 1.00 60.14 C
ATOM 3313 C GLN A 642 -1.795 -39.699 -41.152 1.00 60.14 C
ATOM 3314 O GLN A 642 -0.763 -40.302 -40.841 1.00 60.14 O
ATOM 3315 CB GLN A 642 -3.846 -41.155 -41.298 1.00 60.14 C
ATOM 3316 CG GLN A 642 -3.163 -42.496 -41.315 1.00 60.14 C
ATOM 3317 CD GLN A 642 -4.005 -43.537 -42.016 1.00 60.14 C
ATOM 3318 OE1 GLN A 642 -5.092 -43.236 -42.506 1.00 60.14 O
ATOM 3319 NE2 GLN A 642 -3.512 -44.766 -42.069 1.00 60.14 N
ATOM 3320 N LEU A 643 -1.793 -38.689 -42.023 1.00 52.69 N
ATOM 3321 CA LEU A 643 -0.549 -38.172 -42.578 1.00 52.69 C
ATOM 3322 C LEU A 643 0.246 -37.395 -41.538 1.00 52.69 C
ATOM 3323 O LEU A 643 1.478 -37.339 -41.612 1.00 52.69 O
ATOM 3324 CB LEU A 643 -0.866 -37.306 -43.798 1.00 52.69 C
ATOM 3325 CG LEU A 643 0.191 -36.750 -44.750 1.00 52.69 C
ATOM 3326 CD1 LEU A 643 0.776 -35.438 -44.300 1.00 52.69 C
ATOM 3327 CD2 LEU A 643 1.284 -37.765 -44.901 1.00 52.69 C
ATOM 3328 N LEU A 644 -0.438 -36.734 -40.602 1.00 49.65 N
ATOM 3329 CA LEU A 644 0.276 -36.079 -39.507 1.00 49.65 C
ATOM 3330 C LEU A 644 1.005 -37.079 -38.635 1.00 49.65 C
ATOM 3331 O LEU A 644 2.205 -36.937 -38.387 1.00 49.65 O
ATOM 3332 CB LEU A 644 -0.655 -35.263 -38.623 1.00 49.65 C
ATOM 3333 CG LEU A 644 -1.081 -33.899 -39.103 1.00 49.65 C
ATOM 3334 CD1 LEU A 644 -2.022 -33.305 -38.100 1.00 49.65 C
ATOM 3335 CD2 LEU A 644 0.139 -33.053 -39.236 1.00 49.65 C
ATOM 3336 N THR A 645 0.308 -38.098 -38.156 1.00 56.30 N
ATOM 3337 CA THR A 645 0.937 -38.968 -37.172 1.00 56.30 C
ATOM 3338 C THR A 645 1.876 -40.008 -37.780 1.00 56.30 C
ATOM 3339 O THR A 645 2.393 -40.852 -37.044 1.00 56.30 O
ATOM 3340 CB THR A 645 -0.130 -39.665 -36.331 1.00 56.30 C
ATOM 3341 OG1 THR A 645 0.500 -40.405 -35.278 1.00 56.30 O
ATOM 3342 CG2 THR A 645 -0.952 -40.600 -37.192 1.00 56.30 C
ATOM 3343 N TYR A 646 2.126 -39.962 -39.082 1.00 58.23 N
ATOM 3344 CA TYR A 646 2.998 -40.937 -39.722 1.00 58.23 C
ATOM 3345 C TYR A 646 4.461 -40.610 -39.472 1.00 58.23 C
ATOM 3346 O TYR A 646 4.842 -39.441 -39.424 1.00 58.23 O
ATOM 3347 CB TYR A 646 2.710 -40.961 -41.214 1.00 58.23 C
ATOM 3348 CG TYR A 646 3.625 -41.832 -42.013 1.00 58.23 C
ATOM 3349 CD1 TYR A 646 3.614 -43.202 -41.851 1.00 58.23 C
ATOM 3350 CD2 TYR A 646 4.458 -41.287 -42.971 1.00 58.23 C
ATOM 3351 CE1 TYR A 646 4.435 -44.006 -42.588 1.00 58.23 C
ATOM 3352 CE2 TYR A 646 5.281 -42.083 -43.723 1.00 58.23 C
ATOM 3353 CZ TYR A 646 5.266 -43.444 -43.525 1.00 58.23 C
ATOM 3354 OH TYR A 646 6.084 -44.256 -44.266 1.00 58.23 O
ATOM 3355 N SER A 647 5.286 -41.642 -39.326 1.00 60.27 N
ATOM 3356 CA SER A 647 6.711 -41.478 -39.075 1.00 60.27 C
ATOM 3357 C SER A 647 7.521 -42.192 -40.146 1.00 60.27 C
ATOM 3358 O SER A 647 7.055 -43.172 -40.732 1.00 60.27 O
ATOM 3359 CB SER A 647 7.089 -42.022 -37.703 1.00 60.27 C
ATOM 3360 OG SER A 647 6.902 -43.422 -37.655 1.00 60.27 O
ATOM 3361 N CYS A 648 8.735 -41.699 -40.402 1.00 65.41 N
ATOM 3362 CA CYS A 648 9.657 -42.355 -41.318 1.00 65.41 C
ATOM 3363 C CYS A 648 11.029 -42.498 -40.681 1.00 65.41 C
ATOM 3364 O CYS A 648 11.328 -41.876 -39.661 1.00 65.41 O
ATOM 3365 CB CYS A 648 9.826 -41.616 -42.633 1.00 65.41 C
ATOM 3366 SG CYS A 648 10.871 -42.562 -43.758 1.00 65.41 S
ATOM 3367 N GLU A 649 11.861 -43.338 -41.299 1.00 75.19 N
ATOM 3368 CA GLU A 649 13.208 -43.572 -40.794 1.00 75.19 C
ATOM 3369 C GLU A 649 14.242 -42.642 -41.403 1.00 75.19 C
ATOM 3370 O GLU A 649 15.374 -42.613 -40.913 1.00 75.19 O
ATOM 3371 CB GLU A 649 13.647 -45.006 -41.065 1.00 75.19 C
ATOM 3372 CG GLU A 649 12.970 -46.053 -40.228 1.00 75.19 C
ATOM 3373 CD GLU A 649 13.410 -47.444 -40.623 1.00 75.19 C
ATOM 3374 OE1 GLU A 649 14.102 -47.572 -41.655 1.00 75.19 O
ATOM 3375 OE2 GLU A 649 13.075 -48.406 -39.903 1.00 75.19 O
ATOM 3376 N ALA A 650 13.901 -41.932 -42.483 1.00 60.49 N
ATOM 3377 CA ALA A 650 14.882 -41.096 -43.171 1.00 60.49 C
ATOM 3378 C ALA A 650 15.319 -39.936 -42.294 1.00 60.49 C
ATOM 3379 O ALA A 650 16.508 -39.621 -42.204 1.00 60.49 O
ATOM 3380 CB ALA A 650 14.304 -40.578 -44.484 1.00 60.49 C
ATOM 3381 N TRP A 651 14.368 -39.304 -41.630 1.00 47.52 N
ATOM 3382 CA TRP A 651 14.652 -38.351 -40.575 1.00 47.52 C
ATOM 3383 C TRP A 651 14.772 -39.128 -39.280 1.00 47.52 C
ATOM 3384 O TRP A 651 14.678 -40.355 -39.265 1.00 47.52 O
ATOM 3385 CB TRP A 651 13.550 -37.302 -40.513 1.00 47.52 C
ATOM 3386 CG TRP A 651 13.397 -36.666 -41.829 1.00 47.52 C
ATOM 3387 CD1 TRP A 651 12.536 -37.031 -42.805 1.00 47.52 C
ATOM 3388 CD2 TRP A 651 14.147 -35.572 -42.344 1.00 47.52 C
ATOM 3389 NE1 TRP A 651 12.694 -36.233 -43.902 1.00 47.52 N
ATOM 3390 CE2 TRP A 651 13.680 -35.324 -43.641 1.00 47.52 C
ATOM 3391 CE3 TRP A 651 15.164 -34.772 -41.831 1.00 47.52 C
ATOM 3392 CZ2 TRP A 651 14.189 -34.312 -44.430 1.00 47.52 C
ATOM 3393 CZ3 TRP A 651 15.665 -33.768 -42.615 1.00 47.52 C
ATOM 3394 CH2 TRP A 651 15.180 -33.545 -43.900 1.00 47.52 C
ATOM 3395 N GLY A 652 14.951 -38.418 -38.178 1.00 64.50 N
ATOM 3396 CA GLY A 652 15.285 -39.104 -36.945 1.00 64.50 C
ATOM 3397 C GLY A 652 14.171 -39.884 -36.273 1.00 64.50 C
ATOM 3398 O GLY A 652 13.919 -39.690 -35.081 1.00 64.50 O
ATOM 3399 N GLY A 653 13.552 -40.808 -37.013 1.00 67.49 N
ATOM 3400 CA GLY A 653 12.449 -41.632 -36.557 1.00 67.49 C
ATOM 3401 C GLY A 653 11.302 -40.866 -35.935 1.00 67.49 C
ATOM 3402 O GLY A 653 10.805 -41.249 -34.873 1.00 67.49 O
ATOM 3403 N SER A 654 10.877 -39.782 -36.570 1.00 65.35 N
ATOM 3404 CA SER A 654 10.000 -38.835 -35.907 1.00 65.35 C
ATOM 3405 C SER A 654 8.904 -38.346 -36.838 1.00 65.35 C
ATOM 3406 O SER A 654 9.166 -37.944 -37.973 1.00 65.35 O
ATOM 3407 CB SER A 654 10.800 -37.651 -35.378 1.00 65.35 C
ATOM 3408 OG SER A 654 9.958 -36.737 -34.705 1.00 65.35 O
ATOM 3409 N ASN A 655 7.677 -38.369 -36.334 1.00 58.10 N
ATOM 3410 CA ASN A 655 6.532 -37.827 -37.037 1.00 58.10 C
ATOM 3411 C ASN A 655 6.599 -36.307 -37.085 1.00 58.10 C
ATOM 3412 O ASN A 655 7.334 -35.671 -36.329 1.00 58.10 O
ATOM 3413 CB ASN A 655 5.242 -38.287 -36.367 1.00 58.10 C
ATOM 3414 CG ASN A 655 5.291 -38.132 -34.872 1.00 58.10 C
ATOM 3415 OD1 ASN A 655 6.294 -37.693 -34.329 1.00 58.10 O
ATOM 3416 ND2 ASN A 655 4.209 -38.498 -34.195 1.00 58.10 N
ATOM 3417 N CYS A 656 5.808 -35.735 -37.997 1.00 49.67 N
ATOM 3418 CA CYS A 656 5.892 -34.312 -38.314 1.00 49.67 C
ATOM 3419 C CYS A 656 5.499 -33.440 -37.131 1.00 49.67 C
ATOM 3420 O CYS A 656 6.101 -32.383 -36.895 1.00 49.67 O
ATOM 3421 CB CYS A 656 4.999 -34.015 -39.513 1.00 49.67 C
ATOM 3422 SG CYS A 656 4.903 -32.294 -39.998 1.00 49.67 S
ATOM 3423 N LEU A 657 4.519 -33.888 -36.354 1.00 48.83 N
ATOM 3424 CA LEU A 657 3.978 -33.052 -35.297 1.00 48.83 C
ATOM 3425 C LEU A 657 4.939 -32.961 -34.122 1.00 48.83 C
ATOM 3426 O LEU A 657 4.942 -31.965 -33.395 1.00 48.83 O
ATOM 3427 CB LEU A 657 2.614 -33.596 -34.878 1.00 48.83 C
ATOM 3428 CG LEU A 657 1.640 -32.794 -34.024 1.00 48.83 C
ATOM 3429 CD1 LEU A 657 1.881 -32.963 -32.543 1.00 48.83 C
ATOM 3430 CD2 LEU A 657 1.742 -31.341 -34.418 1.00 48.83 C
ATOM 3431 N GLU A 658 5.763 -33.985 -33.915 1.00 57.17 N
ATOM 3432 CA GLU A 658 6.798 -33.872 -32.896 1.00 57.17 C
ATOM 3433 C GLU A 658 7.942 -33.009 -33.392 1.00 57.17 C
ATOM 3434 O GLU A 658 8.605 -32.325 -32.606 1.00 57.17 O
ATOM 3435 CB GLU A 658 7.311 -35.252 -32.509 1.00 57.17 C
ATOM 3436 CG GLU A 658 8.263 -35.281 -31.340 1.00 57.17 C
ATOM 3437 CD GLU A 658 8.736 -36.681 -31.038 1.00 57.17 C
ATOM 3438 OE1 GLU A 658 8.361 -37.603 -31.792 1.00 57.17 O
ATOM 3439 OE2 GLU A 658 9.476 -36.863 -30.048 1.00 57.17 O
ATOM 3440 N LEU A 659 8.181 -33.022 -34.700 1.00 47.61 N
ATOM 3441 CA LEU A 659 9.298 -32.271 -35.250 1.00 47.61 C
ATOM 3442 C LEU A 659 9.015 -30.778 -35.218 1.00 47.61 C
ATOM 3443 O LEU A 659 9.937 -29.967 -35.065 1.00 47.61 O
ATOM 3444 CB LEU A 659 9.576 -32.734 -36.671 1.00 47.61 C
ATOM 3445 CG LEU A 659 10.879 -32.247 -37.263 1.00 47.61 C
ATOM 3446 CD1 LEU A 659 12.004 -32.862 -36.492 1.00 47.61 C
ATOM 3447 CD2 LEU A 659 10.935 -32.654 -38.687 1.00 47.61 C
ATOM 3448 N ALA A 660 7.742 -30.397 -35.350 1.00 52.44 N
ATOM 3449 CA ALA A 660 7.391 -28.981 -35.299 1.00 52.44 C
ATOM 3450 C ALA A 660 7.642 -28.386 -33.922 1.00 52.44 C
ATOM 3451 O ALA A 660 8.046 -27.225 -33.810 1.00 52.44 O
ATOM 3452 CB ALA A 660 5.933 -28.785 -35.688 1.00 52.44 C
ATOM 3453 N VAL A 661 7.420 -29.164 -32.866 1.00 52.66 N
ATOM 3454 CA VAL A 661 7.626 -28.648 -31.517 1.00 52.66 C
ATOM 3455 C VAL A 661 9.113 -28.510 -31.219 1.00 52.66 C
ATOM 3456 O VAL A 661 9.551 -27.523 -30.618 1.00 52.66 O
ATOM 3457 CB VAL A 661 6.906 -29.547 -30.497 1.00 52.66 C
ATOM 3458 CG1 VAL A 661 7.223 -29.138 -29.076 1.00 52.66 C
ATOM 3459 CG2 VAL A 661 5.419 -29.476 -30.727 1.00 52.66 C
ATOM 3460 N GLU A 662 9.919 -29.475 -31.667 1.00 60.58 N
ATOM 3461 CA GLU A 662 11.361 -29.378 -31.459 1.00 60.58 C
ATOM 3462 C GLU A 662 11.971 -28.267 -32.296 1.00 60.58 C
ATOM 3463 O GLU A 662 12.973 -27.665 -31.900 1.00 60.58 O
ATOM 3464 CB GLU A 662 12.041 -30.705 -31.774 1.00 60.58 C
ATOM 3465 CG GLU A 662 11.775 -31.797 -30.766 1.00 60.58 C
ATOM 3466 CD GLU A 662 12.497 -33.082 -31.113 1.00 60.58 C
ATOM 3467 OE1 GLU A 662 13.084 -33.153 -32.214 1.00 60.58 O
ATOM 3468 OE2 GLU A 662 12.483 -34.017 -30.284 1.00 60.58 O
ATOM 3469 N ALA A 663 11.383 -27.978 -33.459 1.00 57.71 N
ATOM 3470 CA ALA A 663 11.869 -26.862 -34.263 1.00 57.71 C
ATOM 3471 C ALA A 663 11.529 -25.531 -33.620 1.00 57.71 C
ATOM 3472 O ALA A 663 12.188 -24.522 -33.892 1.00 57.71 O
ATOM 3473 CB ALA A 663 11.286 -26.928 -35.670 1.00 57.71 C
ATOM 3474 N ARG A 664 10.508 -25.526 -32.754 1.00 61.59 N
ATOM 3475 CA ARG A 664 9.969 -24.342 -32.084 1.00 61.59 C
ATOM 3476 C ARG A 664 9.585 -23.275 -33.102 1.00 61.59 C
ATOM 3477 O ARG A 664 9.992 -22.116 -33.008 1.00 61.59 O
ATOM 3478 CB ARG A 664 10.944 -23.806 -31.028 1.00 61.59 C
ATOM 3479 CG ARG A 664 10.360 -22.884 -29.962 1.00 61.59 C
ATOM 3480 CD ARG A 664 11.444 -22.493 -28.993 1.00 61.59 C
ATOM 3481 NE ARG A 664 12.451 -21.653 -29.628 1.00 61.59 N
ATOM 3482 CZ ARG A 664 13.642 -21.392 -29.101 1.00 61.59 C
ATOM 3483 NH1 ARG A 664 13.979 -21.923 -27.933 1.00 61.59 N
ATOM 3484 NH2 ARG A 664 14.499 -20.613 -29.745 1.00 61.59 N
ATOM 3485 N ASP A 665 8.852 -23.678 -34.130 1.00 58.74 N
ATOM 3486 CA ASP A 665 8.389 -22.708 -35.104 1.00 58.74 C
ATOM 3487 C ASP A 665 6.926 -22.358 -34.868 1.00 58.74 C
ATOM 3488 O ASP A 665 6.158 -23.142 -34.308 1.00 58.74 O
ATOM 3489 CB ASP A 665 8.624 -23.214 -36.526 1.00 58.74 C
ATOM 3490 CG ASP A 665 7.956 -24.538 -36.816 1.00 58.74 C
ATOM 3491 OD1 ASP A 665 7.408 -25.183 -35.901 1.00 58.74 O
ATOM 3492 OD2 ASP A 665 7.985 -24.939 -37.994 1.00 58.74 O
ATOM 3493 N GLN A 666 6.552 -21.158 -35.285 1.00 57.42 N
ATOM 3494 CA GLN A 666 5.292 -20.562 -34.888 1.00 57.42 C
ATOM 3495 C GLN A 666 4.183 -20.814 -35.888 1.00 57.42 C
ATOM 3496 O GLN A 666 3.028 -20.984 -35.489 1.00 57.42 O
ATOM 3497 CB GLN A 666 5.462 -19.054 -34.720 1.00 57.42 C
ATOM 3498 CG GLN A 666 6.630 -18.631 -33.870 1.00 57.42 C
ATOM 3499 CD GLN A 666 6.507 -19.080 -32.452 1.00 57.42 C
ATOM 3500 OE1 GLN A 666 5.414 -19.114 -31.897 1.00 57.42 O
ATOM 3501 NE2 GLN A 666 7.633 -19.405 -31.837 1.00 57.42 N
ATOM 3502 N GLN A 667 4.504 -20.862 -37.178 1.00 51.64 N
ATOM 3503 CA GLN A 667 3.499 -20.642 -38.206 1.00 51.64 C
ATOM 3504 C GLN A 667 2.964 -21.964 -38.743 1.00 51.64 C
ATOM 3505 O GLN A 667 2.097 -21.974 -39.613 1.00 51.64 O
ATOM 3506 CB GLN A 667 4.093 -19.778 -39.327 1.00 51.64 C
ATOM 3507 CG GLN A 667 3.103 -19.076 -40.251 1.00 51.64 C
ATOM 3508 CD GLN A 667 3.792 -18.278 -41.322 1.00 51.64 C
ATOM 3509 OE1 GLN A 667 5.016 -18.275 -41.410 1.00 51.64 O
ATOM 3510 NE2 GLN A 667 3.012 -17.592 -42.147 1.00 51.64 N
ATOM 3511 N PHE A 668 3.401 -23.089 -38.191 1.00 43.15 N
ATOM 3512 CA PHE A 668 2.814 -24.351 -38.612 1.00 43.15 C
ATOM 3513 C PHE A 668 1.699 -24.729 -37.659 1.00 43.15 C
ATOM 3514 O PHE A 668 0.706 -25.339 -38.060 1.00 43.15 O
ATOM 3515 CB PHE A 668 3.839 -25.476 -38.647 1.00 43.15 C
ATOM 3516 CG PHE A 668 3.303 -26.755 -39.209 1.00 43.15 C
ATOM 3517 CD1 PHE A 668 3.190 -26.915 -40.569 1.00 43.15 C
ATOM 3518 CD2 PHE A 668 2.906 -27.789 -38.382 1.00 43.15 C
ATOM 3519 CE1 PHE A 668 2.704 -28.077 -41.096 1.00 43.15 C
ATOM 3520 CE2 PHE A 668 2.408 -28.951 -38.912 1.00 43.15 C
ATOM 3521 CZ PHE A 668 2.312 -29.094 -40.266 1.00 43.15 C
ATOM 3522 N ILE A 669 1.865 -24.384 -36.392 1.00 41.62 N
ATOM 3523 CA ILE A 669 0.943 -24.818 -35.356 1.00 41.62 C
ATOM 3524 C ILE A 669 -0.261 -23.886 -35.361 1.00 41.62 C
ATOM 3525 O ILE A 669 -1.341 -24.232 -34.875 1.00 41.62 O
ATOM 3526 CB ILE A 669 1.663 -24.846 -34.000 1.00 41.62 C
ATOM 3527 CG1 ILE A 669 2.949 -25.648 -34.133 1.00 41.62 C
ATOM 3528 CG2 ILE A 669 0.850 -25.530 -32.963 1.00 41.62 C
ATOM 3529 CD1 ILE A 669 2.745 -27.075 -34.556 1.00 41.62 C
ATOM 3530 N ALA A 670 -0.105 -22.718 -35.972 1.00 44.79 N
ATOM 3531 CA ALA A 670 -1.116 -21.675 -35.878 1.00 44.79 C
ATOM 3532 C ALA A 670 -2.373 -21.966 -36.683 1.00 44.79 C
ATOM 3533 O ALA A 670 -3.439 -21.438 -36.357 1.00 44.79 O
ATOM 3534 CB ALA A 670 -0.535 -20.339 -36.334 1.00 44.79 C
ATOM 3535 N GLN A 671 -2.275 -22.773 -37.725 1.00 45.57 N
ATOM 3536 CA GLN A 671 -3.413 -22.979 -38.606 1.00 45.57 C
ATOM 3537 C GLN A 671 -4.458 -23.861 -37.921 1.00 45.57 C
ATOM 3538 O GLN A 671 -4.126 -24.580 -36.973 1.00 45.57 O
ATOM 3539 CB GLN A 671 -2.938 -23.608 -39.911 1.00 45.57 C
ATOM 3540 CG GLN A 671 -2.290 -24.918 -39.727 1.00 45.57 C
ATOM 3541 CD GLN A 671 -1.870 -25.480 -41.032 1.00 45.57 C
ATOM 3542 OE1 GLN A 671 -2.216 -24.954 -42.083 1.00 45.57 O
ATOM 3543 NE2 GLN A 671 -1.068 -26.519 -40.987 1.00 45.57 N
ATOM 3544 N PRO A 672 -5.727 -23.814 -38.342 1.00 43.11 N
ATOM 3545 CA PRO A 672 -6.756 -24.546 -37.589 1.00 43.11 C
ATOM 3546 C PRO A 672 -6.752 -26.049 -37.773 1.00 43.11 C
ATOM 3547 O PRO A 672 -7.503 -26.736 -37.071 1.00 43.11 O
ATOM 3548 CB PRO A 672 -8.057 -23.927 -38.107 1.00 43.11 C
ATOM 3549 CG PRO A 672 -7.678 -22.624 -38.632 1.00 43.11 C
ATOM 3550 CD PRO A 672 -6.347 -22.829 -39.242 1.00 43.11 C
ATOM 3551 N GLY A 673 -5.960 -26.581 -38.703 1.00 44.74 N
ATOM 3552 CA GLY A 673 -5.937 -28.023 -38.902 1.00 44.74 C
ATOM 3553 C GLY A 673 -5.398 -28.771 -37.698 1.00 44.74 C
ATOM 3554 O GLY A 673 -6.076 -29.633 -37.127 1.00 44.74 O
ATOM 3555 N VAL A 674 -4.197 -28.407 -37.255 1.00 46.34 N
ATOM 3556 CA VAL A 674 -3.621 -29.101 -36.114 1.00 46.34 C
ATOM 3557 C VAL A 674 -4.296 -28.661 -34.828 1.00 46.34 C
ATOM 3558 O VAL A 674 -4.272 -29.384 -33.831 1.00 46.34 O
ATOM 3559 CB VAL A 674 -2.103 -28.892 -36.061 1.00 46.34 C
ATOM 3560 CG1 VAL A 674 -1.498 -29.364 -37.340 1.00 46.34 C
ATOM 3561 CG2 VAL A 674 -1.777 -27.452 -35.838 1.00 46.34 C
ATOM 3562 N GLN A 675 -4.953 -27.500 -34.835 1.00 46.00 N
ATOM 3563 CA GLN A 675 -5.733 -27.095 -33.672 1.00 46.00 C
ATOM 3564 C GLN A 675 -6.966 -27.968 -33.508 1.00 46.00 C
ATOM 3565 O GLN A 675 -7.294 -28.390 -32.392 1.00 46.00 O
ATOM 3566 CB GLN A 675 -6.127 -25.631 -33.784 1.00 46.00 C
ATOM 3567 CG GLN A 675 -4.980 -24.710 -33.566 1.00 46.00 C
ATOM 3568 CD GLN A 675 -4.495 -24.778 -32.148 1.00 46.00 C
ATOM 3569 OE1 GLN A 675 -5.287 -24.892 -31.217 1.00 46.00 O
ATOM 3570 NE2 GLN A 675 -3.190 -24.707 -31.968 1.00 46.00 N
ATOM 3571 N ASN A 676 -7.660 -28.250 -34.612 1.00 49.58 N
ATOM 3572 CA ASN A 676 -8.796 -29.160 -34.561 1.00 49.58 C
ATOM 3573 C ASN A 676 -8.343 -30.556 -34.165 1.00 49.58 C
ATOM 3574 O ASN A 676 -9.011 -31.229 -33.367 1.00 49.58 O
ATOM 3575 CB ASN A 676 -9.499 -29.179 -35.914 1.00 49.58 C
ATOM 3576 CG ASN A 676 -10.867 -29.818 -35.859 1.00 49.58 C
ATOM 3577 OD1 ASN A 676 -11.338 -30.236 -34.806 1.00 49.58 O
ATOM 3578 ND2 ASN A 676 -11.516 -29.895 -37.007 1.00 49.58 N
ATOM 3579 N PHE A 677 -7.185 -30.983 -34.683 1.00 45.22 N
ATOM 3580 CA PHE A 677 -6.610 -32.270 -34.301 1.00 45.22 C
ATOM 3581 C PHE A 677 -6.328 -32.353 -32.810 1.00 45.22 C
ATOM 3582 O PHE A 677 -6.732 -33.321 -32.149 1.00 45.22 O
ATOM 3583 CB PHE A 677 -5.326 -32.521 -35.075 1.00 45.22 C
ATOM 3584 CG PHE A 677 -4.575 -33.705 -34.592 1.00 45.22 C
ATOM 3585 CD1 PHE A 677 -5.059 -34.973 -34.817 1.00 45.22 C
ATOM 3586 CD2 PHE A 677 -3.387 -33.554 -33.908 1.00 45.22 C
ATOM 3587 CE1 PHE A 677 -4.374 -36.071 -34.365 1.00 45.22 C
ATOM 3588 CE2 PHE A 677 -2.699 -34.644 -33.458 1.00 45.22 C
ATOM 3589 CZ PHE A 677 -3.192 -35.906 -33.686 1.00 45.22 C
ATOM 3590 N LEU A 678 -5.630 -31.351 -32.275 1.00 49.30 N
ATOM 3591 CA LEU A 678 -5.308 -31.302 -30.857 1.00 49.30 C
ATOM 3592 C LEU A 678 -6.560 -31.309 -30.001 1.00 49.30 C
ATOM 3593 O LEU A 678 -6.662 -32.079 -29.041 1.00 49.30 O
ATOM 3594 CB LEU A 678 -4.502 -30.050 -30.555 1.00 49.30 C
ATOM 3595 CG LEU A 678 -4.213 -29.971 -29.065 1.00 49.30 C
ATOM 3596 CD1 LEU A 678 -3.117 -30.937 -28.687 1.00 49.30 C
ATOM 3597 CD2 LEU A 678 -3.952 -28.556 -28.596 1.00 49.30 C
ATOM 3598 N SER A 679 -7.532 -30.467 -30.345 1.00 51.47 N
ATOM 3599 CA SER A 679 -8.695 -30.309 -29.487 1.00 51.47 C
ATOM 3600 C SER A 679 -9.566 -31.559 -29.493 1.00 51.47 C
ATOM 3601 O SER A 679 -10.102 -31.959 -28.453 1.00 51.47 O
ATOM 3602 CB SER A 679 -9.481 -29.078 -29.917 1.00 51.47 C
ATOM 3603 OG SER A 679 -10.615 -28.899 -29.098 1.00 51.47 O
ATOM 3604 N LYS A 680 -9.663 -32.243 -30.634 1.00 52.99 N
ATOM 3605 CA LYS A 680 -10.469 -33.454 -30.620 1.00 52.99 C
ATOM 3606 C LYS A 680 -9.666 -34.639 -30.108 1.00 52.99 C
ATOM 3607 O LYS A 680 -10.220 -35.719 -29.887 1.00 52.99 O
ATOM 3608 CB LYS A 680 -11.052 -33.748 -31.995 1.00 52.99 C
ATOM 3609 CG LYS A 680 -10.132 -34.387 -32.986 1.00 52.99 C
ATOM 3610 CD LYS A 680 -10.929 -34.626 -34.243 1.00 52.99 C
ATOM 3611 CE LYS A 680 -10.158 -35.418 -35.258 1.00 52.99 C
ATOM 3612 NZ LYS A 680 -10.955 -35.618 -36.495 1.00 52.99 N
ATOM 3613 N GLN A 681 -8.357 -34.468 -29.924 1.00 55.70 N
ATOM 3614 CA GLN A 681 -7.632 -35.431 -29.103 1.00 55.70 C
ATOM 3615 C GLN A 681 -7.829 -35.140 -27.620 1.00 55.70 C
ATOM 3616 O GLN A 681 -7.835 -36.061 -26.797 1.00 55.70 O
ATOM 3617 CB GLN A 681 -6.151 -35.419 -29.470 1.00 55.70 C
ATOM 3618 CG GLN A 681 -5.305 -36.454 -28.758 1.00 55.70 C
ATOM 3619 CD GLN A 681 -3.859 -36.408 -29.192 1.00 55.70 C
ATOM 3620 OE1 GLN A 681 -3.477 -35.596 -30.032 1.00 55.70 O
ATOM 3621 NE2 GLN A 681 -3.041 -37.273 -28.612 1.00 55.70 N
ATOM 3622 N TRP A 682 -8.012 -33.868 -27.268 1.00 57.63 N
ATOM 3623 CA TRP A 682 -8.289 -33.492 -25.884 1.00 57.63 C
ATOM 3624 C TRP A 682 -9.661 -33.972 -25.441 1.00 57.63 C
ATOM 3625 O TRP A 682 -9.857 -34.315 -24.271 1.00 57.63 O
ATOM 3626 CB TRP A 682 -8.182 -31.978 -25.731 1.00 57.63 C
ATOM 3627 CG TRP A 682 -8.653 -31.425 -24.423 1.00 57.63 C
ATOM 3628 CD1 TRP A 682 -9.848 -30.833 -24.186 1.00 57.63 C
ATOM 3629 CD2 TRP A 682 -7.932 -31.373 -23.194 1.00 57.63 C
ATOM 3630 NE1 TRP A 682 -9.930 -30.429 -22.885 1.00 57.63 N
ATOM 3631 CE2 TRP A 682 -8.764 -30.750 -22.251 1.00 57.63 C
ATOM 3632 CE3 TRP A 682 -6.671 -31.800 -22.796 1.00 57.63 C
ATOM 3633 CZ2 TRP A 682 -8.378 -30.542 -20.938 1.00 57.63 C
ATOM 3634 CZ3 TRP A 682 -6.287 -31.592 -21.489 1.00 57.63 C
ATOM 3635 CH2 TRP A 682 -7.138 -30.972 -20.575 1.00 57.63 C
ATOM 3636 N TYR A 683 -10.626 -34.003 -26.358 1.00 58.12 N
ATOM 3637 CA TYR A 683 -11.928 -34.541 -25.992 1.00 58.12 C
ATOM 3638 C TYR A 683 -12.023 -36.041 -26.192 1.00 58.12 C
ATOM 3639 O TYR A 683 -12.838 -36.683 -25.527 1.00 58.12 O
ATOM 3640 CB TYR A 683 -13.038 -33.839 -26.763 1.00 58.12 C
ATOM 3641 CG TYR A 683 -13.491 -32.554 -26.123 1.00 58.12 C
ATOM 3642 CD1 TYR A 683 -13.230 -32.298 -24.789 1.00 58.12 C
ATOM 3643 CD2 TYR A 683 -14.187 -31.603 -26.852 1.00 58.12 C
ATOM 3644 CE1 TYR A 683 -13.651 -31.137 -24.200 1.00 58.12 C
ATOM 3645 CE2 TYR A 683 -14.605 -30.437 -26.272 1.00 58.12 C
ATOM 3646 CZ TYR A 683 -14.331 -30.209 -24.949 1.00 58.12 C
ATOM 3647 OH TYR A 683 -14.753 -29.041 -24.370 1.00 58.12 O
ATOM 3648 N GLY A 684 -11.223 -36.612 -27.080 1.00 64.66 N
ATOM 3649 CA GLY A 684 -11.192 -38.061 -27.188 1.00 64.66 C
ATOM 3650 C GLY A 684 -12.420 -38.593 -27.890 1.00 64.66 C
ATOM 3651 O GLY A 684 -12.923 -38.000 -28.850 1.00 64.66 O
ATOM 3652 N GLU A 685 -12.935 -39.718 -27.395 1.00 69.27 N
ATOM 3653 CA GLU A 685 -14.081 -40.344 -28.042 1.00 69.27 C
ATOM 3654 C GLU A 685 -15.379 -39.623 -27.697 1.00 69.27 C
ATOM 3655 O GLU A 685 -16.414 -39.863 -28.330 1.00 69.27 O
ATOM 3656 CB GLU A 685 -14.161 -41.817 -27.654 1.00 69.27 C
ATOM 3657 N ILE A 686 -15.353 -38.753 -26.682 1.00 66.07 N
ATOM 3658 CA ILE A 686 -16.467 -37.840 -26.470 1.00 66.07 C
ATOM 3659 C ILE A 686 -16.532 -36.871 -27.629 1.00 66.07 C
ATOM 3660 O ILE A 686 -15.549 -36.195 -27.950 1.00 66.07 O
ATOM 3661 CB ILE A 686 -16.320 -37.076 -25.146 1.00 66.07 C
ATOM 3662 CG1 ILE A 686 -16.434 -38.024 -23.968 1.00 66.07 C
ATOM 3663 CG2 ILE A 686 -17.365 -35.997 -25.038 1.00 66.07 C
ATOM 3664 CD1 ILE A 686 -16.132 -37.364 -22.667 1.00 66.07 C
ATOM 3665 N SER A 687 -17.686 -36.814 -28.283 1.00 75.91 N
ATOM 3666 CA SER A 687 -17.846 -35.882 -29.382 1.00 75.91 C
ATOM 3667 C SER A 687 -17.925 -34.465 -28.849 1.00 75.91 C
ATOM 3668 O SER A 687 -18.312 -34.225 -27.704 1.00 75.91 O
ATOM 3669 CB SER A 687 -19.102 -36.189 -30.189 1.00 75.91 C
ATOM 3670 OG SER A 687 -20.256 -35.862 -29.444 1.00 75.91 O
ATOM 3671 N ARG A 688 -17.568 -33.519 -29.704 1.00 69.34 N
ATOM 3672 CA ARG A 688 -17.596 -32.113 -29.357 1.00 69.34 C
ATOM 3673 C ARG A 688 -19.036 -31.607 -29.357 1.00 69.34 C
ATOM 3674 O ARG A 688 -19.993 -32.377 -29.492 1.00 69.34 O
ATOM 3675 CB ARG A 688 -16.726 -31.332 -30.335 1.00 69.34 C
ATOM 3676 CG ARG A 688 -15.293 -31.789 -30.321 1.00 69.34 C
ATOM 3677 CD ARG A 688 -14.474 -31.131 -31.411 1.00 69.34 C
ATOM 3678 NE ARG A 688 -14.383 -29.687 -31.250 1.00 69.34 N
ATOM 3679 CZ ARG A 688 -13.512 -29.089 -30.448 1.00 69.34 C
ATOM 3680 NH1 ARG A 688 -12.687 -29.822 -29.722 1.00 69.34 N
ATOM 3681 NH2 ARG A 688 -13.478 -27.769 -30.356 1.00 69.34 N
ATOM 3682 N ASP A 689 -19.174 -30.289 -29.180 1.00 73.11 N
ATOM 3683 CA ASP A 689 -20.446 -29.568 -29.274 1.00 73.11 C
ATOM 3684 C ASP A 689 -21.447 -30.060 -28.235 1.00 73.11 C
ATOM 3685 O ASP A 689 -22.646 -30.160 -28.495 1.00 73.11 O
ATOM 3686 CB ASP A 689 -21.028 -29.648 -30.685 1.00 73.11 C
ATOM 3687 CG ASP A 689 -20.123 -29.011 -31.701 1.00 73.11 C
ATOM 3688 OD1 ASP A 689 -19.411 -28.066 -31.313 1.00 73.11 O
ATOM 3689 OD2 ASP A 689 -20.098 -29.459 -32.866 1.00 73.11 O
ATOM 3690 N THR A 690 -20.942 -30.400 -27.057 1.00 82.55 N
ATOM 3691 CA THR A 690 -21.765 -30.634 -25.884 1.00 82.55 C
ATOM 3692 C THR A 690 -21.359 -29.636 -24.816 1.00 82.55 C
ATOM 3693 O THR A 690 -20.226 -29.149 -24.809 1.00 82.55 O
ATOM 3694 CB THR A 690 -21.620 -32.055 -25.346 1.00 82.55 C
ATOM 3695 OG1 THR A 690 -20.259 -32.289 -24.976 1.00 82.55 O
ATOM 3696 CG2 THR A 690 -22.030 -33.059 -26.393 1.00 82.55 C
ATOM 3697 N LYS A 691 -22.289 -29.323 -23.927 1.00 92.80 N
ATOM 3698 CA LYS A 691 -22.019 -28.334 -22.898 1.00 92.80 C
ATOM 3699 C LYS A 691 -21.114 -28.919 -21.824 1.00 92.80 C
ATOM 3700 O LYS A 691 -21.038 -30.136 -21.645 1.00 92.80 O
ATOM 3701 CB LYS A 691 -23.321 -27.851 -22.274 1.00 92.80 C
ATOM 3702 CG LYS A 691 -24.137 -26.914 -23.143 1.00 92.80 C
ATOM 3703 CD LYS A 691 -25.146 -27.671 -23.985 1.00 92.80 C
ATOM 3704 CE LYS A 691 -26.095 -26.724 -24.681 1.00 92.80 C
ATOM 3705 NZ LYS A 691 -25.402 -25.883 -25.697 1.00 92.80 N
ATOM 3706 N ASN A 692 -20.422 -28.038 -21.105 1.00101.48 N
ATOM 3707 CA ASN A 692 -19.462 -28.500 -20.113 1.00101.48 C
ATOM 3708 C ASN A 692 -20.157 -28.923 -18.826 1.00101.48 C
ATOM 3709 O ASN A 692 -19.741 -29.893 -18.176 1.00101.48 O
ATOM 3710 CB ASN A 692 -18.431 -27.410 -19.850 1.00101.48 C
ATOM 3711 CG ASN A 692 -17.610 -27.096 -21.079 1.00101.48 C
ATOM 3712 OD1 ASN A 692 -17.262 -27.989 -21.846 1.00101.48 O
ATOM 3713 ND2 ASN A 692 -17.297 -25.823 -21.274 1.00101.48 N
ATOM 3714 N TRP A 693 -21.230 -28.216 -18.450 1.00104.30 N
ATOM 3715 CA TRP A 693 -21.999 -28.605 -17.270 1.00104.30 C
ATOM 3716 C TRP A 693 -22.668 -29.951 -17.477 1.00104.30 C
ATOM 3717 O TRP A 693 -22.871 -30.707 -16.522 1.00104.30 O
ATOM 3718 CB TRP A 693 -23.047 -27.544 -16.936 1.00104.30 C
ATOM 3719 CG TRP A 693 -24.054 -27.315 -18.023 1.00104.30 C
ATOM 3720 CD1 TRP A 693 -23.980 -26.389 -19.017 1.00104.30 C
ATOM 3721 CD2 TRP A 693 -25.281 -28.027 -18.232 1.00104.30 C
ATOM 3722 NE1 TRP A 693 -25.086 -26.469 -19.824 1.00104.30 N
ATOM 3723 CE2 TRP A 693 -25.895 -27.474 -19.369 1.00104.30 C
ATOM 3724 CE3 TRP A 693 -25.918 -29.077 -17.568 1.00104.30 C
ATOM 3725 CZ2 TRP A 693 -27.113 -27.936 -19.856 1.00104.30 C
ATOM 3726 CZ3 TRP A 693 -27.123 -29.534 -18.054 1.00104.30 C
ATOM 3727 CH2 TRP A 693 -27.709 -28.964 -19.185 1.00104.30 C
ATOM 3728 N LYS A 694 -23.013 -30.264 -18.725 1.00105.65 N
ATOM 3729 CA LYS A 694 -23.598 -31.555 -19.046 1.00105.65 C
ATOM 3730 C LYS A 694 -22.604 -32.682 -18.808 1.00105.65 C
ATOM 3731 O LYS A 694 -22.959 -33.730 -18.258 1.00105.65 O
ATOM 3732 CB LYS A 694 -24.074 -31.536 -20.493 1.00105.65 C
ATOM 3733 CG LYS A 694 -24.817 -32.754 -20.925 1.00105.65 C
ATOM 3734 CD LYS A 694 -25.292 -32.608 -22.360 1.00105.65 C
ATOM 3735 CE LYS A 694 -26.443 -31.619 -22.463 1.00105.65 C
ATOM 3736 NZ LYS A 694 -26.995 -31.538 -23.844 1.00105.65 N
ATOM 3737 N ILE A 695 -21.338 -32.462 -19.165 1.00101.83 N
ATOM 3738 CA ILE A 695 -20.318 -33.480 -18.939 1.00101.83 C
ATOM 3739 C ILE A 695 -19.992 -33.583 -17.455 1.00101.83 C
ATOM 3740 O ILE A 695 -19.689 -34.667 -16.949 1.00101.83 O
ATOM 3741 CB ILE A 695 -19.071 -33.178 -19.787 1.00101.83 C
ATOM 3742 CG1 ILE A 695 -19.460 -33.080 -21.252 1.00101.83 C
ATOM 3743 CG2 ILE A 695 -18.059 -34.285 -19.686 1.00101.83 C
ATOM 3744 CD1 ILE A 695 -18.365 -32.541 -22.120 1.00101.83 C
ATOM 3745 N ILE A 696 -20.115 -32.478 -16.717 1.00105.49 N
ATOM 3746 CA ILE A 696 -19.884 -32.548 -15.273 1.00105.49 C
ATOM 3747 C ILE A 696 -21.015 -33.307 -14.572 1.00105.49 C
ATOM 3748 O ILE A 696 -20.774 -34.122 -13.667 1.00105.49 O
ATOM 3749 CB ILE A 696 -19.682 -31.132 -14.704 1.00105.49 C
ATOM 3750 CG1 ILE A 696 -18.397 -30.535 -15.272 1.00105.49 C
ATOM 3751 CG2 ILE A 696 -19.601 -31.147 -13.190 1.00105.49 C
ATOM 3752 CD1 ILE A 696 -18.234 -29.065 -15.003 1.00105.49 C
ATOM 3753 N LEU A 697 -22.261 -33.090 -15.002 1.00113.14 N
ATOM 3754 CA LEU A 697 -23.369 -33.852 -14.431 1.00113.14 C
ATOM 3755 C LEU A 697 -23.298 -35.321 -14.826 1.00113.14 C
ATOM 3756 O LEU A 697 -23.682 -36.196 -14.044 1.00113.14 O
ATOM 3757 CB LEU A 697 -24.710 -33.258 -14.847 1.00113.14 C
ATOM 3758 CG LEU A 697 -25.034 -31.908 -14.218 1.00113.14 C
ATOM 3759 CD1 LEU A 697 -26.366 -31.391 -14.721 1.00113.14 C
ATOM 3760 CD2 LEU A 697 -25.033 -32.026 -12.708 1.00113.14 C
ATOM 3761 N CYS A 698 -22.790 -35.616 -16.022 1.00117.15 N
ATOM 3762 CA CYS A 698 -22.581 -37.011 -16.389 1.00117.15 C
ATOM 3763 C CYS A 698 -21.365 -37.591 -15.678 1.00117.15 C
ATOM 3764 O CYS A 698 -21.198 -38.813 -15.611 1.00117.15 O
ATOM 3765 CB CYS A 698 -22.451 -37.137 -17.902 1.00117.15 C
ATOM 3766 SG CYS A 698 -23.987 -36.764 -18.773 1.00117.15 S
ATOM 3767 N LEU A 699 -20.486 -36.731 -15.168 1.00108.79 N
ATOM 3768 CA LEU A 699 -19.417 -37.203 -14.299 1.00108.79 C
ATOM 3769 C LEU A 699 -19.958 -37.583 -12.930 1.00108.79 C
ATOM 3770 O LEU A 699 -19.479 -38.537 -12.305 1.00108.79 O
ATOM 3771 CB LEU A 699 -18.329 -36.139 -14.183 1.00108.79 C
ATOM 3772 CG LEU A 699 -17.182 -36.417 -13.221 1.00108.79 C
ATOM 3773 CD1 LEU A 699 -16.460 -37.685 -13.615 1.00108.79 C
ATOM 3774 CD2 LEU A 699 -16.238 -35.238 -13.193 1.00108.79 C
ATOM 3775 N PHE A 700 -20.963 -36.857 -12.443 1.00121.67 N
ATOM 3776 CA PHE A 700 -21.600 -37.285 -11.200 1.00121.67 C
ATOM 3777 C PHE A 700 -22.447 -38.541 -11.397 1.00121.67 C
ATOM 3778 O PHE A 700 -22.453 -39.431 -10.540 1.00121.67 O
ATOM 3779 CB PHE A 700 -22.452 -36.163 -10.612 1.00121.67 C
ATOM 3780 CG PHE A 700 -21.657 -35.086 -9.941 1.00121.67 C
ATOM 3781 CD1 PHE A 700 -21.137 -35.289 -8.674 1.00121.67 C
ATOM 3782 CD2 PHE A 700 -21.452 -33.865 -10.559 1.00121.67 C
ATOM 3783 CE1 PHE A 700 -20.410 -34.299 -8.043 1.00121.67 C
ATOM 3784 CE2 PHE A 700 -20.724 -32.869 -9.934 1.00121.67 C
ATOM 3785 CZ PHE A 700 -20.205 -33.086 -8.674 1.00121.67 C
ATOM 3786 N PHE A 701 -23.155 -38.642 -12.519 1.00122.87 N
ATOM 3787 CA PHE A 701 -24.198 -39.649 -12.697 1.00122.87 C
ATOM 3788 C PHE A 701 -23.788 -40.681 -13.739 1.00122.87 C
ATOM 3789 O PHE A 701 -23.514 -40.335 -14.891 1.00122.87 O
ATOM 3790 CB PHE A 701 -25.519 -38.995 -13.099 1.00122.87 C
ATOM 3791 CG PHE A 701 -26.188 -38.248 -11.988 1.00122.87 C
ATOM 3792 CD1 PHE A 701 -25.832 -38.471 -10.668 1.00122.87 C
ATOM 3793 CD2 PHE A 701 -27.177 -37.320 -12.264 1.00122.87 C
ATOM 3794 CE1 PHE A 701 -26.449 -37.782 -9.645 1.00122.87 C
ATOM 3795 CE2 PHE A 701 -27.801 -36.627 -11.247 1.00122.87 C
ATOM 3796 CZ PHE A 701 -27.437 -36.858 -9.935 1.00122.87 C
ATOM 3797 N PHE A 702 -23.774 -41.945 -13.332 1.00124.13 N
ATOM 3798 CA PHE A 702 -23.506 -43.028 -14.272 1.00124.13 C
ATOM 3799 C PHE A 702 -24.572 -43.272 -15.349 1.00124.13 C
ATOM 3800 O PHE A 702 -24.173 -43.363 -16.523 1.00124.13 O
ATOM 3801 CB PHE A 702 -23.234 -44.314 -13.481 1.00124.13 C
ATOM 3802 CG PHE A 702 -21.961 -44.270 -12.699 1.00124.13 C
ATOM 3803 CD1 PHE A 702 -20.749 -44.519 -13.322 1.00124.13 C
ATOM 3804 CD2 PHE A 702 -21.971 -43.962 -11.350 1.00124.13 C
ATOM 3805 CE1 PHE A 702 -19.570 -44.476 -12.612 1.00124.13 C
ATOM 3806 CE2 PHE A 702 -20.796 -43.915 -10.631 1.00124.13 C
ATOM 3807 CZ PHE A 702 -19.592 -44.173 -11.264 1.00124.13 C
ATOM 3808 N PRO A 703 -25.887 -43.406 -15.067 1.00124.41 N
ATOM 3809 CA PRO A 703 -26.777 -43.928 -16.125 1.00124.41 C
ATOM 3810 C PRO A 703 -27.108 -42.935 -17.232 1.00124.41 C
ATOM 3811 O PRO A 703 -27.773 -43.306 -18.210 1.00124.41 O
ATOM 3812 CB PRO A 703 -28.033 -44.336 -15.350 1.00124.41 C
ATOM 3813 CG PRO A 703 -28.075 -43.411 -14.234 1.00124.41 C
ATOM 3814 CD PRO A 703 -26.660 -43.186 -13.825 1.00124.41 C
ATOM 3815 N LEU A 704 -26.657 -41.684 -17.115 1.00121.79 N
ATOM 3816 CA LEU A 704 -26.793 -40.745 -18.223 1.00121.79 C
ATOM 3817 C LEU A 704 -25.925 -41.160 -19.406 1.00121.79 C
ATOM 3818 O LEU A 704 -26.204 -40.792 -20.552 1.00121.79 O
ATOM 3819 CB LEU A 704 -26.425 -39.339 -17.761 1.00121.79 C
ATOM 3820 CG LEU A 704 -27.295 -38.740 -16.660 1.00121.79 C
ATOM 3821 CD1 LEU A 704 -26.773 -37.374 -16.262 1.00121.79 C
ATOM 3822 CD2 LEU A 704 -28.734 -38.655 -17.115 1.00121.79 C
ATOM 3823 N ILE A 705 -24.857 -41.913 -19.139 1.00119.25 N
ATOM 3824 CA ILE A 705 -24.032 -42.479 -20.200 1.00119.25 C
ATOM 3825 C ILE A 705 -24.813 -43.522 -20.987 1.00119.25 C
ATOM 3826 O ILE A 705 -24.818 -43.514 -22.223 1.00119.25 O
ATOM 3827 CB ILE A 705 -22.752 -43.068 -19.589 1.00119.25 C
ATOM 3828 CG1 ILE A 705 -21.967 -41.957 -18.893 1.00119.25 C
ATOM 3829 CG2 ILE A 705 -21.923 -43.771 -20.647 1.00119.25 C
ATOM 3830 CD1 ILE A 705 -20.873 -42.450 -17.988 1.00119.25 C
ATOM 3831 N GLY A 706 -25.501 -44.424 -20.282 1.00121.34 N
ATOM 3832 CA GLY A 706 -26.283 -45.444 -20.965 1.00121.34 C
ATOM 3833 C GLY A 706 -27.590 -44.912 -21.521 1.00121.34 C
ATOM 3834 O GLY A 706 -28.259 -45.585 -22.310 1.00121.34 O
ATOM 3835 N CYS A 707 -27.980 -43.705 -21.102 1.00122.28 N
ATOM 3836 CA CYS A 707 -29.166 -43.060 -21.659 1.00122.28 C
ATOM 3837 C CYS A 707 -28.979 -42.710 -23.131 1.00122.28 C
ATOM 3838 O CYS A 707 -29.950 -42.663 -23.895 1.00122.28 O
ATOM 3839 CB CYS A 707 -29.487 -41.802 -20.850 1.00122.28 C
ATOM 3840 SG CYS A 707 -30.937 -40.866 -21.394 1.00122.28 S
ATOM 3841 N GLY A 708 -27.738 -42.490 -23.555 1.00119.06 N
ATOM 3842 CA GLY A 708 -27.499 -41.875 -24.842 1.00119.06 C
ATOM 3843 C GLY A 708 -27.558 -40.371 -24.794 1.00119.06 C
ATOM 3844 O GLY A 708 -27.965 -39.740 -25.773 1.00119.06 O
ATOM 3845 N PHE A 709 -27.169 -39.777 -23.665 1.00112.48 N
ATOM 3846 CA PHE A 709 -27.432 -38.364 -23.430 1.00112.48 C
ATOM 3847 C PHE A 709 -26.321 -37.489 -23.996 1.00112.48 C
ATOM 3848 O PHE A 709 -26.555 -36.328 -24.349 1.00112.48 O
ATOM 3849 CB PHE A 709 -27.618 -38.138 -21.935 1.00112.48 C
ATOM 3850 CG PHE A 709 -28.053 -36.764 -21.580 1.00112.48 C
ATOM 3851 CD1 PHE A 709 -29.296 -36.305 -21.968 1.00112.48 C
ATOM 3852 CD2 PHE A 709 -27.258 -35.957 -20.792 1.00112.48 C
ATOM 3853 CE1 PHE A 709 -29.718 -35.040 -21.623 1.00112.48 C
ATOM 3854 CE2 PHE A 709 -27.683 -34.699 -20.431 1.00112.48 C
ATOM 3855 CZ PHE A 709 -28.908 -34.236 -20.852 1.00112.48 C
ATOM 3856 N ILE A 710 -25.107 -38.022 -24.076 1.00102.50 N
ATOM 3857 CA ILE A 710 -24.014 -37.355 -24.775 1.00102.50 C
ATOM 3858 C ILE A 710 -23.831 -38.034 -26.124 1.00102.50 C
ATOM 3859 O ILE A 710 -23.889 -39.263 -26.217 1.00102.50 O
ATOM 3860 CB ILE A 710 -22.720 -37.423 -23.953 1.00102.50 C
ATOM 3861 CG1 ILE A 710 -22.941 -36.885 -22.549 1.00102.50 C
ATOM 3862 CG2 ILE A 710 -21.644 -36.585 -24.594 1.00102.50 C
ATOM 3863 CD1 ILE A 710 -21.774 -37.155 -21.643 1.00102.50 C
ATOM 3864 N SER A 711 -23.610 -37.251 -27.174 1.00 93.18 N
ATOM 3865 CA SER A 711 -23.312 -37.841 -28.468 1.00 93.18 C
ATOM 3866 C SER A 711 -21.891 -38.393 -28.487 1.00 93.18 C
ATOM 3867 O SER A 711 -21.090 -38.135 -27.588 1.00 93.18 O
ATOM 3868 CB SER A 711 -23.494 -36.819 -29.589 1.00 93.18 C
ATOM 3869 OG SER A 711 -22.531 -35.789 -29.498 1.00 93.18 O
ATOM 3870 N PHE A 712 -21.589 -39.173 -29.520 1.00 89.93 N
ATOM 3871 CA PHE A 712 -20.304 -39.844 -29.641 1.00 89.93 C
ATOM 3872 C PHE A 712 -19.899 -39.965 -31.101 1.00 89.93 C
ATOM 3873 O PHE A 712 -20.563 -39.440 -31.998 1.00 89.93 O
ATOM 3874 CB PHE A 712 -20.336 -41.240 -29.025 1.00 89.93 C
ATOM 3875 CG PHE A 712 -20.361 -41.244 -27.536 1.00 89.93 C
ATOM 3876 CD1 PHE A 712 -19.190 -41.113 -26.818 1.00 89.93 C
ATOM 3877 CD2 PHE A 712 -21.550 -41.388 -26.849 1.00 89.93 C
ATOM 3878 CE1 PHE A 712 -19.203 -41.124 -25.437 1.00 89.93 C
ATOM 3879 CE2 PHE A 712 -21.571 -41.394 -25.467 1.00 89.93 C
ATOM 3880 CZ PHE A 712 -20.396 -41.262 -24.762 1.00 89.93 C
ATOM 3881 N ARG A 713 -18.786 -40.657 -31.321 1.00 85.66 N
ATOM 3882 CA ARG A 713 -18.376 -41.026 -32.666 1.00 85.66 C
ATOM 3883 C ARG A 713 -18.805 -42.455 -32.972 1.00 85.66 C
ATOM 3884 O ARG A 713 -18.566 -43.374 -32.183 1.00 85.66 O
ATOM 3885 CB ARG A 713 -16.866 -40.903 -32.802 1.00 85.66 C
ATOM 3886 CG ARG A 713 -16.349 -39.499 -32.631 1.00 85.66 C
ATOM 3887 CD ARG A 713 -14.845 -39.515 -32.671 1.00 85.66 C
ATOM 3888 NE ARG A 713 -14.263 -38.204 -32.426 1.00 85.66 N
ATOM 3889 CZ ARG A 713 -12.958 -37.991 -32.309 1.00 85.66 C
ATOM 3890 NH1 ARG A 713 -12.110 -39.004 -32.412 1.00 85.66 N
ATOM 3891 NH2 ARG A 713 -12.499 -36.771 -32.084 1.00 85.66 N
ATOM 3892 N LYS A 714 -19.431 -42.645 -34.127 1.00 95.91 N
ATOM 3893 CA LYS A 714 -19.904 -43.967 -34.529 1.00 95.91 C
ATOM 3894 C LYS A 714 -18.748 -44.872 -34.943 1.00 95.91 C
ATOM 3895 O LYS A 714 -17.705 -44.397 -35.390 1.00 95.91 O
ATOM 3896 CB LYS A 714 -20.912 -43.850 -35.675 1.00 95.91 C
ATOM 3897 N LYS A 721 -22.201 -55.451 -26.742 1.00128.01 N
ATOM 3898 CA LYS A 721 -21.476 -54.783 -25.670 1.00128.01 C
ATOM 3899 C LYS A 721 -21.040 -53.389 -26.106 1.00128.01 C
ATOM 3900 O LYS A 721 -19.850 -53.113 -26.247 1.00128.01 O
ATOM 3901 CB LYS A 721 -20.263 -55.611 -25.245 1.00128.01 C
ATOM 3902 N LYS A 722 -22.019 -52.514 -26.333 1.00127.27 N
ATOM 3903 CA LYS A 722 -21.705 -51.157 -26.760 1.00127.27 C
ATOM 3904 C LYS A 722 -21.523 -50.227 -25.569 1.00127.27 C
ATOM 3905 O LYS A 722 -20.690 -49.313 -25.605 1.00127.27 O
ATOM 3906 CB LYS A 722 -22.800 -50.632 -27.685 1.00127.27 C
ATOM 3907 N LEU A 723 -22.302 -50.438 -24.504 1.00124.20 N
ATOM 3908 CA LEU A 723 -22.300 -49.492 -23.391 1.00124.20 C
ATOM 3909 C LEU A 723 -21.036 -49.617 -22.548 1.00124.20 C
ATOM 3910 O LEU A 723 -20.583 -48.634 -21.951 1.00124.20 O
ATOM 3911 CB LEU A 723 -23.564 -49.674 -22.549 1.00124.20 C
ATOM 3912 CG LEU A 723 -23.916 -51.020 -21.910 1.00124.20 C
ATOM 3913 CD1 LEU A 723 -23.360 -51.175 -20.495 1.00124.20 C
ATOM 3914 CD2 LEU A 723 -25.426 -51.213 -21.927 1.00124.20 C
ATOM 3915 N PHE A 724 -20.443 -50.811 -22.494 1.00125.75 N
ATOM 3916 CA PHE A 724 -19.158 -50.951 -21.816 1.00125.75 C
ATOM 3917 C PHE A 724 -18.060 -50.218 -22.578 1.00125.75 C
ATOM 3918 O PHE A 724 -17.182 -49.589 -21.970 1.00125.75 O
ATOM 3919 CB PHE A 724 -18.802 -52.426 -21.652 1.00125.75 C
ATOM 3920 CG PHE A 724 -17.558 -52.655 -20.851 1.00125.75 C
ATOM 3921 CD1 PHE A 724 -17.580 -52.526 -19.470 1.00125.75 C
ATOM 3922 CD2 PHE A 724 -16.365 -52.990 -21.473 1.00125.75 C
ATOM 3923 CE1 PHE A 724 -16.438 -52.733 -18.721 1.00125.75 C
ATOM 3924 CE2 PHE A 724 -15.215 -53.196 -20.731 1.00125.75 C
ATOM 3925 CZ PHE A 724 -15.253 -53.067 -19.351 1.00125.75 C
ATOM 3926 N LEU A 725 -18.110 -50.277 -23.914 1.00124.44 N
ATOM 3927 CA LEU A 725 -17.229 -49.459 -24.741 1.00124.44 C
ATOM 3928 C LEU A 725 -17.476 -47.978 -24.507 1.00124.44 C
ATOM 3929 O LEU A 725 -16.535 -47.177 -24.521 1.00124.44 O
ATOM 3930 CB LEU A 725 -17.432 -49.798 -26.214 1.00124.44 C
ATOM 3931 CG LEU A 725 -16.998 -51.198 -26.624 1.00124.44 C
ATOM 3932 CD1 LEU A 725 -17.420 -51.476 -28.053 1.00124.44 C
ATOM 3933 CD2 LEU A 725 -15.494 -51.332 -26.467 1.00124.44 C
ATOM 3934 N TYR A 726 -18.737 -47.604 -24.265 1.00118.70 N
ATOM 3935 CA TYR A 726 -19.055 -46.215 -23.950 1.00118.70 C
ATOM 3936 C TYR A 726 -18.426 -45.782 -22.632 1.00118.70 C
ATOM 3937 O TYR A 726 -17.861 -44.690 -22.548 1.00118.70 O
ATOM 3938 CB TYR A 726 -20.568 -46.006 -23.902 1.00118.70 C
ATOM 3939 CG TYR A 726 -21.277 -46.076 -25.237 1.00118.70 C
ATOM 3940 CD1 TYR A 726 -20.570 -46.039 -26.433 1.00118.70 C
ATOM 3941 CD2 TYR A 726 -22.663 -46.160 -25.296 1.00118.70 C
ATOM 3942 CE1 TYR A 726 -21.226 -46.102 -27.649 1.00118.70 C
ATOM 3943 CE2 TYR A 726 -23.326 -46.218 -26.504 1.00118.70 C
ATOM 3944 CZ TYR A 726 -22.603 -46.189 -27.677 1.00118.70 C
ATOM 3945 OH TYR A 726 -23.260 -46.247 -28.885 1.00118.70 O
ATOM 3946 N TYR A 727 -18.492 -46.635 -21.601 1.00111.76 N
ATOM 3947 CA TYR A 727 -17.882 -46.294 -20.312 1.00111.76 C
ATOM 3948 C TYR A 727 -16.363 -46.192 -20.408 1.00111.76 C
ATOM 3949 O TYR A 727 -15.760 -45.272 -19.834 1.00111.76 O
ATOM 3950 CB TYR A 727 -18.249 -47.309 -19.232 1.00111.76 C
ATOM 3951 CG TYR A 727 -19.646 -47.193 -18.678 1.00111.76 C
ATOM 3952 CD1 TYR A 727 -20.010 -46.110 -17.893 1.00111.76 C
ATOM 3953 CD2 TYR A 727 -20.571 -48.210 -18.856 1.00111.76 C
ATOM 3954 CE1 TYR A 727 -21.283 -46.010 -17.362 1.00111.76 C
ATOM 3955 CE2 TYR A 727 -21.842 -48.122 -18.327 1.00111.76 C
ATOM 3956 CZ TYR A 727 -22.191 -47.021 -17.580 1.00111.76 C
ATOM 3957 OH TYR A 727 -23.456 -46.934 -17.050 1.00111.76 O
ATOM 3958 N VAL A 728 -15.728 -47.126 -21.126 1.00104.34 N
ATOM 3959 CA VAL A 728 -14.270 -47.097 -21.249 1.00104.34 C
ATOM 3960 C VAL A 728 -13.823 -45.883 -22.054 1.00104.34 C
ATOM 3961 O VAL A 728 -12.903 -45.156 -21.651 1.00104.34 O
ATOM 3962 CB VAL A 728 -13.758 -48.408 -21.867 1.00104.34 C
ATOM 3963 CG1 VAL A 728 -12.270 -48.322 -22.129 1.00104.34 C
ATOM 3964 CG2 VAL A 728 -14.039 -49.558 -20.934 1.00104.34 C
ATOM 3965 N SER A 729 -14.498 -45.613 -23.173 1.00100.79 N
ATOM 3966 CA SER A 729 -14.174 -44.446 -23.984 1.00100.79 C
ATOM 3967 C SER A 729 -14.494 -43.148 -23.252 1.00100.79 C
ATOM 3968 O SER A 729 -13.883 -42.109 -23.520 1.00100.79 O
ATOM 3969 CB SER A 729 -14.935 -44.521 -25.303 1.00100.79 C
ATOM 3970 OG SER A 729 -16.331 -44.458 -25.075 1.00100.79 O
ATOM 3971 N PHE A 730 -15.446 -43.191 -22.322 1.00 92.15 N
ATOM 3972 CA PHE A 730 -15.750 -42.022 -21.514 1.00 92.15 C
ATOM 3973 C PHE A 730 -14.625 -41.723 -20.539 1.00 92.15 C
ATOM 3974 O PHE A 730 -14.160 -40.584 -20.444 1.00 92.15 O
ATOM 3975 CB PHE A 730 -17.060 -42.244 -20.768 1.00 92.15 C
ATOM 3976 CG PHE A 730 -17.486 -41.082 -19.932 1.00 92.15 C
ATOM 3977 CD1 PHE A 730 -18.040 -39.964 -20.520 1.00 92.15 C
ATOM 3978 CD2 PHE A 730 -17.350 -41.115 -18.558 1.00 92.15 C
ATOM 3979 CE1 PHE A 730 -18.441 -38.894 -19.753 1.00 92.15 C
ATOM 3980 CE2 PHE A 730 -17.750 -40.048 -17.786 1.00 92.15 C
ATOM 3981 CZ PHE A 730 -18.296 -38.937 -18.385 1.00 92.15 C
ATOM 3982 N PHE A 731 -14.167 -42.733 -19.803 1.00 89.44 N
ATOM 3983 CA PHE A 731 -13.167 -42.453 -18.776 1.00 89.44 C
ATOM 3984 C PHE A 731 -11.758 -42.374 -19.346 1.00 89.44 C
ATOM 3985 O PHE A 731 -10.819 -42.020 -18.627 1.00 89.44 O
ATOM 3986 CB PHE A 731 -13.231 -43.487 -17.662 1.00 89.44 C
ATOM 3987 CG PHE A 731 -14.374 -43.286 -16.732 1.00 89.44 C
ATOM 3988 CD1 PHE A 731 -14.298 -42.335 -15.731 1.00 89.44 C
ATOM 3989 CD2 PHE A 731 -15.527 -44.036 -16.853 1.00 89.44 C
ATOM 3990 CE1 PHE A 731 -15.352 -42.139 -14.861 1.00 89.44 C
ATOM 3991 CE2 PHE A 731 -16.587 -43.846 -15.988 1.00 89.44 C
ATOM 3992 CZ PHE A 731 -16.498 -42.896 -14.990 1.00 89.44 C
ATOM 3993 N THR A 732 -11.573 -42.712 -20.622 1.00 86.74 N
ATOM 3994 CA THR A 732 -10.247 -42.510 -21.197 1.00 86.74 C
ATOM 3995 C THR A 732 -10.088 -41.130 -21.813 1.00 86.74 C
ATOM 3996 O THR A 732 -8.984 -40.763 -22.222 1.00 86.74 O
ATOM 3997 CB THR A 732 -9.931 -43.580 -22.232 1.00 86.74 C
ATOM 3998 OG1 THR A 732 -11.014 -43.680 -23.164 1.00 86.74 O
ATOM 3999 CG2 THR A 732 -9.662 -44.913 -21.558 1.00 86.74 C
ATOM 4000 N SER A 733 -11.159 -40.362 -21.908 1.00 76.20 N
ATOM 4001 CA SER A 733 -11.028 -38.997 -22.393 1.00 76.20 C
ATOM 4002 C SER A 733 -10.388 -38.132 -21.318 1.00 76.20 C
ATOM 4003 O SER A 733 -10.880 -38.103 -20.185 1.00 76.20 O
ATOM 4004 CB SER A 733 -12.383 -38.422 -22.778 1.00 76.20 C
ATOM 4005 OG SER A 733 -12.236 -37.084 -23.216 1.00 76.20 O
ATOM 4006 N PRO A 734 -9.322 -37.400 -21.632 1.00 68.56 N
ATOM 4007 CA PRO A 734 -8.526 -36.782 -20.562 1.00 68.56 C
ATOM 4008 C PRO A 734 -9.186 -35.587 -19.897 1.00 68.56 C
ATOM 4009 O PRO A 734 -8.759 -35.190 -18.806 1.00 68.56 O
ATOM 4010 CB PRO A 734 -7.237 -36.394 -21.286 1.00 68.56 C
ATOM 4011 CG PRO A 734 -7.651 -36.185 -22.677 1.00 68.56 C
ATOM 4012 CD PRO A 734 -8.735 -37.169 -22.957 1.00 68.56 C
ATOM 4013 N PHE A 735 -10.212 -35.002 -20.521 1.00 70.32 N
ATOM 4014 CA PHE A 735 -10.918 -33.877 -19.910 1.00 70.32 C
ATOM 4015 C PHE A 735 -11.653 -34.300 -18.651 1.00 70.32 C
ATOM 4016 O PHE A 735 -11.597 -33.613 -17.619 1.00 70.32 O
ATOM 4017 CB PHE A 735 -11.893 -33.281 -20.916 1.00 70.32 C
ATOM 4018 CG PHE A 735 -12.745 -32.195 -20.356 1.00 70.32 C
ATOM 4019 CD1 PHE A 735 -12.201 -30.965 -20.053 1.00 70.32 C
ATOM 4020 CD2 PHE A 735 -14.096 -32.394 -20.162 1.00 70.32 C
ATOM 4021 CE1 PHE A 735 -12.987 -29.955 -19.546 1.00 70.32 C
ATOM 4022 CE2 PHE A 735 -14.886 -31.390 -19.660 1.00 70.32 C
ATOM 4023 CZ PHE A 735 -14.330 -30.169 -19.349 1.00 70.32 C
ATOM 4024 N VAL A 736 -12.332 -35.444 -18.720 1.00 70.22 N
ATOM 4025 CA VAL A 736 -13.036 -35.989 -17.568 1.00 70.22 C
ATOM 4026 C VAL A 736 -12.043 -36.373 -16.485 1.00 70.22 C
ATOM 4027 O VAL A 736 -12.305 -36.209 -15.287 1.00 70.22 O
ATOM 4028 CB VAL A 736 -13.882 -37.190 -18.017 1.00 70.22 C
ATOM 4029 CG1 VAL A 736 -14.728 -37.708 -16.887 1.00 70.22 C
ATOM 4030 CG2 VAL A 736 -14.719 -36.808 -19.207 1.00 70.22 C
ATOM 4031 N VAL A 737 -10.862 -36.827 -16.900 1.00 70.02 N
ATOM 4032 CA VAL A 737 -9.817 -37.202 -15.961 1.00 70.02 C
ATOM 4033 C VAL A 737 -9.302 -35.980 -15.223 1.00 70.02 C
ATOM 4034 O VAL A 737 -9.112 -36.015 -14.005 1.00 70.02 O
ATOM 4035 CB VAL A 737 -8.690 -37.923 -16.710 1.00 70.02 C
ATOM 4036 CG1 VAL A 737 -7.603 -38.352 -15.755 1.00 70.02 C
ATOM 4037 CG2 VAL A 737 -9.260 -39.093 -17.459 1.00 70.02 C
ATOM 4038 N PHE A 738 -9.013 -34.924 -15.974 1.00 71.63 N
ATOM 4039 CA PHE A 738 -8.507 -33.702 -15.374 1.00 71.63 C
ATOM 4040 C PHE A 738 -9.543 -33.104 -14.442 1.00 71.63 C
ATOM 4041 O PHE A 738 -9.221 -32.655 -13.345 1.00 71.63 O
ATOM 4042 CB PHE A 738 -8.126 -32.680 -16.440 1.00 71.63 C
ATOM 4043 CG PHE A 738 -7.847 -31.317 -15.888 1.00 71.63 C
ATOM 4044 CD1 PHE A 738 -6.668 -31.060 -15.214 1.00 71.63 C
ATOM 4045 CD2 PHE A 738 -8.767 -30.297 -16.030 1.00 71.63 C
ATOM 4046 CE1 PHE A 738 -6.408 -29.805 -14.698 1.00 71.63 C
ATOM 4047 CE2 PHE A 738 -8.515 -29.040 -15.518 1.00 71.63 C
ATOM 4048 CZ PHE A 738 -7.333 -28.794 -14.850 1.00 71.63 C
ATOM 4049 N SER A 739 -10.796 -33.114 -14.877 1.00 74.94 N
ATOM 4050 CA SER A 739 -11.872 -32.578 -14.061 1.00 74.94 C
ATOM 4051 C SER A 739 -12.008 -33.399 -12.793 1.00 74.94 C
ATOM 4052 O SER A 739 -12.179 -32.858 -11.705 1.00 74.94 O
ATOM 4053 CB SER A 739 -13.185 -32.606 -14.832 1.00 74.94 C
ATOM 4054 OG SER A 739 -13.534 -33.936 -15.165 1.00 74.94 O
ATOM 4055 N TRP A 740 -11.920 -34.716 -12.938 1.00 78.55 N
ATOM 4056 CA TRP A 740 -12.028 -35.603 -11.796 1.00 78.55 C
ATOM 4057 C TRP A 740 -10.886 -35.365 -10.825 1.00 78.55 C
ATOM 4058 O TRP A 740 -11.086 -35.352 -9.614 1.00 78.55 O
ATOM 4059 CB TRP A 740 -12.026 -37.063 -12.237 1.00 78.55 C
ATOM 4060 CG TRP A 740 -12.586 -37.968 -11.201 1.00 78.55 C
ATOM 4061 CD1 TRP A 740 -12.111 -38.160 -9.939 1.00 78.55 C
ATOM 4062 CD2 TRP A 740 -13.737 -38.805 -11.328 1.00 78.55 C
ATOM 4063 NE1 TRP A 740 -12.895 -39.067 -9.271 1.00 78.55 N
ATOM 4064 CE2 TRP A 740 -13.901 -39.478 -10.103 1.00 78.55 C
ATOM 4065 CE3 TRP A 740 -14.645 -39.052 -12.360 1.00 78.55 C
ATOM 4066 CZ2 TRP A 740 -14.934 -40.382 -9.883 1.00 78.55 C
ATOM 4067 CZ3 TRP A 740 -15.669 -39.949 -12.140 1.00 78.55 C
ATOM 4068 CH2 TRP A 740 -15.806 -40.604 -10.912 1.00 78.55 C
ATOM 4069 N ASN A 741 -9.688 -35.163 -11.358 1.00 75.18 N
ATOM 4070 CA ASN A 741 -8.534 -34.945 -10.506 1.00 75.18 C
ATOM 4071 C ASN A 741 -8.696 -33.696 -9.666 1.00 75.18 C
ATOM 4072 O ASN A 741 -8.413 -33.708 -8.473 1.00 75.18 O
ATOM 4073 CB ASN A 741 -7.266 -34.828 -11.345 1.00 75.18 C
ATOM 4074 CG ASN A 741 -6.830 -36.152 -11.928 1.00 75.18 C
ATOM 4075 OD1 ASN A 741 -6.906 -37.187 -11.268 1.00 75.18 O
ATOM 4076 ND2 ASN A 741 -6.363 -36.128 -13.169 1.00 75.18 N
ATOM 4077 N VAL A 742 -9.176 -32.621 -10.278 1.00 72.97 N
ATOM 4078 CA VAL A 742 -9.357 -31.385 -9.538 1.00 72.97 C
ATOM 4079 C VAL A 742 -10.389 -31.575 -8.439 1.00 72.97 C
ATOM 4080 O VAL A 742 -10.198 -31.123 -7.312 1.00 72.97 O
ATOM 4081 CB VAL A 742 -9.787 -30.232 -10.455 1.00 72.97 C
ATOM 4082 CG1 VAL A 742 -10.199 -29.028 -9.626 1.00 72.97 C
ATOM 4083 CG2 VAL A 742 -8.659 -29.869 -11.403 1.00 72.97 C
ATOM 4084 N ILE A 743 -11.507 -32.209 -8.778 1.00 76.26 N
ATOM 4085 CA ILE A 743 -12.556 -32.449 -7.797 1.00 76.26 C
ATOM 4086 C ILE A 743 -12.036 -33.359 -6.694 1.00 76.26 C
ATOM 4087 O ILE A 743 -12.294 -33.135 -5.512 1.00 76.26 O
ATOM 4088 CB ILE A 743 -13.795 -33.096 -8.440 1.00 76.26 C
ATOM 4089 CG1 ILE A 743 -14.374 -32.183 -9.521 1.00 76.26 C
ATOM 4090 CG2 ILE A 743 -14.844 -33.403 -7.383 1.00 76.26 C
ATOM 4091 CD1 ILE A 743 -15.613 -32.737 -10.189 1.00 76.26 C
ATOM 4092 N PHE A 744 -11.296 -34.388 -7.093 1.00 81.92 N
ATOM 4093 CA PHE A 744 -10.721 -35.332 -6.146 1.00 81.92 C
ATOM 4094 C PHE A 744 -9.709 -34.632 -5.248 1.00 81.92 C
ATOM 4095 O PHE A 744 -9.647 -34.883 -4.046 1.00 81.92 O
ATOM 4096 CB PHE A 744 -10.057 -36.494 -6.885 1.00 81.92 C
ATOM 4097 CG PHE A 744 -9.735 -37.666 -6.005 1.00 81.92 C
ATOM 4098 CD1 PHE A 744 -10.628 -38.717 -5.874 1.00 81.92 C
ATOM 4099 CD2 PHE A 744 -8.541 -37.718 -5.306 1.00 81.92 C
ATOM 4100 CE1 PHE A 744 -10.336 -39.798 -5.065 1.00 81.92 C
ATOM 4101 CE2 PHE A 744 -8.242 -38.796 -4.494 1.00 81.92 C
ATOM 4102 CZ PHE A 744 -9.141 -39.837 -4.373 1.00 81.92 C
ATOM 4103 N TYR A 745 -8.919 -33.748 -5.849 1.00 77.66 N
ATOM 4104 CA TYR A 745 -7.896 -33.006 -5.125 1.00 77.66 C
ATOM 4105 C TYR A 745 -8.509 -32.106 -4.059 1.00 77.66 C
ATOM 4106 O TYR A 745 -7.980 -31.991 -2.954 1.00 77.66 O
ATOM 4107 CB TYR A 745 -7.054 -32.175 -6.095 1.00 77.66 C
ATOM 4108 CG TYR A 745 -5.742 -31.699 -5.515 1.00 77.66 C
ATOM 4109 CD1 TYR A 745 -4.562 -32.386 -5.764 1.00 77.66 C
ATOM 4110 CD2 TYR A 745 -5.683 -30.564 -4.719 1.00 77.66 C
ATOM 4111 CE1 TYR A 745 -3.360 -31.956 -5.237 1.00 77.66 C
ATOM 4112 CE2 TYR A 745 -4.485 -30.126 -4.188 1.00 77.66 C
ATOM 4113 CZ TYR A 745 -3.327 -30.826 -4.450 1.00 77.66 C
ATOM 4114 OH TYR A 745 -2.132 -30.394 -3.923 1.00 77.66 O
ATOM 4115 N ILE A 746 -9.627 -31.470 -4.394 1.00 80.02 N
ATOM 4116 CA ILE A 746 -10.303 -30.581 -3.458 1.00 80.02 C
ATOM 4117 C ILE A 746 -10.765 -31.362 -2.235 1.00 80.02 C
ATOM 4118 O ILE A 746 -10.662 -30.885 -1.105 1.00 80.02 O
ATOM 4119 CB ILE A 746 -11.514 -29.889 -4.108 1.00 30.00 C
ATOM 4120 CG1 ILE A 746 -11.083 -29.134 -5.367 1.00 30.00 C
ATOM 4121 CG2 ILE A 746 -12.182 -28.947 -3.119 1.00 30.00 C
ATOM 4122 CD1 ILE A 746 -12.216 -28.414 -6.065 1.00 30.00 C
ATOM 4123 N ALA A 747 -11.276 -32.565 -2.470 1.00 82.21 N
ATOM 4124 CA ALA A 747 -11.741 -33.429 -1.385 1.00 82.21 C
ATOM 4125 C ALA A 747 -10.581 -33.907 -0.518 1.00 82.21 C
ATOM 4126 O ALA A 747 -10.715 -34.015 0.709 1.00 82.21 O
ATOM 4127 CB ALA A 747 -12.507 -34.620 -1.953 1.00 82.21 C
ATOM 4128 N PHE A 748 -9.442 -34.204 -1.148 1.00 85.44 N
ATOM 4129 CA PHE A 748 -8.217 -34.522 -0.427 1.00 85.44 C
ATOM 4130 C PHE A 748 -7.799 -33.388 0.486 1.00 85.44 C
ATOM 4131 O PHE A 748 -7.368 -33.623 1.619 1.00 85.44 O
ATOM 4132 CB PHE A 748 -7.099 -34.816 -1.418 1.00 85.44 C
ATOM 4133 CG PHE A 748 -5.757 -34.954 -0.780 1.00 85.44 C
ATOM 4134 CD1 PHE A 748 -5.458 -36.056 -0.012 1.00 85.44 C
ATOM 4135 CD2 PHE A 748 -4.788 -33.988 -0.964 1.00 85.44 C
ATOM 4136 CE1 PHE A 748 -4.220 -36.188 0.577 1.00 85.44 C
ATOM 4137 CE2 PHE A 748 -3.552 -34.115 -0.380 1.00 85.44 C
ATOM 4138 CZ PHE A 748 -3.267 -35.214 0.390 1.00 85.44 C
ATOM 4139 N LEU A 749 -7.917 -32.154 0.002 1.00 85.90 N
ATOM 4140 CA LEU A 749 -7.512 -31.008 0.805 1.00 85.90 C
ATOM 4141 C LEU A 749 -8.433 -30.837 2.007 1.00 85.90 C
ATOM 4142 O LEU A 749 -7.973 -30.533 3.118 1.00 85.90 O
ATOM 4143 CB LEU A 749 -7.508 -29.756 -0.062 1.00 85.90 C
ATOM 4144 CG LEU A 749 -6.736 -28.601 0.546 1.00 85.90 C
ATOM 4145 CD1 LEU A 749 -5.285 -29.009 0.620 1.00 85.90 C
ATOM 4146 CD2 LEU A 749 -6.900 -27.372 -0.305 1.00 85.90 C
ATOM 4147 N LEU A 750 -9.735 -31.074 1.805 1.00 89.58 N
ATOM 4148 CA LEU A 750 -10.688 -31.017 2.912 1.00 89.58 C
ATOM 4149 C LEU A 750 -10.402 -32.086 3.957 1.00 89.58 C
ATOM 4150 O LEU A 750 -10.442 -31.810 5.164 1.00 89.58 O
ATOM 4151 CB LEU A 750 -12.113 -31.165 2.391 1.00 89.58 C
ATOM 4152 CG LEU A 750 -12.680 -29.983 1.613 1.00 89.58 C
ATOM 4153 CD1 LEU A 750 -14.010 -30.337 0.985 1.00 89.58 C
ATOM 4154 CD2 LEU A 750 -12.844 -28.803 2.547 1.00 89.58 C
ATOM 4155 N LEU A 751 -10.098 -33.306 3.513 1.00 91.99 N
ATOM 4156 CA LEU A 751 -9.812 -34.381 4.458 1.00 91.99 C
ATOM 4157 C LEU A 751 -8.509 -34.119 5.201 1.00 91.99 C
ATOM 4158 O LEU A 751 -8.382 -34.450 6.388 1.00 91.99 O
ATOM 4159 CB LEU A 751 -9.761 -35.718 3.719 1.00 91.99 C
ATOM 4160 CG LEU A 751 -9.844 -37.043 4.479 1.00 91.99 C
ATOM 4161 CD1 LEU A 751 -10.503 -38.062 3.571 1.00 91.99 C
ATOM 4162 CD2 LEU A 751 -8.502 -37.566 4.955 1.00 91.99 C
ATOM 4163 N PHE A 752 -7.537 -33.513 4.515 1.00 92.76 N
ATOM 4164 CA PHE A 752 -6.271 -33.152 5.142 1.00 92.76 C
ATOM 4165 C PHE A 752 -6.494 -32.114 6.229 1.00 92.76 C
ATOM 4166 O PHE A 752 -5.916 -32.207 7.319 1.00 92.76 O
ATOM 4167 CB PHE A 752 -5.321 -32.633 4.065 1.00 92.76 C
ATOM 4168 CG PHE A 752 -3.888 -32.569 4.477 1.00 92.76 C
ATOM 4169 CD1 PHE A 752 -3.132 -33.718 4.532 1.00 92.76 C
ATOM 4170 CD2 PHE A 752 -3.284 -31.366 4.762 1.00 92.76 C
ATOM 4171 CE1 PHE A 752 -1.808 -33.664 4.884 1.00 92.76 C
ATOM 4172 CE2 PHE A 752 -1.960 -31.302 5.110 1.00 92.76 C
ATOM 4173 CZ PHE A 752 -1.221 -32.452 5.173 1.00 92.76 C
ATOM 4174 N ALA A 753 -7.379 -31.148 5.963 1.00 97.66 N
ATOM 4175 CA ALA A 753 -7.726 -30.146 6.966 1.00 97.66 C
ATOM 4176 C ALA A 753 -8.446 -30.773 8.155 1.00 97.66 C
ATOM 4177 O ALA A 753 -8.211 -30.390 9.311 1.00 97.66 O
ATOM 4178 CB ALA A 753 -8.589 -29.057 6.332 1.00 97.66 C
ATOM 4179 N TYR A 754 -9.329 -31.739 7.885 1.00 98.38 N
ATOM 4180 CA TYR A 754 -10.068 -32.389 8.965 1.00 98.38 C
ATOM 4181 C TYR A 754 -9.148 -33.205 9.862 1.00 98.38 C
ATOM 4182 O TYR A 754 -9.353 -33.268 11.079 1.00 98.38 O
ATOM 4183 CB TYR A 754 -11.175 -33.275 8.401 1.00 98.38 C
ATOM 4184 CG TYR A 754 -11.935 -34.007 9.479 1.00 98.38 C
ATOM 4185 CD1 TYR A 754 -12.808 -33.330 10.315 1.00 98.38 C
ATOM 4186 CD2 TYR A 754 -11.777 -35.373 9.663 1.00 98.38 C
ATOM 4187 CE1 TYR A 754 -13.502 -33.992 11.306 1.00 98.38 C
ATOM 4188 CE2 TYR A 754 -12.466 -36.045 10.651 1.00 98.38 C
ATOM 4189 CZ TYR A 754 -13.326 -35.348 11.468 1.00 98.38 C
ATOM 4190 OH TYR A 754 -14.019 -36.007 12.453 1.00 98.38 O
ATOM 4191 N VAL A 755 -8.127 -33.833 9.284 1.00101.56 N
ATOM 4192 CA VAL A 755 -7.178 -34.574 10.107 1.00101.56 C
ATOM 4193 C VAL A 755 -6.275 -33.613 10.874 1.00101.56 C
ATOM 4194 O VAL A 755 -5.929 -33.861 12.036 1.00101.56 O
ATOM 4195 CB VAL A 755 -6.382 -35.562 9.236 1.00101.56 C
ATOM 4196 CG1 VAL A 755 -5.299 -36.271 10.031 1.00101.56 C
ATOM 4197 CG2 VAL A 755 -7.319 -36.590 8.647 1.00101.56 C
ATOM 4198 N LEU A 756 -5.922 -32.475 10.260 1.00 97.26 N
ATOM 4199 CA LEU A 756 -5.094 -31.482 10.948 1.00 97.26 C
ATOM 4200 C LEU A 756 -5.826 -30.846 12.122 1.00 97.26 C
ATOM 4201 O LEU A 756 -5.199 -30.390 13.084 1.00 97.26 O
ATOM 4202 CB LEU A 756 -4.636 -30.398 9.981 1.00 97.26 C
ATOM 4203 CG LEU A 756 -3.507 -30.786 9.043 1.00 97.26 C
ATOM 4204 CD1 LEU A 756 -3.262 -29.670 8.056 1.00 97.26 C
ATOM 4205 CD2 LEU A 756 -2.272 -31.066 9.859 1.00 97.26 C
ATOM 4206 N LEU A 757 -7.154 -30.788 12.056 1.00103.54 N
ATOM 4207 CA LEU A 757 -7.893 -30.276 13.203 1.00103.54 C
ATOM 4208 C LEU A 757 -8.220 -31.387 14.194 1.00103.54 C
ATOM 4209 O LEU A 757 -8.155 -31.179 15.411 1.00103.54 O
ATOM 4210 CB LEU A 757 -9.154 -29.565 12.730 1.00103.54 C
ATOM 4211 CG LEU A 757 -8.824 -28.297 11.949 1.00103.54 C
ATOM 4212 CD1 LEU A 757 -10.080 -27.690 11.376 1.00103.54 C
ATOM 4213 CD2 LEU A 757 -8.116 -27.313 12.853 1.00103.54 C
ATOM 4214 N MET A 758 -8.588 -32.565 13.699 1.00111.84 N
ATOM 4215 CA MET A 758 -8.855 -33.734 14.540 1.00111.84 C
ATOM 4216 C MET A 758 -7.641 -34.661 14.544 1.00111.84 C
ATOM 4217 O MET A 758 -7.671 -35.766 13.999 1.00111.84 O
ATOM 4218 CB MET A 758 -10.103 -34.462 14.051 1.00111.84 C
ATOM 4219 CG MET A 758 -11.424 -33.835 14.471 1.00111.84 C
ATOM 4220 SD MET A 758 -11.709 -32.167 13.844 1.00111.84 S
ATOM 4221 CE MET A 758 -11.553 -31.200 15.341 1.00111.84 C
ATOM 4222 N ASP A 759 -6.562 -34.206 15.177 1.00121.33 N
ATOM 4223 CA ASP A 759 -5.313 -34.956 15.251 1.00121.33 C
ATOM 4224 C ASP A 759 -5.134 -35.459 16.676 1.00121.33 C
ATOM 4225 O ASP A 759 -5.314 -34.700 17.633 1.00121.33 O
ATOM 4226 CB ASP A 759 -4.120 -34.094 14.834 1.00121.33 C
ATOM 4227 CG ASP A 759 -2.862 -34.911 14.575 1.00121.33 C
ATOM 4228 OD1 ASP A 759 -2.900 -36.152 14.701 1.00121.33 O
ATOM 4229 OD2 ASP A 759 -1.825 -34.304 14.239 1.00121.33 O
ATOM 4230 N PHE A 760 -4.782 -36.733 16.808 1.00125.65 N
ATOM 4231 CA PHE A 760 -4.583 -37.343 18.109 1.00125.65 C
ATOM 4232 C PHE A 760 -3.081 -37.381 18.415 1.00125.65 C
ATOM 4233 O PHE A 760 -2.246 -36.953 17.614 1.00125.65 O
ATOM 4234 CB PHE A 760 -5.265 -38.716 18.123 1.00125.65 C
ATOM 4235 CG PHE A 760 -5.413 -39.323 19.489 1.00125.65 C
ATOM 4236 CD1 PHE A 760 -6.289 -38.776 20.409 1.00125.65 C
ATOM 4237 CD2 PHE A 760 -4.684 -40.449 19.843 1.00125.65 C
ATOM 4238 CE1 PHE A 760 -6.423 -39.328 21.669 1.00125.65 C
ATOM 4239 CE2 PHE A 760 -4.814 -41.009 21.100 1.00125.65 C
ATOM 4240 CZ PHE A 760 -5.685 -40.449 22.014 1.00125.65 C
ATOM 4241 N GLN A 761 -2.723 -37.899 19.587 1.00129.10 N
ATOM 4242 CA GLN A 761 -1.346 -38.053 20.036 1.00129.10 C
ATOM 4243 C GLN A 761 -0.782 -39.332 19.395 1.00129.10 C
ATOM 4244 O GLN A 761 -1.395 -39.873 18.472 1.00129.10 O
ATOM 4245 CB GLN A 761 -1.322 -38.018 21.574 1.00129.10 C
ATOM 4246 CG GLN A 761 0.003 -37.600 22.228 1.00129.10 C
ATOM 4247 CD GLN A 761 -0.090 -37.519 23.736 1.00129.10 C
ATOM 4248 OE1 GLN A 761 -1.113 -37.863 24.325 1.00129.10 O
ATOM 4249 NE2 GLN A 761 0.974 -37.038 24.369 1.00129.10 N
ATOM 4250 N LYS A 762 0.340 -39.849 19.929 1.00130.22 N
ATOM 4251 CA LYS A 762 1.396 -40.717 19.336 1.00130.22 C
ATOM 4252 C LYS A 762 0.834 -41.738 18.342 1.00130.22 C
ATOM 4253 O LYS A 762 1.410 -41.894 17.258 1.00130.22 O
ATOM 4254 CB LYS A 762 2.180 -41.310 20.501 1.00130.22 C
ATOM 4255 N GLU A 763 -0.246 -42.444 18.659 1.00127.32 N
ATOM 4256 CA GLU A 763 -0.813 -43.399 17.720 1.00127.32 C
ATOM 4257 C GLU A 763 -1.697 -42.701 16.690 1.00127.32 C
ATOM 4258 O GLU A 763 -2.682 -42.049 17.042 1.00127.32 O
ATOM 4259 CB GLU A 763 -1.622 -44.452 18.467 1.00127.32 C
ATOM 4260 N PRO A 764 -1.368 -42.826 15.404 1.00127.59 N
ATOM 4261 CA PRO A 764 -2.218 -42.222 14.371 1.00127.59 C
ATOM 4262 C PRO A 764 -3.415 -43.101 14.035 1.00127.59 C
ATOM 4263 O PRO A 764 -3.328 -44.331 14.026 1.00127.59 O
ATOM 4264 CB PRO A 764 -1.271 -42.087 13.174 1.00127.59 C
ATOM 4265 CG PRO A 764 -0.311 -43.203 13.346 1.00127.59 C
ATOM 4266 CD PRO A 764 -0.129 -43.382 14.832 1.00127.59 C
ATOM 4267 N THR A 765 -4.542 -42.454 13.750 1.00126.04 N
ATOM 4268 CA THR A 765 -5.738 -43.176 13.344 1.00126.04 C
ATOM 4269 C THR A 765 -5.637 -43.615 11.885 1.00126.04 C
ATOM 4270 O THR A 765 -4.651 -43.353 11.191 1.00126.04 O
ATOM 4271 CB THR A 765 -6.980 -42.311 13.527 1.00126.04 C
ATOM 4272 OG1 THR A 765 -6.896 -41.174 12.661 1.00126.04 O
ATOM 4273 CG2 THR A 765 -7.080 -41.836 14.958 1.00126.04 C
ATOM 4274 N ALA A 766 -6.696 -44.283 11.416 1.00125.09 N
ATOM 4275 CA ALA A 766 -6.706 -44.814 10.055 1.00125.09 C
ATOM 4276 C ALA A 766 -6.812 -43.703 9.016 1.00125.09 C
ATOM 4277 O ALA A 766 -6.410 -43.884 7.859 1.00125.09 O
ATOM 4278 CB ALA A 766 -7.852 -45.810 9.892 1.00125.09 C
ATOM 4279 N LEU A 767 -7.366 -42.551 9.411 1.00118.54 N
ATOM 4280 CA LEU A 767 -7.489 -41.417 8.500 1.00118.54 C
ATOM 4281 C LEU A 767 -6.122 -40.884 8.092 1.00118.54 C
ATOM 4282 O LEU A 767 -5.877 -40.614 6.905 1.00118.54 O
ATOM 4283 CB LEU A 767 -8.321 -40.319 9.160 1.00118.54 C
ATOM 4284 CG LEU A 767 -9.773 -40.709 9.430 1.00118.54 C
ATOM 4285 CD1 LEU A 767 -10.489 -39.642 10.234 1.00118.54 C
ATOM 4286 CD2 LEU A 767 -10.487 -40.959 8.119 1.00118.54 C
ATOM 4287 N GLU A 768 -5.213 -40.747 9.064 1.00115.10 N
ATOM 4288 CA GLU A 768 -3.853 -40.313 8.767 1.00115.10 C
ATOM 4289 C GLU A 768 -3.139 -41.321 7.877 1.00115.10 C
ATOM 4290 O GLU A 768 -2.381 -40.935 6.979 1.00115.10 O
ATOM 4291 CB GLU A 768 -3.077 -40.093 10.064 1.00115.10 C
ATOM 4292 N ILE A 769 -3.413 -42.613 8.081 1.00114.60 N
ATOM 4293 CA ILE A 769 -2.832 -43.667 7.251 1.00114.60 C
ATOM 4294 C ILE A 769 -3.321 -43.547 5.815 1.00114.60 C
ATOM 4295 O ILE A 769 -2.545 -43.709 4.859 1.00114.60 O
ATOM 4296 CB ILE A 769 -3.166 -45.044 7.853 1.00114.60 C
ATOM 4297 CG1 ILE A 769 -2.635 -45.125 9.281 1.00114.60 C
ATOM 4298 CG2 ILE A 769 -2.558 -46.161 7.025 1.00114.60 C
ATOM 4299 CD1 ILE A 769 -3.168 -46.294 10.063 1.00114.60 C
ATOM 4300 N ILE A 770 -4.611 -43.235 5.645 1.00108.11 N
ATOM 4301 CA ILE A 770 -5.170 -43.003 4.316 1.00108.11 C
ATOM 4302 C ILE A 770 -4.498 -41.805 3.659 1.00108.11 C
ATOM 4303 O ILE A 770 -4.221 -41.814 2.450 1.00108.11 O
ATOM 4304 CB ILE A 770 -6.694 -42.816 4.406 1.00108.11 C
ATOM 4305 N LEU A 771 -4.198 -40.771 4.454 1.00105.92 N
ATOM 4306 CA LEU A 771 -3.448 -39.627 3.936 1.00105.92 C
ATOM 4307 C LEU A 771 -2.051 -40.022 3.474 1.00105.92 C
ATOM 4308 O LEU A 771 -1.589 -39.552 2.425 1.00105.92 O
ATOM 4309 CB LEU A 771 -3.342 -38.519 4.980 1.00105.92 C
ATOM 4310 CG LEU A 771 -4.572 -37.683 5.286 1.00105.92 C
ATOM 4311 CD1 LEU A 771 -4.250 -36.747 6.417 1.00105.92 C
ATOM 4312 CD2 LEU A 771 -4.956 -36.901 4.062 1.00105.92 C
ATOM 4313 N TYR A 772 -1.364 -40.877 4.241 1.00107.83 N
ATOM 4314 CA TYR A 772 -0.010 -41.260 3.849 1.00107.83 C
ATOM 4315 C TYR A 772 -0.032 -42.096 2.578 1.00107.83 C
ATOM 4316 O TYR A 772 0.861 -41.975 1.731 1.00107.83 O
ATOM 4317 CB TYR A 772 0.710 -42.031 4.955 1.00107.83 C
ATOM 4318 CG TYR A 772 0.864 -41.302 6.266 1.00107.83 C
ATOM 4319 CD1 TYR A 772 1.517 -40.083 6.334 1.00107.83 C
ATOM 4320 CD2 TYR A 772 0.483 -41.905 7.455 1.00107.83 C
ATOM 4321 CE1 TYR A 772 1.676 -39.433 7.537 1.00107.83 C
ATOM 4322 CE2 TYR A 772 0.638 -41.263 8.659 1.00107.83 C
ATOM 4323 CZ TYR A 772 1.242 -40.033 8.696 1.00107.83 C
ATOM 4324 OH TYR A 772 1.412 -39.398 9.897 1.00107.83 O
ATOM 4325 N VAL A 773 -1.075 -42.912 2.409 1.00107.14 N
ATOM 4326 CA VAL A 773 -1.223 -43.690 1.181 1.00107.14 C
ATOM 4327 C VAL A 773 -1.465 -42.774 -0.016 1.00107.14 C
ATOM 4328 O VAL A 773 -0.876 -42.966 -1.089 1.00107.14 O
ATOM 4329 CB VAL A 773 -2.344 -44.731 1.347 1.00107.14 C
ATOM 4330 CG1 VAL A 773 -2.647 -45.423 0.031 1.00107.14 C
ATOM 4331 CG2 VAL A 773 -1.935 -45.763 2.369 1.00107.14 C
ATOM 4332 N LEU A 774 -2.300 -41.744 0.160 1.00104.09 N
ATOM 4333 CA LEU A 774 -2.571 -40.819 -0.942 1.00104.09 C
ATOM 4334 C LEU A 774 -1.329 -40.022 -1.333 1.00104.09 C
ATOM 4335 O LEU A 774 -1.056 -39.819 -2.527 1.00104.09 O
ATOM 4336 CB LEU A 774 -3.716 -39.882 -0.561 1.00104.09 C
ATOM 4337 CG LEU A 774 -5.073 -40.579 -0.484 1.00104.09 C
ATOM 4338 CD1 LEU A 774 -6.144 -39.663 0.067 1.00104.09 C
ATOM 4339 CD2 LEU A 774 -5.460 -41.088 -1.855 1.00104.09 C
ATOM 4340 N VAL A 775 -0.537 -39.603 -0.347 1.00101.09 N
ATOM 4341 CA VAL A 775 0.684 -38.869 -0.670 1.00101.09 C
ATOM 4342 C VAL A 775 1.716 -39.807 -1.294 1.00101.09 C
ATOM 4343 O VAL A 775 2.510 -39.398 -2.149 1.00101.09 O
ATOM 4344 CB VAL A 775 1.213 -38.143 0.582 1.00101.09 C
ATOM 4345 CG1 VAL A 775 2.483 -37.379 0.287 1.00101.09 C
ATOM 4346 CG2 VAL A 775 0.177 -37.171 1.079 1.00101.09 C
ATOM 4347 N PHE A 776 1.674 -41.093 -0.933 1.00100.87 N
ATOM 4348 CA PHE A 776 2.530 -42.073 -1.597 1.00100.87 C
ATOM 4349 C PHE A 776 2.151 -42.251 -3.064 1.00100.87 C
ATOM 4350 O PHE A 776 3.024 -42.453 -3.919 1.00100.87 O
ATOM 4351 CB PHE A 776 2.454 -43.407 -0.863 1.00100.87 C
ATOM 4352 CG PHE A 776 3.304 -44.476 -1.468 1.00100.87 C
ATOM 4353 CD1 PHE A 776 4.677 -44.462 -1.295 1.00100.87 C
ATOM 4354 CD2 PHE A 776 2.732 -45.497 -2.209 1.00100.87 C
ATOM 4355 CE1 PHE A 776 5.467 -45.448 -1.852 1.00100.87 C
ATOM 4356 CE2 PHE A 776 3.512 -46.484 -2.766 1.00100.87 C
ATOM 4357 CZ PHE A 776 4.883 -46.461 -2.589 1.00100.87 C
ATOM 4358 N ILE A 777 0.849 -42.195 -3.363 1.00102.71 N
ATOM 4359 CA ILE A 777 0.381 -42.203 -4.752 1.00102.71 C
ATOM 4360 C ILE A 777 0.943 -41.002 -5.504 1.00102.71 C
ATOM 4361 O ILE A 777 1.438 -41.122 -6.639 1.00102.71 O
ATOM 4362 CB ILE A 777 -1.158 -42.217 -4.795 1.00102.71 C
ATOM 4363 CG1 ILE A 777 -1.704 -43.492 -4.159 1.00102.71 C
ATOM 4364 CG2 ILE A 777 -1.665 -42.082 -6.217 1.00102.71 C
ATOM 4365 CD1 ILE A 777 -3.185 -43.446 -3.881 1.00102.71 C
ATOM 4366 N LEU A 778 0.890 -39.829 -4.861 1.00 97.15 N
ATOM 4367 CA LEU A 778 1.497 -38.627 -5.433 1.00 97.15 C
ATOM 4368 C LEU A 778 2.996 -38.795 -5.665 1.00 97.15 C
ATOM 4369 O LEU A 778 3.523 -38.345 -6.689 1.00 97.15 O
ATOM 4370 CB LEU A 778 1.240 -37.422 -4.532 1.00 97.15 C
ATOM 4371 CG LEU A 778 -0.095 -36.699 -4.585 1.00 97.15 C
ATOM 4372 CD1 LEU A 778 -0.172 -35.699 -3.457 1.00 97.15 C
ATOM 4373 CD2 LEU A 778 -0.173 -35.983 -5.910 1.00 97.15 C
ATOM 4374 N LEU A 779 3.689 -39.460 -4.738 1.00102.44 N
ATOM 4375 CA LEU A 779 5.132 -39.641 -4.871 1.00102.44 C
ATOM 4376 C LEU A 779 5.464 -40.565 -6.028 1.00102.44 C
ATOM 4377 O LEU A 779 6.440 -40.335 -6.755 1.00102.44 O
ATOM 4378 CB LEU A 779 5.721 -40.183 -3.571 1.00102.44 C
ATOM 4379 N CYS A 780 4.646 -41.604 -6.225 1.00106.65 N
ATOM 4380 CA CYS A 780 4.826 -42.484 -7.376 1.00106.65 C
ATOM 4381 C CYS A 780 4.623 -41.730 -8.681 1.00106.65 C
ATOM 4382 O CYS A 780 5.383 -41.922 -9.642 1.00106.65 O
ATOM 4383 CB CYS A 780 3.868 -43.667 -7.290 1.00106.65 C
ATOM 4384 SG CYS A 780 4.196 -44.785 -5.918 1.00106.65 S
ATOM 4385 N ASP A 781 3.635 -40.830 -8.715 1.00108.38 N
ATOM 4386 CA ASP A 781 3.401 -40.043 -9.926 1.00108.38 C
ATOM 4387 C ASP A 781 4.552 -39.072 -10.189 1.00108.38 C
ATOM 4388 O ASP A 781 4.953 -38.863 -11.345 1.00108.38 O
ATOM 4389 CB ASP A 781 2.076 -39.295 -9.804 1.00108.38 C
ATOM 4390 CG ASP A 781 1.547 -38.817 -11.139 1.00108.38 C
ATOM 4391 OD1 ASP A 781 2.190 -39.076 -12.177 1.00108.38 O
ATOM 4392 OD2 ASP A 781 0.471 -38.182 -11.151 1.00108.38 O
ATOM 4393 N GLU A 782 5.121 -38.500 -9.123 1.00110.29 N
ATOM 4394 CA GLU A 782 6.242 -37.576 -9.283 1.00110.29 C
ATOM 4395 C GLU A 782 7.493 -38.289 -9.784 1.00110.29 C
ATOM 4396 O GLU A 782 8.219 -37.758 -10.634 1.00110.29 O
ATOM 4397 CB GLU A 782 6.528 -36.861 -7.964 1.00110.29 C
ATOM 4398 CG GLU A 782 5.453 -35.879 -7.541 1.00110.29 C
ATOM 4399 CD GLU A 782 5.368 -34.676 -8.453 1.00110.29 C
ATOM 4400 OE1 GLU A 782 6.414 -34.262 -8.986 1.00110.29 O
ATOM 4401 OE2 GLU A 782 4.256 -34.141 -8.640 1.00110.29 O
ATOM 4402 N VAL A 783 7.754 -39.497 -9.276 1.00107.46 N
ATOM 4403 CA VAL A 783 8.896 -40.280 -9.750 1.00107.46 C
ATOM 4404 C VAL A 783 8.693 -40.699 -11.205 1.00107.46 C
ATOM 4405 O VAL A 783 9.643 -40.707 -12.009 1.00107.46 O
ATOM 4406 CB VAL A 783 9.123 -41.483 -8.813 1.00107.46 C
ATOM 4407 CG1 VAL A 783 10.168 -42.434 -9.353 1.00107.46 C
ATOM 4408 CG2 VAL A 783 9.567 -40.993 -7.453 1.00107.46 C
ATOM 4409 N ARG A 784 7.444 -41.001 -11.578 1.00105.66 N
ATOM 4410 CA ARG A 784 7.151 -41.324 -12.970 1.00105.66 C
ATOM 4411 C ARG A 784 7.418 -40.137 -13.886 1.00105.66 C
ATOM 4412 O ARG A 784 7.944 -40.307 -14.991 1.00105.66 O
ATOM 4413 CB ARG A 784 5.704 -41.802 -13.108 1.00105.66 C
ATOM 4414 CG ARG A 784 5.309 -42.232 -14.522 1.00105.66 C
ATOM 4415 CD ARG A 784 4.472 -41.185 -15.250 1.00105.66 C
ATOM 4416 NE ARG A 784 4.207 -41.580 -16.627 1.00105.66 N
ATOM 4417 CZ ARG A 784 3.197 -42.354 -17.000 1.00105.66 C
ATOM 4418 NH1 ARG A 784 2.349 -42.826 -16.098 1.00105.66 N
ATOM 4419 NH2 ARG A 784 3.035 -42.661 -18.278 1.00105.66 N
ATOM 4420 N GLN A 785 7.079 -38.926 -13.447 1.00105.09 N
ATOM 4421 CA GLN A 785 7.310 -37.787 -14.330 1.00105.09 C
ATOM 4422 C GLN A 785 8.790 -37.406 -14.364 1.00105.09 C
ATOM 4423 O GLN A 785 9.281 -36.906 -15.390 1.00105.09 O
ATOM 4424 CB GLN A 785 6.435 -36.606 -13.920 1.00105.09 C
ATOM 4425 CG GLN A 785 6.455 -35.482 -14.936 1.00105.09 C
ATOM 4426 CD GLN A 785 5.498 -34.371 -14.617 1.00105.09 C
ATOM 4427 OE1 GLN A 785 4.758 -34.432 -13.637 1.00105.09 O
ATOM 4428 NE2 GLN A 785 5.514 -33.331 -15.441 1.00105.09 N
ATOM 4429 N TRP A 786 9.512 -37.654 -13.256 1.00107.30 N
ATOM 4430 CA TRP A 786 10.974 -37.568 -13.250 1.00107.30 C
ATOM 4431 C TRP A 786 11.583 -38.412 -14.353 1.00107.30 C
ATOM 4432 O TRP A 786 12.333 -37.902 -15.199 1.00107.30 O
ATOM 4433 CB TRP A 786 11.545 -38.068 -11.925 1.00107.30 C
ATOM 4434 CG TRP A 786 11.364 -37.228 -10.732 1.00107.30 C
ATOM 4435 CD1 TRP A 786 10.870 -35.972 -10.678 1.00107.30 C
ATOM 4436 CD2 TRP A 786 11.702 -37.589 -9.392 1.00107.30 C
ATOM 4437 NE1 TRP A 786 10.870 -35.518 -9.381 1.00107.30 N
ATOM 4438 CE2 TRP A 786 11.379 -36.499 -8.572 1.00107.30 C
ATOM 4439 CE3 TRP A 786 12.245 -38.734 -8.807 1.00107.30 C
ATOM 4440 CZ2 TRP A 786 11.581 -36.518 -7.198 1.00107.30 C
ATOM 4441 CZ3 TRP A 786 12.444 -38.749 -7.443 1.00107.30 C
ATOM 4442 CH2 TRP A 786 12.112 -37.650 -6.653 1.00107.30 C
ATOM 4443 N TYR A 787 11.215 -39.697 -14.378 1.00114.66 N
ATOM 4444 CA TYR A 787 11.830 -40.666 -15.282 1.00114.66 C
ATOM 4445 C TYR A 787 11.519 -40.366 -16.744 1.00114.66 C
ATOM 4446 O TYR A 787 12.275 -40.754 -17.641 1.00114.66 O
ATOM 4447 CB TYR A 787 11.360 -42.070 -14.901 1.00114.66 C
ATOM 4448 CG TYR A 787 11.879 -43.165 -15.787 1.00114.66 C
ATOM 4449 CD1 TYR A 787 13.198 -43.581 -15.702 1.00114.66 C
ATOM 4450 CD2 TYR A 787 11.047 -43.785 -16.711 1.00114.66 C
ATOM 4451 CE1 TYR A 787 13.678 -44.585 -16.517 1.00114.66 C
ATOM 4452 CE2 TYR A 787 11.514 -44.788 -17.529 1.00114.66 C
ATOM 4453 CZ TYR A 787 12.831 -45.185 -17.429 1.00114.66 C
ATOM 4454 OH TYR A 787 13.305 -46.188 -18.242 1.00114.66 O
ATOM 4455 N MET A 788 10.424 -39.661 -17.006 1.00113.38 N
ATOM 4456 CA MET A 788 10.040 -39.349 -18.385 1.00113.38 C
ATOM 4457 C MET A 788 10.674 -38.047 -18.864 1.00113.38 C
ATOM 4458 O MET A 788 11.170 -37.973 -19.991 1.00113.38 O
ATOM 4459 CB MET A 788 8.517 -39.314 -18.513 1.00113.38 C
ATOM 4460 CG MET A 788 7.880 -40.678 -18.328 1.00113.38 C
ATOM 4461 SD MET A 788 6.092 -40.665 -18.504 1.00113.38 S
ATOM 4462 CE MET A 788 5.953 -40.403 -20.267 1.00113.38 C
ATOM 4463 N ASN A 789 10.659 -37.005 -18.029 1.00112.12 N
ATOM 4464 CA ASN A 789 11.149 -35.717 -18.512 1.00112.12 C
ATOM 4465 C ASN A 789 12.648 -35.552 -18.294 1.00112.12 C
ATOM 4466 O ASN A 789 13.382 -35.251 -19.241 1.00112.12 O
ATOM 4467 CB ASN A 789 10.379 -34.574 -17.863 1.00112.12 C
ATOM 4468 CG ASN A 789 9.029 -34.358 -18.502 1.00112.12 C
ATOM 4469 OD1 ASN A 789 8.901 -34.388 -19.724 1.00112.12 O
ATOM 4470 ND2 ASN A 789 8.010 -34.140 -17.681 1.00112.12 N
ATOM 4471 N GLY A 790 13.128 -35.732 -17.066 1.00111.94 N
ATOM 4472 CA GLY A 790 14.540 -35.455 -16.846 1.00111.94 C
ATOM 4473 C GLY A 790 14.774 -34.054 -16.310 1.00111.94 C
ATOM 4474 O GLY A 790 14.328 -33.706 -15.213 1.00111.94 O
ATOM 4475 N SER A 791 15.512 -33.239 -17.068 1.00111.51 N
ATOM 4476 CA SER A 791 15.881 -31.912 -16.577 1.00111.51 C
ATOM 4477 C SER A 791 14.857 -30.856 -16.981 1.00111.51 C
ATOM 4478 O SER A 791 14.696 -29.835 -16.293 1.00111.51 O
ATOM 4479 CB SER A 791 17.271 -31.538 -17.080 1.00111.51 C
ATOM 4480 OG SER A 791 18.248 -32.402 -16.529 1.00111.51 O
ATOM 4481 N LYS A 792 14.154 -31.085 -18.096 1.00112.86 N
ATOM 4482 CA LYS A 792 13.060 -30.203 -18.490 1.00112.86 C
ATOM 4483 C LYS A 792 11.917 -30.245 -17.485 1.00112.86 C
ATOM 4484 O LYS A 792 11.102 -29.317 -17.431 1.00112.86 O
ATOM 4485 CB LYS A 792 12.558 -30.583 -19.883 1.00112.86 C
ATOM 4486 N TYR A 793 11.819 -31.338 -16.721 1.00108.68 N
ATOM 4487 CA TYR A 793 11.051 -31.349 -15.482 1.00108.68 C
ATOM 4488 C TYR A 793 11.484 -30.229 -14.553 1.00108.68 C
ATOM 4489 O TYR A 793 10.664 -29.391 -14.169 1.00108.68 O
ATOM 4490 CB TYR A 793 11.252 -32.686 -14.771 1.00108.68 C
ATOM 4491 CG TYR A 793 10.432 -32.901 -13.519 1.00108.68 C
ATOM 4492 CD1 TYR A 793 9.169 -33.469 -13.585 1.00108.68 C
ATOM 4493 CD2 TYR A 793 10.922 -32.537 -12.268 1.00108.68 C
ATOM 4494 CE1 TYR A 793 8.426 -33.678 -12.440 1.00108.68 C
ATOM 4495 CE2 TYR A 793 10.184 -32.713 -11.135 1.00108.68 C
ATOM 4496 CZ TYR A 793 8.945 -33.290 -11.224 1.00108.68 C
ATOM 4497 OH TYR A 793 8.226 -33.472 -10.074 1.00108.68 O
ATOM 4498 N PHE A 794 12.760 -30.201 -14.185 1.00103.24 N
ATOM 4499 CA PHE A 794 13.261 -29.297 -13.162 1.00103.24 C
ATOM 4500 C PHE A 794 13.528 -27.895 -13.683 1.00103.24 C
ATOM 4501 O PHE A 794 14.023 -27.054 -12.926 1.00103.24 O
ATOM 4502 CB PHE A 794 14.538 -29.864 -12.546 1.00103.24 C
ATOM 4503 CG PHE A 794 14.317 -31.077 -11.689 1.00103.24 C
ATOM 4504 CD1 PHE A 794 14.000 -30.947 -10.348 1.00103.24 C
ATOM 4505 CD2 PHE A 794 14.424 -32.346 -12.226 1.00103.24 C
ATOM 4506 CE1 PHE A 794 13.806 -32.061 -9.559 1.00103.24 C
ATOM 4507 CE2 PHE A 794 14.224 -33.465 -11.442 1.00103.24 C
ATOM 4508 CZ PHE A 794 13.915 -33.321 -10.109 1.00103.24 C
ATOM 4509 N SER A 795 13.234 -27.629 -14.956 1.00103.03 N
ATOM 4510 CA SER A 795 13.318 -26.261 -15.456 1.00103.03 C
ATOM 4511 C SER A 795 12.255 -25.365 -14.822 1.00103.03 C
ATOM 4512 O SER A 795 12.483 -24.166 -14.625 1.00103.03 O
ATOM 4513 CB SER A 795 13.194 -26.260 -16.979 1.00103.03 C
ATOM 4514 N ASP A 796 11.090 -25.925 -14.495 1.00100.28 N
ATOM 4515 CA ASP A 796 10.001 -25.153 -13.905 1.00100.28 C
ATOM 4516 C ASP A 796 10.119 -25.144 -12.386 1.00100.28 C
ATOM 4517 O ASP A 796 10.239 -26.201 -11.760 1.00100.28 O
ATOM 4518 CB ASP A 796 8.651 -25.734 -14.322 1.00100.28 C
ATOM 4519 N LEU A 797 10.062 -23.949 -11.794 1.00 92.60 N
ATOM 4520 CA LEU A 797 10.324 -23.820 -10.362 1.00 92.60 C
ATOM 4521 C LEU A 797 9.166 -24.355 -9.524 1.00 92.60 C
ATOM 4522 O LEU A 797 9.372 -24.820 -8.396 1.00 92.60 O
ATOM 4523 CB LEU A 797 10.638 -22.361 -10.023 1.00 92.60 C
ATOM 4524 CG LEU A 797 10.924 -21.952 -8.573 1.00 92.60 C
ATOM 4525 CD1 LEU A 797 12.018 -22.796 -7.958 1.00 92.60 C
ATOM 4526 CD2 LEU A 797 11.348 -20.513 -8.542 1.00 92.60 C
ATOM 4527 N TRP A 798 7.947 -24.334 -10.071 1.00 87.49 N
ATOM 4528 CA TRP A 798 6.800 -24.869 -9.341 1.00 87.49 C
ATOM 4529 C TRP A 798 6.904 -26.378 -9.194 1.00 87.49 C
ATOM 4530 O TRP A 798 6.406 -26.961 -8.225 1.00 87.49 O
ATOM 4531 CB TRP A 798 5.509 -24.500 -10.063 1.00 87.49 C
ATOM 4532 CG TRP A 798 5.362 -23.048 -10.217 1.00 87.49 C
ATOM 4533 CD1 TRP A 798 5.507 -22.334 -11.359 1.00 87.49 C
ATOM 4534 CD2 TRP A 798 5.130 -22.110 -9.177 1.00 87.49 C
ATOM 4535 NE1 TRP A 798 5.328 -20.999 -11.103 1.00 87.49 N
ATOM 4536 CE2 TRP A 798 5.098 -20.841 -9.765 1.00 87.49 C
ATOM 4537 CE3 TRP A 798 4.918 -22.221 -7.805 1.00 87.49 C
ATOM 4538 CZ2 TRP A 798 4.870 -19.693 -9.034 1.00 87.49 C
ATOM 4539 CZ3 TRP A 798 4.694 -21.089 -7.084 1.00 87.49 C
ATOM 4540 CH2 TRP A 798 4.686 -19.843 -7.694 1.00 87.49 C
ATOM 4541 N ASN A 799 7.576 -27.017 -10.138 1.00 96.52 N
ATOM 4542 CA ASN A 799 7.718 -28.457 -10.094 1.00 96.52 C
ATOM 4543 C ASN A 799 8.730 -28.848 -9.022 1.00 96.52 C
ATOM 4544 O ASN A 799 8.530 -29.822 -8.280 1.00 96.52 O
ATOM 4545 CB ASN A 799 8.130 -28.912 -11.482 1.00 96.52 C
ATOM 4546 CG ASN A 799 7.607 -30.257 -11.830 1.00 96.52 C
ATOM 4547 OD1 ASN A 799 7.025 -30.948 -10.999 1.00 96.52 O
ATOM 4548 ND2 ASN A 799 7.730 -30.609 -13.099 1.00 96.52 N
ATOM 4549 N VAL A 800 9.794 -28.046 -8.896 1.00 99.19 N
ATOM 4550 CA VAL A 800 10.750 -28.152 -7.795 1.00 99.19 C
ATOM 4551 C VAL A 800 10.059 -27.913 -6.460 1.00 99.19 C
ATOM 4552 O VAL A 800 10.349 -28.589 -5.462 1.00 99.19 O
ATOM 4553 CB VAL A 800 11.905 -27.155 -8.018 1.00 99.19 C
ATOM 4554 CG1 VAL A 800 12.868 -27.122 -6.835 1.00 99.19 C
ATOM 4555 CG2 VAL A 800 12.643 -27.475 -9.311 1.00 99.19 C
ATOM 4556 N MET A 801 9.131 -26.951 -6.427 1.00 99.93 N
ATOM 4557 CA MET A 801 8.349 -26.683 -5.222 1.00 99.93 C
ATOM 4558 C MET A 801 7.513 -27.887 -4.818 1.00 99.93 C
ATOM 4559 O MET A 801 7.456 -28.241 -3.635 1.00 99.93 O
ATOM 4560 CB MET A 801 7.429 -25.490 -5.450 1.00 99.93 C
ATOM 4561 CG MET A 801 6.612 -25.120 -4.238 1.00 99.93 C
ATOM 4562 SD MET A 801 5.331 -23.926 -4.639 1.00 99.93 S
ATOM 4563 CE MET A 801 4.185 -24.977 -5.530 1.00 99.93 C
ATOM 4564 N ASP A 802 6.854 -28.520 -5.792 1.00101.23 N
ATOM 4565 CA ASP A 802 6.015 -29.680 -5.507 1.00101.23 C
ATOM 4566 C ASP A 802 6.853 -30.848 -4.996 1.00101.23 C
ATOM 4567 O ASP A 802 6.467 -31.527 -4.032 1.00101.23 O
ATOM 4568 CB ASP A 802 5.240 -30.064 -6.770 1.00101.23 C
ATOM 4569 CG ASP A 802 4.030 -30.941 -6.487 1.00101.23 C
ATOM 4570 OD1 ASP A 802 3.782 -31.280 -5.314 1.00101.23 O
ATOM 4571 OD2 ASP A 802 3.312 -31.281 -7.452 1.00101.23 O
ATOM 4572 N THR A 803 8.026 -31.063 -5.603 1.00102.24 N
ATOM 4573 CA THR A 803 8.924 -32.129 -5.161 1.00102.24 C
ATOM 4574 C THR A 803 9.452 -31.880 -3.751 1.00102.24 C
ATOM 4575 O THR A 803 9.467 -32.794 -2.912 1.00102.24 O
ATOM 4576 CB THR A 803 10.083 -32.259 -6.143 1.00102.24 C
ATOM 4577 OG1 THR A 803 9.575 -32.597 -7.437 1.00102.24 O
ATOM 4578 CG2 THR A 803 11.054 -33.324 -5.694 1.00102.24 C
ATOM 4579 N LEU A 804 9.878 -30.646 -3.469 1.00102.72 N
ATOM 4580 CA LEU A 804 10.359 -30.301 -2.136 1.00102.72 C
ATOM 4581 C LEU A 804 9.253 -30.411 -1.098 1.00102.72 C
ATOM 4582 O LEU A 804 9.501 -30.864 0.024 1.00102.72 O
ATOM 4583 CB LEU A 804 10.947 -28.891 -2.138 1.00102.72 C
ATOM 4584 CG LEU A 804 11.516 -28.402 -0.804 1.00102.72 C
ATOM 4585 CD1 LEU A 804 12.670 -29.279 -0.373 1.00102.72 C
ATOM 4586 CD2 LEU A 804 11.947 -26.949 -0.880 1.00102.72 C
ATOM 4587 N ALA A 805 8.019 -30.070 -1.478 1.00102.78 N
ATOM 4588 CA ALA A 805 6.895 -30.176 -0.555 1.00102.78 C
ATOM 4589 C ALA A 805 6.596 -31.623 -0.209 1.00102.78 C
ATOM 4590 O ALA A 805 6.385 -31.957 0.963 1.00102.78 O
ATOM 4591 CB ALA A 805 5.660 -29.520 -1.161 1.00102.78 C
ATOM 4592 N ILE A 806 6.597 -32.503 -1.210 1.00104.59 N
ATOM 4593 CA ILE A 806 6.223 -33.883 -0.931 1.00104.59 C
ATOM 4594 C ILE A 806 7.346 -34.615 -0.198 1.00104.59 C
ATOM 4595 O ILE A 806 7.087 -35.458 0.672 1.00104.59 O
ATOM 4596 CB ILE A 806 5.775 -34.591 -2.224 1.00104.59 C
ATOM 4597 CG1 ILE A 806 5.169 -35.943 -1.898 1.00104.59 C
ATOM 4598 CG2 ILE A 806 6.889 -34.749 -3.233 1.00104.59 C
ATOM 4599 CD1 ILE A 806 4.437 -36.513 -3.034 1.00104.59 C
ATOM 4600 N PHE A 807 8.606 -34.250 -0.459 1.00104.36 N
ATOM 4601 CA PHE A 807 9.690 -34.856 0.307 1.00104.36 C
ATOM 4602 C PHE A 807 9.725 -34.313 1.731 1.00104.36 C
ATOM 4603 O PHE A 807 10.077 -35.034 2.675 1.00104.36 O
ATOM 4604 CB PHE A 807 11.024 -34.635 -0.393 1.00104.36 C
ATOM 4605 CG PHE A 807 12.168 -35.293 0.300 1.00104.36 C
ATOM 4606 CD1 PHE A 807 12.298 -36.672 0.279 1.00104.36 C
ATOM 4607 CD2 PHE A 807 13.113 -34.541 0.975 1.00104.36 C
ATOM 4608 CE1 PHE A 807 13.351 -37.296 0.925 1.00104.36 C
ATOM 4609 CE2 PHE A 807 14.172 -35.155 1.622 1.00104.36 C
ATOM 4610 CZ PHE A 807 14.291 -36.536 1.596 1.00104.36 C
ATOM 4611 N TYR A 808 9.328 -33.052 1.903 1.00104.37 N
ATOM 4612 CA TYR A 808 9.209 -32.461 3.228 1.00104.37 C
ATOM 4613 C TYR A 808 8.111 -33.147 4.030 1.00104.37 C
ATOM 4614 O TYR A 808 8.268 -33.401 5.231 1.00104.37 O
ATOM 4615 CB TYR A 808 8.938 -30.969 3.046 1.00104.37 C
ATOM 4616 CG TYR A 808 8.987 -30.104 4.273 1.00104.37 C
ATOM 4617 CD1 TYR A 808 10.188 -29.857 4.920 1.00104.37 C
ATOM 4618 CD2 TYR A 808 7.849 -29.459 4.732 1.00104.37 C
ATOM 4619 CE1 TYR A 808 10.244 -29.042 6.026 1.00104.37 C
ATOM 4620 CE2 TYR A 808 7.895 -28.636 5.830 1.00104.37 C
ATOM 4621 CZ TYR A 808 9.094 -28.435 6.476 1.00104.37 C
ATOM 4622 OH TYR A 808 9.147 -27.618 7.578 1.00104.37 O
ATOM 4623 N PHE A 809 7.014 -33.502 3.358 1.00101.23 N
ATOM 4624 CA PHE A 809 5.950 -34.274 3.994 1.00101.23 C
ATOM 4625 C PHE A 809 6.429 -35.669 4.366 1.00101.23 C
ATOM 4626 O PHE A 809 6.046 -36.204 5.414 1.00101.23 O
ATOM 4627 CB PHE A 809 4.755 -34.375 3.052 1.00101.23 C
ATOM 4628 CG PHE A 809 3.529 -34.973 3.677 1.00101.23 C
ATOM 4629 CD1 PHE A 809 2.651 -34.182 4.385 1.00101.23 C
ATOM 4630 CD2 PHE A 809 3.261 -36.324 3.568 1.00101.23 C
ATOM 4631 CE1 PHE A 809 1.518 -34.720 4.942 1.00101.23 C
ATOM 4632 CE2 PHE A 809 2.139 -36.869 4.136 1.00101.23 C
ATOM 4633 CZ PHE A 809 1.267 -36.064 4.830 1.00101.23 C
ATOM 4634 N ILE A 810 7.230 -36.290 3.493 1.00101.97 N
ATOM 4635 CA ILE A 810 7.735 -37.637 3.757 1.00101.97 C
ATOM 4636 C ILE A 810 8.665 -37.628 4.960 1.00101.97 C
ATOM 4637 O ILE A 810 8.709 -38.587 5.737 1.00101.97 O
ATOM 4638 CB ILE A 810 8.436 -38.200 2.507 1.00101.97 C
ATOM 4639 N ALA A 811 9.419 -36.543 5.131 1.00106.75 N
ATOM 4640 CA ALA A 811 10.231 -36.394 6.333 1.00106.75 C
ATOM 4641 C ALA A 811 9.365 -36.168 7.564 1.00106.75 C
ATOM 4642 O ALA A 811 9.630 -36.734 8.633 1.00106.75 O
ATOM 4643 CB ALA A 811 11.217 -35.242 6.159 1.00106.75 C
ATOM 4644 N GLY A 812 8.324 -35.342 7.431 1.00108.91 N
ATOM 4645 CA GLY A 812 7.476 -35.039 8.574 1.00108.91 C
ATOM 4646 C GLY A 812 6.668 -36.231 9.053 1.00108.91 C
ATOM 4647 O GLY A 812 6.333 -36.328 10.237 1.00108.91 O
ATOM 4648 N ILE A 813 6.362 -37.160 8.143 1.00112.03 N
ATOM 4649 CA ILE A 813 5.658 -38.387 8.515 1.00112.03 C
ATOM 4650 C ILE A 813 6.505 -39.225 9.465 1.00112.03 C
ATOM 4651 O ILE A 813 6.021 -39.699 10.501 1.00112.03 O
ATOM 4652 CB ILE A 813 5.278 -39.183 7.254 1.00112.03 C
ATOM 4653 N VAL A 814 7.789 -39.395 9.142 1.00116.16 N
ATOM 4654 CA VAL A 814 8.680 -40.172 9.999 1.00116.16 C
ATOM 4655 C VAL A 814 9.009 -39.398 11.266 1.00116.16 C
ATOM 4656 O VAL A 814 9.302 -39.990 12.312 1.00116.16 O
ATOM 4657 CB VAL A 814 9.958 -40.559 9.232 1.00116.16 C
ATOM 4658 N PHE A 815 8.993 -38.068 11.188 1.00112.32 N
ATOM 4659 CA PHE A 815 9.261 -37.263 12.373 1.00112.32 C
ATOM 4660 C PHE A 815 8.104 -37.361 13.360 1.00112.32 C
ATOM 4661 O PHE A 815 8.299 -37.310 14.578 1.00112.32 O
ATOM 4662 CB PHE A 815 9.520 -35.815 11.967 1.00112.32 C
ATOM 4663 CG PHE A 815 10.082 -34.974 13.067 1.00112.32 C
ATOM 4664 CD1 PHE A 815 11.420 -35.069 13.400 1.00112.32 C
ATOM 4665 CD2 PHE A 815 9.280 -34.100 13.770 1.00112.32 C
ATOM 4666 CE1 PHE A 815 11.952 -34.299 14.412 1.00112.32 C
ATOM 4667 CE2 PHE A 815 9.805 -33.326 14.785 1.00112.32 C
ATOM 4668 CZ PHE A 815 11.144 -33.426 15.105 1.00112.32 C
ATOM 4669 N ARG A 816 6.882 -37.504 12.841 1.00116.20 N
ATOM 4670 CA ARG A 816 5.738 -37.754 13.711 1.00116.20 C
ATOM 4671 C ARG A 816 5.721 -39.196 14.202 1.00116.20 C
ATOM 4672 O ARG A 816 5.258 -39.463 15.317 1.00116.20 O
ATOM 4673 CB ARG A 816 4.437 -37.412 12.976 1.00116.20 C
ATOM 4674 CG ARG A 816 3.161 -37.460 13.824 1.00116.20 C
ATOM 4675 CD ARG A 816 2.361 -38.736 13.624 1.00116.20 C
ATOM 4676 NE ARG A 816 1.153 -38.760 14.441 1.00116.20 N
ATOM 4677 CZ ARG A 816 -0.007 -38.225 14.078 1.00116.20 C
ATOM 4678 NH1 ARG A 816 -0.120 -37.611 12.911 1.00116.20 N
ATOM 4679 NH2 ARG A 816 -1.056 -38.298 14.883 1.00116.20 N
ATOM 4680 N LEU A 817 6.213 -40.134 13.384 1.00123.81 N
ATOM 4681 CA LEU A 817 6.144 -41.551 13.740 1.00123.81 C
ATOM 4682 C LEU A 817 7.047 -41.881 14.921 1.00123.81 C
ATOM 4683 O LEU A 817 6.807 -42.859 15.637 1.00123.81 O
ATOM 4684 CB LEU A 817 6.510 -42.413 12.534 1.00123.81 C
ATOM 4685 N HIS A 818 8.089 -41.082 15.139 1.00129.44 N
ATOM 4686 CA HIS A 818 8.932 -41.257 16.312 1.00129.44 C
ATOM 4687 C HIS A 818 8.168 -40.861 17.569 1.00129.44 C
ATOM 4688 O HIS A 818 7.465 -39.848 17.596 1.00129.44 O
ATOM 4689 CB HIS A 818 10.206 -40.424 16.186 1.00129.44 C
ATOM 4690 N SER A 819 8.307 -41.673 18.611 1.00137.84 N
ATOM 4691 CA SER A 819 7.572 -41.485 19.858 1.00137.84 C
ATOM 4692 C SER A 819 8.514 -40.857 20.878 1.00137.84 C
ATOM 4693 O SER A 819 9.359 -41.539 21.464 1.00137.84 O
ATOM 4694 CB SER A 819 7.009 -42.811 20.358 1.00137.84 C
ATOM 4695 N ASP A 820 8.371 -39.548 21.077 1.00135.57 N
ATOM 4696 CA ASP A 820 9.102 -38.832 22.107 1.00135.57 C
ATOM 4697 C ASP A 820 8.244 -37.850 22.890 1.00135.57 C
ATOM 4698 O ASP A 820 8.729 -37.305 23.891 1.00135.57 O
ATOM 4699 CB ASP A 820 10.291 -38.076 21.493 1.00135.57 C
ATOM 4700 N GLU A 821 7.032 -37.541 22.405 1.00135.11 N
ATOM 4701 CA GLU A 821 5.988 -36.720 23.028 1.00135.11 C
ATOM 4702 C GLU A 821 6.336 -35.232 23.093 1.00135.11 C
ATOM 4703 O GLU A 821 5.505 -34.421 23.510 1.00135.11 O
ATOM 4704 CB GLU A 821 5.625 -37.238 24.427 1.00135.11 C
ATOM 4705 N SER A 822 7.547 -34.858 22.678 1.00127.11 N
ATOM 4706 CA SER A 822 7.913 -33.448 22.622 1.00127.11 C
ATOM 4707 C SER A 822 8.099 -32.992 21.184 1.00127.11 C
ATOM 4708 O SER A 822 7.784 -31.848 20.838 1.00127.11 O
ATOM 4709 CB SER A 822 9.184 -33.204 23.431 1.00127.11 C
ATOM 4710 OG SER A 822 9.587 -31.850 23.337 1.00127.11 O
ATOM 4711 N SER A 823 8.626 -33.873 20.334 1.00119.51 N
ATOM 4712 CA SER A 823 8.784 -33.547 18.923 1.00119.51 C
ATOM 4713 C SER A 823 7.442 -33.536 18.207 1.00119.51 C
ATOM 4714 O SER A 823 7.299 -32.883 17.164 1.00119.51 O
ATOM 4715 CB SER A 823 9.723 -34.550 18.265 1.00119.51 C
ATOM 4716 OG SER A 823 9.127 -35.834 18.242 1.00119.51 O
ATOM 4717 N TRP A 824 6.464 -34.272 18.756 1.00117.64 N
ATOM 4718 CA TRP A 824 5.101 -34.462 18.263 1.00117.64 C
ATOM 4719 C TRP A 824 4.452 -33.189 17.752 1.00117.64 C
ATOM 4720 O TRP A 824 4.161 -33.079 16.552 1.00117.64 O
ATOM 4721 CB TRP A 824 4.235 -35.033 19.386 1.00117.64 C
ATOM 4722 CG TRP A 824 2.791 -35.169 19.036 1.00117.64 C
ATOM 4723 CD1 TRP A 824 2.245 -36.029 18.134 1.00117.64 C
ATOM 4724 CD2 TRP A 824 1.704 -34.408 19.574 1.00117.64 C
ATOM 4725 NE1 TRP A 824 0.883 -35.861 18.083 1.00117.64 N
ATOM 4726 CE2 TRP A 824 0.526 -34.871 18.958 1.00117.64 C
ATOM 4727 CE3 TRP A 824 1.611 -33.385 20.521 1.00117.64 C
ATOM 4728 CZ2 TRP A 824 -0.729 -34.346 19.255 1.00117.64 C
ATOM 4729 CZ3 TRP A 824 0.362 -32.863 20.814 1.00117.64 C
ATOM 4730 CH2 TRP A 824 -0.790 -33.345 20.184 1.00117.64 C
ATOM 4731 N TYR A 825 4.318 -32.219 18.667 1.00115.61 N
ATOM 4732 CA TYR A 825 3.803 -30.889 18.353 1.00115.61 C
ATOM 4733 C TYR A 825 4.547 -30.260 17.191 1.00115.61 C
ATOM 4734 O TYR A 825 3.920 -29.833 16.213 1.00115.61 O
ATOM 4735 CB TYR A 825 3.912 -29.994 19.586 1.00115.61 C
ATOM 4736 CG TYR A 825 3.531 -28.554 19.353 1.00115.61 C
ATOM 4737 CD1 TYR A 825 2.202 -28.178 19.237 1.00115.61 C
ATOM 4738 CD2 TYR A 825 4.504 -27.566 19.271 1.00115.61 C
ATOM 4739 CE1 TYR A 825 1.852 -26.861 19.035 1.00115.61 C
ATOM 4740 CE2 TYR A 825 4.163 -26.249 19.068 1.00115.61 C
ATOM 4741 CZ TYR A 825 2.837 -25.902 18.950 1.00115.61 C
ATOM 4742 OH TYR A 825 2.491 -24.588 18.747 1.00115.61 O
ATOM 4743 N SER A 826 5.884 -30.279 17.250 1.00112.25 N
ATOM 4744 CA SER A 826 6.695 -29.679 16.198 1.00112.25 C
ATOM 4745 C SER A 826 6.481 -30.389 14.873 1.00112.25 C
ATOM 4746 O SER A 826 6.359 -29.732 13.829 1.00112.25 O
ATOM 4747 CB SER A 826 8.170 -29.709 16.590 1.00112.25 C
ATOM 4748 OG SER A 826 8.645 -31.039 16.664 1.00112.25 O
ATOM 4749 N GLY A 827 6.339 -31.720 14.915 1.00106.63 N
ATOM 4750 CA GLY A 827 6.050 -32.459 13.700 1.00106.63 C
ATOM 4751 C GLY A 827 4.713 -32.065 13.118 1.00106.63 C
ATOM 4752 O GLY A 827 4.593 -31.849 11.908 1.00106.63 O
ATOM 4753 N ARG A 828 3.731 -31.850 13.999 1.00106.95 N
ATOM 4754 CA ARG A 828 2.417 -31.375 13.594 1.00106.95 C
ATOM 4755 C ARG A 828 2.522 -30.013 12.925 1.00106.95 C
ATOM 4756 O ARG A 828 1.871 -29.765 11.898 1.00106.95 O
ATOM 4757 CB ARG A 828 1.508 -31.343 14.826 1.00106.95 C
ATOM 4758 CG ARG A 828 0.080 -30.891 14.628 1.00106.95 C
ATOM 4759 CD ARG A 828 -0.094 -29.467 15.094 1.00106.95 C
ATOM 4760 NE ARG A 828 -1.491 -29.062 15.093 1.00106.95 N
ATOM 4761 CZ ARG A 828 -2.315 -29.274 16.110 1.00106.95 C
ATOM 4762 NH1 ARG A 828 -1.876 -29.891 17.197 1.00106.95 N
ATOM 4763 NH2 ARG A 828 -3.577 -28.875 16.042 1.00106.95 N
ATOM 4764 N VAL A 829 3.419 -29.161 13.447 1.00107.12 N
ATOM 4765 CA VAL A 829 3.657 -27.836 12.879 1.00107.12 C
ATOM 4766 C VAL A 829 4.125 -27.955 11.440 1.00107.12 C
ATOM 4767 O VAL A 829 3.634 -27.236 10.555 1.00107.12 O
ATOM 4768 CB VAL A 829 4.671 -27.064 13.743 1.00107.12 C
ATOM 4769 CG1 VAL A 829 5.083 -25.774 13.072 1.00107.12 C
ATOM 4770 CG2 VAL A 829 4.080 -26.759 15.093 1.00107.12 C
ATOM 4771 N ILE A 830 4.988 -28.951 11.178 1.00103.99 N
ATOM 4772 CA ILE A 830 5.525 -29.196 9.843 1.00103.99 C
ATOM 4773 C ILE A 830 4.402 -29.453 8.857 1.00103.99 C
ATOM 4774 O ILE A 830 4.367 -28.846 7.773 1.00103.99 O
ATOM 4775 CB ILE A 830 6.514 -30.373 9.883 1.00103.99 C
ATOM 4776 CG1 ILE A 830 7.739 -30.013 10.710 1.00103.99 C
ATOM 4777 CG2 ILE A 830 6.918 -30.788 8.494 1.00103.99 C
ATOM 4778 CD1 ILE A 830 8.628 -31.192 10.980 1.00103.99 C
ATOM 4779 N PHE A 831 3.398 -30.239 9.289 1.00103.30 N
ATOM 4780 CA PHE A 831 2.279 -30.585 8.419 1.00103.30 C
ATOM 4781 C PHE A 831 1.527 -29.344 7.986 1.00103.30 C
ATOM 4782 O PHE A 831 1.236 -29.183 6.790 1.00103.30 O
ATOM 4783 CB PHE A 831 1.326 -31.549 9.119 1.00103.30 C
ATOM 4784 CG PHE A 831 1.864 -32.933 9.271 1.00103.30 C
ATOM 4785 CD1 PHE A 831 1.958 -33.765 8.180 1.00103.30 C
ATOM 4786 CD2 PHE A 831 2.222 -33.421 10.511 1.00103.30 C
ATOM 4787 CE1 PHE A 831 2.440 -35.050 8.304 1.00103.30 C
ATOM 4788 CE2 PHE A 831 2.705 -34.709 10.650 1.00103.30 C
ATOM 4789 CZ PHE A 831 2.813 -35.525 9.542 1.00103.30 C
ATOM 4790 N CYS A 832 1.345 -28.403 8.925 1.00100.85 N
ATOM 4791 CA CYS A 832 0.601 -27.183 8.643 1.00100.85 C
ATOM 4792 C CYS A 832 1.275 -26.379 7.548 1.00100.85 C
ATOM 4793 O CYS A 832 0.611 -25.952 6.594 1.00100.85 O
ATOM 4794 CB CYS A 832 0.461 -26.354 9.914 1.00100.85 C
ATOM 4795 SG CYS A 832 -0.496 -27.175 11.197 1.00100.85 S
ATOM 4796 N LEU A 833 2.613 -26.301 7.598 1.00 94.35 N
ATOM 4797 CA LEU A 833 3.341 -25.552 6.584 1.00 94.35 C
ATOM 4798 C LEU A 833 3.191 -26.213 5.230 1.00 94.35 C
ATOM 4799 O LEU A 833 2.863 -25.540 4.241 1.00 94.35 O
ATOM 4800 CB LEU A 833 4.810 -25.439 6.968 1.00 94.35 C
ATOM 4801 CG LEU A 833 5.059 -24.614 8.222 1.00 94.35 C
ATOM 4802 CD1 LEU A 833 6.525 -24.653 8.603 1.00 94.35 C
ATOM 4803 CD2 LEU A 833 4.594 -23.193 7.992 1.00 94.35 C
ATOM 4804 N ASP A 834 3.278 -27.553 5.211 1.00 88.83 N
ATOM 4805 CA ASP A 834 3.136 -28.298 3.968 1.00 88.83 C
ATOM 4806 C ASP A 834 1.748 -28.105 3.395 1.00 88.83 C
ATOM 4807 O ASP A 834 1.594 -27.974 2.170 1.00 88.83 O
ATOM 4808 CB ASP A 834 3.417 -29.778 4.206 1.00 88.83 C
ATOM 4809 N TYR A 835 0.758 -27.949 4.292 1.00 85.42 N
ATOM 4810 CA TYR A 835 -0.627 -27.725 3.900 1.00 85.42 C
ATOM 4811 C TYR A 835 -0.759 -26.501 3.020 1.00 85.42 C
ATOM 4812 O TYR A 835 -1.356 -26.581 1.936 1.00 85.42 O
ATOM 4813 CB TYR A 835 -1.497 -27.577 5.146 1.00 85.42 C
ATOM 4814 CG TYR A 835 -2.920 -27.189 4.861 1.00 85.42 C
ATOM 4815 CD1 TYR A 835 -3.778 -28.071 4.245 1.00 85.42 C
ATOM 4816 CD2 TYR A 835 -3.415 -25.954 5.242 1.00 85.42 C
ATOM 4817 CE1 TYR A 835 -5.082 -27.737 3.993 1.00 85.42 C
ATOM 4818 CE2 TYR A 835 -4.729 -25.609 4.993 1.00 85.42 C
ATOM 4819 CZ TYR A 835 -5.551 -26.507 4.366 1.00 85.42 C
ATOM 4820 OH TYR A 835 -6.856 -26.171 4.120 1.00 85.42 O
ATOM 4821 N ILE A 836 -0.081 -25.411 3.405 1.00 80.28 N
ATOM 4822 CA ILE A 836 -0.183 -24.168 2.652 1.00 80.28 C
ATOM 4823 C ILE A 836 0.391 -24.356 1.263 1.00 80.28 C
ATOM 4824 O ILE A 836 -0.226 -23.941 0.270 1.00 80.28 O
ATOM 4825 CB ILE A 836 0.504 -23.020 3.410 1.00 80.28 C
ATOM 4826 CG1 ILE A 836 -0.277 -22.680 4.669 1.00 80.28 C
ATOM 4827 CG2 ILE A 836 0.614 -21.788 2.555 1.00 80.28 C
ATOM 4828 CD1 ILE A 836 0.434 -21.703 5.553 1.00 80.28 C
ATOM 4829 N VAL A 837 1.473 -25.139 1.164 1.00 80.38 N
ATOM 4830 CA VAL A 837 2.122 -25.343 -0.124 1.00 80.38 C
ATOM 4831 C VAL A 837 1.208 -26.124 -1.050 1.00 80.38 C
ATOM 4832 O VAL A 837 1.098 -25.794 -2.240 1.00 80.38 O
ATOM 4833 CB VAL A 837 3.479 -26.042 0.048 1.00 80.38 C
ATOM 4834 CG1 VAL A 837 4.192 -26.118 -1.286 1.00 80.38 C
ATOM 4835 CG2 VAL A 837 4.321 -25.308 1.046 1.00 80.38 C
ATOM 4836 N PHE A 838 0.445 -27.083 -0.491 1.00 77.71 N
ATOM 4837 CA PHE A 838 -0.496 -27.834 -1.320 1.00 77.71 C
ATOM 4838 C PHE A 838 -1.566 -26.920 -1.881 1.00 77.71 C
ATOM 4839 O PHE A 838 -1.871 -26.984 -3.081 1.00 77.71 O
ATOM 4840 CB PHE A 838 -1.139 -28.984 -0.547 1.00 77.71 C
ATOM 4841 CG PHE A 838 -0.242 -30.170 -0.365 1.00 77.71 C
ATOM 4842 CD1 PHE A 838 0.058 -30.997 -1.435 1.00 77.71 C
ATOM 4843 CD2 PHE A 838 0.253 -30.493 0.882 1.00 77.71 C
ATOM 4844 CE1 PHE A 838 0.877 -32.095 -1.268 1.00 77.71 C
ATOM 4845 CE2 PHE A 838 1.068 -31.586 1.056 1.00 77.71 C
ATOM 4846 CZ PHE A 838 1.378 -32.389 -0.019 1.00 77.71 C
ATOM 4847 N THR A 839 -2.041 -25.978 -1.054 1.00 72.35 N
ATOM 4848 CA THR A 839 -3.029 -25.010 -1.509 1.00 72.35 C
ATOM 4849 C THR A 839 -2.457 -24.150 -2.619 1.00 72.35 C
ATOM 4850 O THR A 839 -3.125 -23.929 -3.640 1.00 72.35 O
ATOM 4851 CB THR A 839 -3.490 -24.149 -0.341 1.00 72.35 C
ATOM 4852 OG1 THR A 839 -4.004 -24.995 0.689 1.00 72.35 O
ATOM 4853 CG2 THR A 839 -4.588 -23.219 -0.781 1.00 72.35 C
ATOM 4854 N LEU A 840 -1.177 -23.775 -2.489 1.00 75.93 N
ATOM 4855 CA LEU A 840 -0.546 -22.949 -3.509 1.00 75.93 C
ATOM 4856 C LEU A 840 -0.447 -23.710 -4.815 1.00 75.93 C
ATOM 4857 O LEU A 840 -0.677 -23.133 -5.888 1.00 75.93 O
ATOM 4858 CB LEU A 840 0.831 -22.486 -3.047 1.00 75.93 C
ATOM 4859 CG LEU A 840 0.815 -21.569 -1.827 1.00 75.93 C
ATOM 4860 CD1 LEU A 840 2.220 -21.199 -1.423 1.00 75.93 C
ATOM 4861 CD2 LEU A 840 -0.006 -20.336 -2.092 1.00 75.93 C
ATOM 4862 N ARG A 841 -0.230 -25.031 -4.717 1.00 72.24 N
ATOM 4863 CA ARG A 841 -0.195 -25.883 -5.895 1.00 72.24 C
ATOM 4864 C ARG A 841 -1.508 -25.803 -6.644 1.00 72.24 C
ATOM 4865 O ARG A 841 -1.519 -25.514 -7.852 1.00 72.24 O
ATOM 4866 CB ARG A 841 0.092 -27.323 -5.486 1.00 72.24 C
ATOM 4867 CG ARG A 841 0.202 -28.263 -6.658 1.00 72.24 C
ATOM 4868 CD ARG A 841 1.435 -27.927 -7.471 1.00 72.24 C
ATOM 4869 NE ARG A 841 1.616 -28.828 -8.599 1.00 72.24 N
ATOM 4870 CZ ARG A 841 1.077 -28.631 -9.794 1.00 72.24 C
ATOM 4871 NH1 ARG A 841 1.288 -29.498 -10.771 1.00 72.24 N
ATOM 4872 NH2 ARG A 841 0.329 -27.561 -10.010 1.00 72.24 N
ATOM 4873 N LEU A 842 -2.616 -25.882 -5.893 1.00 65.35 N
ATOM 4874 CA LEU A 842 -3.947 -25.812 -6.481 1.00 65.35 C
ATOM 4875 C LEU A 842 -4.159 -24.491 -7.189 1.00 65.35 C
ATOM 4876 O LEU A 842 -4.657 -24.469 -8.325 1.00 65.35 O
ATOM 4877 CB LEU A 842 -5.011 -26.002 -5.404 1.00 65.35 C
ATOM 4878 CG LEU A 842 -6.448 -25.954 -5.905 1.00 65.35 C
ATOM 4879 CD1 LEU A 842 -6.659 -27.069 -6.888 1.00 65.35 C
ATOM 4880 CD2 LEU A 842 -7.428 -26.059 -4.761 1.00 65.35 C
ATOM 4881 N ILE A 843 -3.664 -23.399 -6.587 1.00 62.22 N
ATOM 4882 CA ILE A 843 -3.947 -22.076 -7.128 1.00 62.22 C
ATOM 4883 C ILE A 843 -3.246 -21.905 -8.463 1.00 62.22 C
ATOM 4884 O ILE A 843 -3.820 -21.325 -9.400 1.00 62.22 O
ATOM 4885 CB ILE A 843 -3.572 -20.983 -6.112 1.00 62.22 C
ATOM 4886 CG1 ILE A 843 -4.448 -21.119 -4.876 1.00 62.22 C
ATOM 4887 CG2 ILE A 843 -3.820 -19.615 -6.670 1.00 62.22 C
ATOM 4888 CD1 ILE A 843 -4.076 -20.186 -3.767 1.00 62.22 C
ATOM 4889 N HIS A 844 -2.078 -22.558 -8.622 1.00 63.23 N
ATOM 4890 CA HIS A 844 -1.352 -22.447 -9.882 1.00 63.23 C
ATOM 4891 C HIS A 844 -2.146 -23.051 -11.021 1.00 63.23 C
ATOM 4892 O HIS A 844 -2.194 -22.472 -12.115 1.00 63.23 O
ATOM 4893 CB HIS A 844 0.017 -23.106 -9.811 1.00 63.23 C
ATOM 4894 CG HIS A 844 0.714 -23.142 -11.134 1.00 63.23 C
ATOM 4895 ND1 HIS A 844 1.229 -22.016 -11.735 1.00 63.23 N
ATOM 4896 CD2 HIS A 844 0.948 -24.164 -11.991 1.00 63.23 C
ATOM 4897 CE1 HIS A 844 1.766 -22.344 -12.896 1.00 63.23 C
ATOM 4898 NE2 HIS A 844 1.610 -23.642 -13.074 1.00 63.23 N
ATOM 4899 N ILE A 845 -2.872 -24.140 -10.734 1.00 59.99 N
ATOM 4900 CA ILE A 845 -3.683 -24.794 -11.751 1.00 59.99 C
ATOM 4901 C ILE A 845 -4.766 -23.850 -12.240 1.00 59.99 C
ATOM 4902 O ILE A 845 -4.961 -23.687 -13.455 1.00 59.99 O
ATOM 4903 CB ILE A 845 -4.280 -26.095 -11.201 1.00 59.99 C
ATOM 4904 CG1 ILE A 845 -3.163 -27.022 -10.742 1.00 59.99 C
ATOM 4905 CG2 ILE A 845 -5.075 -26.785 -12.272 1.00 59.99 C
ATOM 4906 CD1 ILE A 845 -3.651 -28.204 -9.945 1.00 59.99 C
ATOM 4907 N PHE A 846 -5.386 -23.116 -11.307 1.00 56.48 N
ATOM 4908 CA PHE A 846 -6.417 -22.167 -11.702 1.00 56.48 C
ATOM 4909 C PHE A 846 -5.829 -21.030 -12.516 1.00 56.48 C
ATOM 4910 O PHE A 846 -6.417 -20.622 -13.526 1.00 56.48 O
ATOM 4911 CB PHE A 846 -7.165 -21.642 -10.484 1.00 56.48 C
ATOM 4912 CG PHE A 846 -8.136 -22.624 -9.917 1.00 56.48 C
ATOM 4913 CD1 PHE A 846 -9.358 -22.827 -10.529 1.00 56.48 C
ATOM 4914 CD2 PHE A 846 -7.837 -23.342 -8.776 1.00 56.48 C
ATOM 4915 CE1 PHE A 846 -10.259 -23.730 -10.018 1.00 56.48 C
ATOM 4916 CE2 PHE A 846 -8.737 -24.244 -8.256 1.00 56.48 C
ATOM 4917 CZ PHE A 846 -9.947 -24.439 -8.879 1.00 56.48 C
ATOM 4918 N THR A 847 -4.606 -20.603 -12.183 1.00 57.86 N
ATOM 4919 CA THR A 847 -4.018 -19.494 -12.923 1.00 57.86 C
ATOM 4920 C THR A 847 -3.571 -19.937 -14.303 1.00 57.86 C
ATOM 4921 O THR A 847 -3.332 -19.102 -15.180 1.00 57.86 O
ATOM 4922 CB THR A 847 -2.853 -18.889 -12.155 1.00 57.86 C
ATOM 4923 OG1 THR A 847 -1.869 -19.897 -11.918 1.00 57.86 O
ATOM 4924 CG2 THR A 847 -3.324 -18.329 -10.841 1.00 57.86 C
ATOM 4925 N VAL A 848 -3.472 -21.246 -14.530 1.00 57.36 N
ATOM 4926 CA VAL A 848 -3.259 -21.709 -15.892 1.00 57.36 C
ATOM 4927 C VAL A 848 -4.601 -21.942 -16.566 1.00 57.36 C
ATOM 4928 O VAL A 848 -4.770 -21.688 -17.764 1.00 57.36 O
ATOM 4929 CB VAL A 848 -2.371 -22.965 -15.896 1.00 57.36 C
ATOM 4930 CG1 VAL A 848 -2.138 -23.471 -17.303 1.00 57.36 C
ATOM 4931 CG2 VAL A 848 -1.047 -22.650 -15.241 1.00 57.36 C
ATOM 4932 N SER A 849 -5.598 -22.370 -15.791 1.00 58.30 N
ATOM 4933 CA SER A 849 -6.870 -22.738 -16.400 1.00 58.30 C
ATOM 4934 C SER A 849 -7.677 -21.507 -16.786 1.00 58.30 C
ATOM 4935 O SER A 849 -8.317 -21.484 -17.843 1.00 58.30 O
ATOM 4936 CB SER A 849 -7.674 -23.614 -15.452 1.00 58.30 C
ATOM 4937 OG SER A 849 -8.153 -22.840 -14.375 1.00 58.30 O
ATOM 4938 N ARG A 850 -7.667 -20.478 -15.941 1.00 62.67 N
ATOM 4939 CA ARG A 850 -8.401 -19.256 -16.254 1.00 62.67 C
ATOM 4940 C ARG A 850 -7.727 -18.483 -17.375 1.00 62.67 C
ATOM 4941 O ARG A 850 -8.384 -18.046 -18.324 1.00 62.67 O
ATOM 4942 CB ARG A 850 -8.508 -18.387 -15.007 1.00 62.67 C
ATOM 4943 CG ARG A 850 -9.139 -17.028 -15.206 1.00 62.67 C
ATOM 4944 CD ARG A 850 -10.626 -17.102 -15.410 1.00 62.67 C
ATOM 4945 NE ARG A 850 -11.199 -15.764 -15.491 1.00 62.67 N
ATOM 4946 CZ ARG A 850 -11.301 -15.061 -16.613 1.00 62.67 C
ATOM 4947 NH1 ARG A 850 -10.879 -15.573 -17.761 1.00 62.67 N
ATOM 4948 NH2 ARG A 850 -11.831 -13.849 -16.590 1.00 62.67 N
ATOM 4949 N ASN A 851 -6.413 -18.324 -17.294 1.00 61.05 N
ATOM 4950 CA ASN A 851 -5.666 -17.517 -18.242 1.00 61.05 C
ATOM 4951 C ASN A 851 -5.399 -18.232 -19.550 1.00 61.05 C
ATOM 4952 O ASN A 851 -4.789 -17.638 -20.441 1.00 61.05 O
ATOM 4953 CB ASN A 851 -4.347 -17.078 -17.625 1.00 61.05 C
ATOM 4954 CG ASN A 851 -4.538 -16.065 -16.544 1.00 61.05 C
ATOM 4955 OD1 ASN A 851 -5.338 -15.143 -16.682 1.00 61.05 O
ATOM 4956 ND2 ASN A 851 -3.819 -16.231 -15.446 1.00 61.05 N
ATOM 4957 N LEU A 852 -5.801 -19.494 -19.672 1.00 59.99 N
ATOM 4958 CA LEU A 852 -5.699 -20.190 -20.946 1.00 59.99 C
ATOM 4959 C LEU A 852 -6.593 -19.492 -21.959 1.00 59.99 C
ATOM 4960 O LEU A 852 -7.799 -19.342 -21.750 1.00 59.99 O
ATOM 4961 CB LEU A 852 -6.095 -21.651 -20.788 1.00 59.99 C
ATOM 4962 CG LEU A 852 -5.876 -22.574 -21.986 1.00 59.99 C
ATOM 4963 CD1 LEU A 852 -4.407 -22.761 -22.252 1.00 59.99 C
ATOM 4964 CD2 LEU A 852 -6.550 -23.915 -21.763 1.00 59.99 C
ATOM 4965 N GLY A 853 -5.988 -19.045 -23.048 1.00 58.04 N
ATOM 4966 CA GLY A 853 -6.509 -17.947 -23.816 1.00 58.04 C
ATOM 4967 C GLY A 853 -5.341 -17.021 -24.046 1.00 58.04 C
ATOM 4968 O GLY A 853 -4.221 -17.350 -23.650 1.00 58.04 O
ATOM 4969 N PRO A 854 -5.540 -15.869 -24.692 1.00 54.93 N
ATOM 4970 CA PRO A 854 -4.378 -15.124 -25.224 1.00 54.93 C
ATOM 4971 C PRO A 854 -3.501 -14.437 -24.186 1.00 54.93 C
ATOM 4972 O PRO A 854 -2.594 -13.689 -24.562 1.00 54.93 O
ATOM 4973 CB PRO A 854 -5.034 -14.101 -26.158 1.00 54.93 C
ATOM 4974 CG PRO A 854 -6.344 -14.681 -26.496 1.00 54.93 C
ATOM 4975 CD PRO A 854 -6.801 -15.393 -25.270 1.00 54.93 C
ATOM 4976 N LYS A 855 -3.732 -14.677 -22.901 1.00 60.73 N
ATOM 4977 CA LYS A 855 -3.016 -13.974 -21.853 1.00 60.73 C
ATOM 4978 C LYS A 855 -1.675 -14.614 -21.509 1.00 60.73 C
ATOM 4979 O LYS A 855 -0.872 -13.989 -20.801 1.00 60.73 O
ATOM 4980 CB LYS A 855 -3.892 -13.924 -20.608 1.00 60.73 C
ATOM 4981 CG LYS A 855 -5.215 -13.226 -20.826 1.00 60.73 C
ATOM 4982 CD LYS A 855 -6.040 -13.203 -19.557 1.00 60.73 C
ATOM 4983 CE LYS A 855 -7.432 -12.686 -19.840 1.00 60.73 C
ATOM 4984 NZ LYS A 855 -7.404 -11.263 -20.257 1.00 60.73 N
ATOM 4985 N ILE A 856 -1.410 -15.832 -21.995 1.00 63.58 N
ATOM 4986 CA ILE A 856 -0.340 -16.664 -21.437 1.00 63.58 C
ATOM 4987 C ILE A 856 1.031 -16.102 -21.784 1.00 63.58 C
ATOM 4988 O ILE A 856 1.981 -16.233 -21.002 1.00 63.58 O
ATOM 4989 CB ILE A 856 -0.494 -18.112 -21.929 1.00 63.58 C
ATOM 4990 CG1 ILE A 856 -1.890 -18.588 -21.623 1.00 63.58 C
ATOM 4991 CG2 ILE A 856 0.415 -19.044 -21.171 1.00 63.58 C
ATOM 4992 CD1 ILE A 856 -2.244 -19.803 -22.379 1.00 63.58 C
ATOM 4993 N ILE A 857 1.149 -15.468 -22.958 1.00 64.45 N
ATOM 4994 CA ILE A 857 2.365 -14.751 -23.340 1.00 64.45 C
ATOM 4995 C ILE A 857 2.717 -13.709 -22.294 1.00 64.45 C
ATOM 4996 O ILE A 857 3.886 -13.540 -21.928 1.00 64.45 O
ATOM 4997 CB ILE A 857 2.180 -14.104 -24.720 1.00 64.45 C
ATOM 4998 CG1 ILE A 857 1.955 -15.167 -25.774 1.00 64.45 C
ATOM 4999 CG2 ILE A 857 3.380 -13.272 -25.113 1.00 64.45 C
ATOM 5000 CD1 ILE A 857 1.505 -14.578 -27.064 1.00 64.45 C
ATOM 5001 N MET A 858 1.703 -13.008 -21.790 1.00 68.19 N
ATOM 5002 CA MET A 858 1.870 -12.202 -20.592 1.00 68.19 C
ATOM 5003 C MET A 858 2.304 -13.062 -19.420 1.00 68.19 C
ATOM 5004 O MET A 858 3.428 -12.910 -18.918 1.00 68.19 O
ATOM 5005 CB MET A 858 0.556 -11.505 -20.261 1.00 68.19 C
ATOM 5006 CG MET A 858 0.627 -10.520 -19.127 1.00 68.19 C
ATOM 5007 SD MET A 858 -1.020 -9.916 -18.732 1.00 68.19 S
ATOM 5008 CE MET A 858 -1.404 -9.019 -20.227 1.00 68.19 C
ATOM 5009 N LEU A 859 1.482 -14.068 -19.091 1.00 60.65 N
ATOM 5010 CA LEU A 859 1.379 -14.611 -17.738 1.00 60.65 C
ATOM 5011 C LEU A 859 2.698 -15.156 -17.220 1.00 60.65 C
ATOM 5012 O LEU A 859 3.206 -14.678 -16.195 1.00 60.65 O
ATOM 5013 CB LEU A 859 0.329 -15.708 -17.712 1.00 60.65 C
ATOM 5014 CG LEU A 859 0.173 -16.326 -16.337 1.00 60.65 C
ATOM 5015 CD1 LEU A 859 -0.364 -15.301 -15.389 1.00 60.65 C
ATOM 5016 CD2 LEU A 859 -0.746 -17.505 -16.431 1.00 60.65 C
ATOM 5017 N GLN A 860 3.285 -16.108 -17.954 1.00 60.44 N
ATOM 5018 CA GLN A 860 4.550 -16.730 -17.574 1.00 60.44 C
ATOM 5019 C GLN A 860 5.646 -15.699 -17.391 1.00 60.44 C
ATOM 5020 O GLN A 860 6.351 -15.715 -16.370 1.00 60.44 O
ATOM 5021 CB GLN A 860 4.967 -17.742 -18.631 1.00 60.44 C
ATOM 5022 CG GLN A 860 4.087 -18.944 -18.690 1.00 60.44 C
ATOM 5023 CD GLN A 860 4.477 -19.854 -19.811 1.00 60.44 C
ATOM 5024 OE1 GLN A 860 5.353 -19.527 -20.608 1.00 60.44 O
ATOM 5025 NE2 GLN A 860 3.837 -21.010 -19.883 1.00 60.44 N
ATOM 5026 N ARG A 861 5.734 -14.743 -18.332 1.00 64.98 N
ATOM 5027 CA ARG A 861 6.758 -13.706 -18.267 1.00 64.98 C
ATOM 5028 C ARG A 861 6.641 -12.904 -16.990 1.00 64.98 C
ATOM 5029 O ARG A 861 7.654 -12.679 -16.308 1.00 64.98 O
ATOM 5030 CB ARG A 861 6.666 -12.779 -19.473 1.00 64.98 C
ATOM 5031 CG ARG A 861 7.201 -13.360 -20.753 1.00 64.98 C
ATOM 5032 CD ARG A 861 7.062 -12.351 -21.874 1.00 64.98 C
ATOM 5033 NE ARG A 861 7.574 -12.851 -23.145 1.00 64.98 N
ATOM 5034 CZ ARG A 861 7.461 -12.200 -24.297 1.00 64.98 C
ATOM 5035 NH1 ARG A 861 6.840 -11.030 -24.338 1.00 64.98 N
ATOM 5036 NH2 ARG A 861 7.955 -12.723 -25.409 1.00 64.98 N
ATOM 5037 N MET A 862 5.395 -12.602 -16.590 1.00 64.24 N
ATOM 5038 CA MET A 862 5.139 -11.845 -15.371 1.00 64.24 C
ATOM 5039 C MET A 862 5.734 -12.548 -14.172 1.00 64.24 C
ATOM 5040 O MET A 862 6.529 -11.940 -13.436 1.00 64.24 O
ATOM 5041 CB MET A 862 3.640 -11.665 -15.173 1.00 64.24 C
ATOM 5042 CG MET A 862 2.967 -10.845 -16.231 1.00 64.24 C
ATOM 5043 SD MET A 862 3.626 -9.189 -16.242 1.00 64.24 S
ATOM 5044 CE MET A 862 3.047 -8.645 -14.647 1.00 64.24 C
ATOM 5045 N MET A 863 5.499 -13.871 -14.088 1.00 63.58 N
ATOM 5046 CA MET A 863 5.973 -14.679 -12.969 1.00 63.58 C
ATOM 5047 C MET A 863 7.476 -14.576 -12.834 1.00 63.58 C
ATOM 5048 O MET A 863 7.981 -14.242 -11.750 1.00 63.58 O
ATOM 5049 CB MET A 863 5.575 -16.140 -13.158 1.00 63.58 C
ATOM 5050 CG MET A 863 4.104 -16.429 -13.052 1.00 63.58 C
ATOM 5051 SD MET A 863 3.798 -18.189 -13.285 1.00 63.58 S
ATOM 5052 CE MET A 863 2.015 -18.231 -13.240 1.00 63.58 C
ATOM 5053 N ILE A 864 8.173 -14.665 -13.977 1.00 59.38 N
ATOM 5054 CA ILE A 864 9.630 -14.699 -13.979 1.00 59.38 C
ATOM 5055 C ILE A 864 10.177 -13.407 -13.413 1.00 59.38 C
ATOM 5056 O ILE A 864 10.970 -13.430 -12.458 1.00 59.38 O
ATOM 5057 CB ILE A 864 10.153 -14.964 -15.399 1.00 59.38 C
ATOM 5058 CG1 ILE A 864 9.663 -16.317 -15.891 1.00 59.38 C
ATOM 5059 CG2 ILE A 864 11.655 -14.940 -15.415 1.00 59.38 C
ATOM 5060 CD1 ILE A 864 9.893 -16.534 -17.356 1.00 59.38 C
ATOM 5061 N ASP A 865 9.608 -12.274 -13.853 1.00 63.01 N
ATOM 5062 CA ASP A 865 10.144 -10.983 -13.441 1.00 63.01 C
ATOM 5063 C ASP A 865 9.919 -10.760 -11.963 1.00 63.01 C
ATOM 5064 O ASP A 865 10.830 -10.295 -11.264 1.00 63.01 O
ATOM 5065 CB ASP A 865 9.531 -9.852 -14.258 1.00 63.01 C
ATOM 5066 CG ASP A 865 10.084 -9.791 -15.660 1.00 63.01 C
ATOM 5067 OD1 ASP A 865 11.244 -10.208 -15.854 1.00 63.01 O
ATOM 5068 OD2 ASP A 865 9.370 -9.321 -16.567 1.00 63.01 O
ATOM 5069 N VAL A 866 8.784 -11.241 -11.445 1.00 56.15 N
ATOM 5070 CA VAL A 866 8.484 -10.974 -10.048 1.00 56.15 C
ATOM 5071 C VAL A 866 9.406 -11.793 -9.162 1.00 56.15 C
ATOM 5072 O VAL A 866 9.904 -11.284 -8.143 1.00 56.15 O
ATOM 5073 CB VAL A 866 6.995 -11.224 -9.759 1.00 56.15 C
ATOM 5074 CG1 VAL A 866 6.683 -10.982 -8.305 1.00 56.15 C
ATOM 5075 CG2 VAL A 866 6.167 -10.294 -10.595 1.00 56.15 C
ATOM 5076 N PHE A 867 9.775 -13.010 -9.628 1.00 65.30 N
ATOM 5077 CA PHE A 867 10.778 -13.807 -8.925 1.00 65.30 C
ATOM 5078 C PHE A 867 12.079 -13.043 -8.795 1.00 65.30 C
ATOM 5079 O PHE A 867 12.590 -12.871 -7.677 1.00 65.30 O
ATOM 5080 CB PHE A 867 11.053 -15.134 -9.633 1.00 65.30 C
ATOM 5081 CG PHE A 867 10.077 -16.227 -9.327 1.00 65.30 C
ATOM 5082 CD1 PHE A 867 10.034 -16.791 -8.065 1.00 65.30 C
ATOM 5083 CD2 PHE A 867 9.303 -16.786 -10.332 1.00 65.30 C
ATOM 5084 CE1 PHE A 867 9.165 -17.821 -7.788 1.00 65.30 C
ATOM 5085 CE2 PHE A 867 8.445 -17.830 -10.066 1.00 65.30 C
ATOM 5086 CZ PHE A 867 8.389 -18.361 -8.797 1.00 65.30 C
ATOM 5087 N PHE A 868 12.530 -12.449 -9.908 1.00 58.25 N
ATOM 5088 CA PHE A 868 13.791 -11.727 -9.903 1.00 58.25 C
ATOM 5089 C PHE A 868 13.705 -10.528 -8.985 1.00 58.25 C
ATOM 5090 O PHE A 868 14.629 -10.289 -8.194 1.00 58.25 O
ATOM 5091 CB PHE A 868 14.162 -11.299 -11.315 1.00 58.25 C
ATOM 5092 CG PHE A 868 15.452 -10.563 -11.389 1.00 58.25 C
ATOM 5093 CD1 PHE A 868 16.644 -11.225 -11.192 1.00 58.25 C
ATOM 5094 CD2 PHE A 868 15.478 -9.212 -11.659 1.00 58.25 C
ATOM 5095 CE1 PHE A 868 17.838 -10.556 -11.253 1.00 58.25 C
ATOM 5096 CE2 PHE A 868 16.670 -8.536 -11.722 1.00 58.25 C
ATOM 5097 CZ PHE A 868 17.851 -9.210 -11.518 1.00 58.25 C
ATOM 5098 N PHE A 869 12.535 -9.871 -8.977 1.00 55.42 N
ATOM 5099 CA PHE A 869 12.319 -8.722 -8.110 1.00 55.42 C
ATOM 5100 C PHE A 869 12.471 -9.103 -6.656 1.00 55.42 C
ATOM 5101 O PHE A 869 13.219 -8.443 -5.919 1.00 55.42 O
ATOM 5102 CB PHE A 869 10.942 -8.121 -8.352 1.00 55.42 C
ATOM 5103 CG PHE A 869 10.499 -7.204 -7.263 1.00 55.42 C
ATOM 5104 CD1 PHE A 869 11.103 -5.982 -7.073 1.00 55.42 C
ATOM 5105 CD2 PHE A 869 9.461 -7.570 -6.426 1.00 55.42 C
ATOM 5106 CE1 PHE A 869 10.690 -5.150 -6.059 1.00 55.42 C
ATOM 5107 CE2 PHE A 869 9.048 -6.742 -5.419 1.00 55.42 C
ATOM 5108 CZ PHE A 869 9.663 -5.529 -5.237 1.00 55.42 C
ATOM 5109 N LEU A 870 11.876 -10.238 -6.268 1.00 57.61 N
ATOM 5110 CA LEU A 870 11.930 -10.651 -4.873 1.00 57.61 C
ATOM 5111 C LEU A 870 13.352 -10.975 -4.473 1.00 57.61 C
ATOM 5112 O LEU A 870 13.775 -10.636 -3.356 1.00 57.61 O
ATOM 5113 CB LEU A 870 11.013 -11.844 -4.629 1.00 57.61 C
ATOM 5114 CG LEU A 870 9.529 -11.509 -4.673 1.00 57.61 C
ATOM 5115 CD1 LEU A 870 8.717 -12.768 -4.548 1.00 57.61 C
ATOM 5116 CD2 LEU A 870 9.199 -10.556 -3.553 1.00 57.61 C
ATOM 5117 N PHE A 871 14.128 -11.514 -5.426 1.00 61.15 N
ATOM 5118 CA PHE A 871 15.528 -11.817 -5.175 1.00 61.15 C
ATOM 5119 C PHE A 871 16.285 -10.561 -4.794 1.00 61.15 C
ATOM 5120 O PHE A 871 16.930 -10.522 -3.736 1.00 61.15 O
ATOM 5121 CB PHE A 871 16.153 -12.475 -6.399 1.00 61.15 C
ATOM 5122 CG PHE A 871 17.618 -12.705 -6.264 1.00 61.15 C
ATOM 5123 CD1 PHE A 871 18.101 -13.690 -5.429 1.00 61.15 C
ATOM 5124 CD2 PHE A 871 18.516 -11.932 -6.974 1.00 61.15 C
ATOM 5125 CE1 PHE A 871 19.454 -13.900 -5.300 1.00 61.15 C
ATOM 5126 CE2 PHE A 871 19.866 -12.134 -6.851 1.00 61.15 C
ATOM 5127 CZ PHE A 871 20.338 -13.121 -6.013 1.00 61.15 C
ATOM 5128 N LEU A 872 16.089 -9.485 -5.572 1.00 60.29 N
ATOM 5129 CA LEU A 872 16.762 -8.228 -5.275 1.00 60.29 C
ATOM 5130 C LEU A 872 16.302 -7.691 -3.942 1.00 60.29 C
ATOM 5131 O LEU A 872 17.131 -7.277 -3.119 1.00 60.29 O
ATOM 5132 CB LEU A 872 16.509 -7.208 -6.376 1.00 60.29 C
ATOM 5133 CG LEU A 872 17.178 -7.549 -7.699 1.00 60.29 C
ATOM 5134 CD1 LEU A 872 16.808 -6.537 -8.736 1.00 60.29 C
ATOM 5135 CD2 LEU A 872 18.667 -7.591 -7.525 1.00 60.29 C
ATOM 5136 N PHE A 873 15.004 -7.854 -3.660 1.00 63.05 N
ATOM 5137 CA PHE A 873 14.444 -7.372 -2.410 1.00 63.05 C
ATOM 5138 C PHE A 873 15.065 -8.099 -1.237 1.00 63.05 C
ATOM 5139 O PHE A 873 15.482 -7.455 -0.261 1.00 63.05 O
ATOM 5140 CB PHE A 873 12.933 -7.549 -2.418 1.00 63.05 C
ATOM 5141 CG PHE A 873 12.267 -7.069 -1.177 1.00 63.05 C
ATOM 5142 CD1 PHE A 873 12.143 -5.721 -0.926 1.00 63.05 C
ATOM 5143 CD2 PHE A 873 11.752 -7.967 -0.265 1.00 63.05 C
ATOM 5144 CE1 PHE A 873 11.528 -5.275 0.213 1.00 63.05 C
ATOM 5145 CE2 PHE A 873 11.131 -7.529 0.875 1.00 63.05 C
ATOM 5146 CZ PHE A 873 11.016 -6.180 1.112 1.00 63.05 C
ATOM 5147 N ALA A 874 15.277 -9.415 -1.394 1.00 66.15 N
ATOM 5148 CA ALA A 874 15.856 -10.205 -0.316 1.00 66.15 C
ATOM 5149 C ALA A 874 17.265 -9.739 -0.014 1.00 66.15 C
ATOM 5150 O ALA A 874 17.618 -9.564 1.164 1.00 66.15 O
ATOM 5151 CB ALA A 874 15.846 -11.687 -0.675 1.00 66.15 C
ATOM 5152 N VAL A 875 18.016 -9.393 -1.074 1.00 64.82 N
ATOM 5153 CA VAL A 875 19.389 -8.927 -0.920 1.00 64.82 C
ATOM 5154 C VAL A 875 19.415 -7.680 -0.069 1.00 64.82 C
ATOM 5155 O VAL A 875 20.127 -7.635 0.950 1.00 64.82 O
ATOM 5156 CB VAL A 875 20.034 -8.681 -2.293 1.00 64.82 C
ATOM 5157 CG1 VAL A 875 21.394 -8.059 -2.117 1.00 64.82 C
ATOM 5158 CG2 VAL A 875 20.157 -9.975 -3.048 1.00 64.82 C
ATOM 5159 N TRP A 876 18.495 -6.744 -0.364 1.00 72.96 N
ATOM 5160 CA TRP A 876 18.467 -5.470 0.340 1.00 72.96 C
ATOM 5161 C TRP A 876 18.205 -5.688 1.811 1.00 72.96 C
ATOM 5162 O TRP A 876 18.907 -5.116 2.659 1.00 72.96 O
ATOM 5163 CB TRP A 876 17.395 -4.547 -0.229 1.00 72.96 C
ATOM 5164 CG TRP A 876 17.420 -3.228 0.451 1.00 72.96 C
ATOM 5165 CD1 TRP A 876 18.283 -2.210 0.215 1.00 72.96 C
ATOM 5166 CD2 TRP A 876 16.620 -2.825 1.566 1.00 72.96 C
ATOM 5167 NE1 TRP A 876 18.034 -1.169 1.071 1.00 72.96 N
ATOM 5168 CE2 TRP A 876 17.022 -1.528 1.920 1.00 72.96 C
ATOM 5169 CE3 TRP A 876 15.595 -3.432 2.289 1.00 72.96 C
ATOM 5170 CZ2 TRP A 876 16.429 -0.824 2.957 1.00 72.96 C
ATOM 5171 CZ3 TRP A 876 15.007 -2.731 3.317 1.00 72.96 C
ATOM 5172 CH2 TRP A 876 15.426 -1.440 3.643 1.00 72.96 C
ATOM 5173 N MET A 877 17.309 -6.637 2.114 1.00 85.83 N
ATOM 5174 CA MET A 877 16.877 -6.827 3.488 1.00 85.83 C
ATOM 5175 C MET A 877 18.030 -7.323 4.334 1.00 85.83 C
ATOM 5176 O MET A 877 18.256 -6.805 5.439 1.00 85.83 O
ATOM 5177 CB MET A 877 15.705 -7.800 3.550 1.00 85.83 C
ATOM 5178 CG MET A 877 15.041 -7.844 4.905 1.00 85.83 C
ATOM 5179 SD MET A 877 14.259 -6.269 5.266 1.00 85.83 S
ATOM 5180 CE MET A 877 12.843 -6.358 4.191 1.00 85.83 C
ATOM 5181 N VAL A 878 18.863 -8.200 3.751 1.00 85.50 N
ATOM 5182 CA VAL A 878 19.975 -8.772 4.501 1.00 85.50 C
ATOM 5183 C VAL A 878 20.977 -7.686 4.835 1.00 85.50 C
ATOM 5184 O VAL A 878 21.443 -7.592 5.981 1.00 85.50 O
ATOM 5185 CB VAL A 878 20.615 -9.927 3.715 1.00 85.50 C
ATOM 5186 CG1 VAL A 878 21.861 -10.425 4.411 1.00 85.50 C
ATOM 5187 CG2 VAL A 878 19.621 -11.057 3.567 1.00 85.50 C
ATOM 5188 N ALA A 879 21.188 -6.764 3.884 1.00 83.85 N
ATOM 5189 CA ALA A 879 22.090 -5.646 4.109 1.00 83.85 C
ATOM 5190 C ALA A 879 21.594 -4.793 5.255 1.00 83.85 C
ATOM 5191 O ALA A 879 22.350 -4.534 6.207 1.00 83.85 O
ATOM 5192 CB ALA A 879 22.225 -4.818 2.839 1.00 83.85 C
ATOM 5193 N PHE A 880 20.280 -4.507 5.250 1.00 89.48 N
ATOM 5194 CA PHE A 880 19.657 -3.723 6.309 1.00 89.48 C
ATOM 5195 C PHE A 880 19.873 -4.378 7.652 1.00 89.48 C
ATOM 5196 O PHE A 880 20.349 -3.721 8.592 1.00 89.48 O
ATOM 5197 CB PHE A 880 18.165 -3.560 6.040 1.00 89.48 C
ATOM 5198 CG PHE A 880 17.438 -2.786 7.102 1.00 89.48 C
ATOM 5199 CD1 PHE A 880 17.557 -1.410 7.172 1.00 89.48 C
ATOM 5200 CD2 PHE A 880 16.627 -3.432 8.024 1.00 89.48 C
ATOM 5201 CE1 PHE A 880 16.890 -0.693 8.146 1.00 89.48 C
ATOM 5202 CE2 PHE A 880 15.957 -2.720 9.000 1.00 89.48 C
ATOM 5203 CZ PHE A 880 16.088 -1.349 9.059 1.00 89.48 C
ATOM 5204 N GLY A 881 19.705 -5.709 7.687 1.00 97.80 N
ATOM 5205 CA GLY A 881 19.813 -6.443 8.933 1.00 97.80 C
ATOM 5206 C GLY A 881 21.187 -6.318 9.548 1.00 97.80 C
ATOM 5207 O GLY A 881 21.306 -5.981 10.733 1.00 97.80 O
ATOM 5208 N VAL A 882 22.230 -6.418 8.710 1.00 96.50 N
ATOM 5209 CA VAL A 882 23.593 -6.332 9.218 1.00 96.50 C
ATOM 5210 C VAL A 882 23.840 -4.944 9.765 1.00 96.50 C
ATOM 5211 O VAL A 882 24.242 -4.788 10.931 1.00 96.50 O
ATOM 5212 CB VAL A 882 24.604 -6.695 8.119 1.00 96.50 C
ATOM 5213 CG1 VAL A 882 26.011 -6.477 8.617 1.00 96.50 C
ATOM 5214 CG2 VAL A 882 24.411 -8.132 7.691 1.00 96.50 C
ATOM 5215 N ALA A 883 23.412 -3.933 8.999 1.00100.01 N
ATOM 5216 CA ALA A 883 23.599 -2.548 9.402 1.00100.01 C
ATOM 5217 C ALA A 883 22.834 -2.267 10.675 1.00100.01 C
ATOM 5218 O ALA A 883 23.358 -1.602 11.582 1.00100.01 O
ATOM 5219 CB ALA A 883 23.147 -1.615 8.287 1.00100.01 C
ATOM 5220 N ARG A 884 21.666 -2.911 10.814 1.00112.66 N
ATOM 5221 CA ARG A 884 20.811 -2.678 11.967 1.00112.66 C
ATOM 5222 C ARG A 884 21.500 -3.131 13.237 1.00112.66 C
ATOM 5223 O ARG A 884 21.567 -2.376 14.217 1.00112.66 O
ATOM 5224 CB ARG A 884 19.486 -3.405 11.789 1.00112.66 C
ATOM 5225 CG ARG A 884 18.513 -3.136 12.894 1.00112.66 C
ATOM 5226 CD ARG A 884 17.220 -3.856 12.642 1.00112.66 C
ATOM 5227 NE ARG A 884 16.255 -3.620 13.706 1.00112.66 N
ATOM 5228 CZ ARG A 884 15.037 -4.143 13.719 1.00112.66 C
ATOM 5229 NH1 ARG A 884 14.205 -3.885 14.719 1.00112.66 N
ATOM 5230 NH2 ARG A 884 14.660 -4.929 12.725 1.00112.66 N
ATOM 5231 N GLN A 885 22.144 -4.303 13.187 1.00119.94 N
ATOM 5232 CA GLN A 885 22.771 -4.803 14.400 1.00119.94 C
ATOM 5233 C GLN A 885 24.014 -3.994 14.710 1.00119.94 C
ATOM 5234 O GLN A 885 24.317 -3.739 15.885 1.00119.94 O
ATOM 5235 CB GLN A 885 23.080 -6.290 14.274 1.00119.94 C
ATOM 5236 CG GLN A 885 23.567 -6.907 15.564 1.00119.94 C
ATOM 5237 CD GLN A 885 23.616 -8.409 15.497 1.00119.94 C
ATOM 5238 OE1 GLN A 885 23.278 -9.004 14.478 1.00119.94 O
ATOM 5239 NE2 GLN A 885 24.032 -9.037 16.588 1.00119.94 N
ATOM 5240 N GLY A 886 24.647 -3.453 13.659 1.00111.24 N
ATOM 5241 CA GLY A 886 25.804 -2.599 13.853 1.00111.24 C
ATOM 5242 C GLY A 886 25.457 -1.332 14.604 1.00111.24 C
ATOM 5243 O GLY A 886 26.285 -0.775 15.326 1.00111.24 O
ATOM 5244 N ILE A 887 24.206 -0.892 14.492 1.00115.15 N
ATOM 5245 CA ILE A 887 23.795 0.267 15.266 1.00115.15 C
ATOM 5246 C ILE A 887 23.398 -0.159 16.672 1.00115.15 C
ATOM 5247 O ILE A 887 23.732 0.508 17.658 1.00115.15 O
ATOM 5248 CB ILE A 887 22.665 1.017 14.542 1.00115.15 C
ATOM 5249 CG1 ILE A 887 23.165 1.502 13.183 1.00115.15 C
ATOM 5250 CG2 ILE A 887 22.196 2.210 15.346 1.00115.15 C
ATOM 5251 CD1 ILE A 887 22.082 2.049 12.292 1.00115.15 C
ATOM 5252 N LEU A 888 22.729 -1.307 16.797 1.00126.49 N
ATOM 5253 CA LEU A 888 21.925 -1.519 17.999 1.00126.49 C
ATOM 5254 C LEU A 888 22.700 -2.246 19.088 1.00126.49 C
ATOM 5255 O LEU A 888 22.756 -1.785 20.233 1.00126.49 O
ATOM 5256 CB LEU A 888 20.640 -2.269 17.657 1.00126.49 C
ATOM 5257 CG LEU A 888 19.644 -1.490 16.797 1.00126.49 C
ATOM 5258 CD1 LEU A 888 18.416 -2.333 16.518 1.00126.49 C
ATOM 5259 CD2 LEU A 888 19.263 -0.174 17.449 1.00126.49 C
ATOM 5260 N ARG A 889 23.293 -3.389 18.764 1.00138.62 N
ATOM 5261 CA ARG A 889 23.948 -4.202 19.776 1.00138.62 C
ATOM 5262 C ARG A 889 25.386 -4.464 19.368 1.00138.62 C
ATOM 5263 O ARG A 889 25.649 -4.954 18.266 1.00138.62 O
ATOM 5264 CB ARG A 889 23.211 -5.532 19.987 1.00138.62 C
ATOM 5265 N LYS A 890 26.316 -4.138 20.263 1.00146.11 N
ATOM 5266 CA LYS A 890 27.733 -4.391 20.045 1.00146.11 C
ATOM 5267 C LYS A 890 28.278 -5.130 21.267 1.00146.11 C
ATOM 5268 O LYS A 890 28.875 -4.525 22.161 1.00146.11 O
ATOM 5269 CB LYS A 890 28.489 -3.090 19.782 1.00146.11 C
ATOM 5270 N ASN A 891 28.085 -6.449 21.263 1.00151.70 N
ATOM 5271 CA ASN A 891 28.550 -7.374 22.288 1.00151.70 C
ATOM 5272 C ASN A 891 28.267 -8.782 21.790 1.00151.70 C
ATOM 5273 O ASN A 891 27.667 -8.965 20.726 1.00151.70 O
ATOM 5274 CB ASN A 891 27.858 -7.152 23.640 1.00151.70 C
ATOM 5275 N GLU A 892 28.707 -9.768 22.583 1.00155.73 N
ATOM 5276 CA GLU A 892 28.253 -11.156 22.488 1.00155.73 C
ATOM 5277 C GLU A 892 28.521 -11.814 21.137 1.00155.73 C
ATOM 5278 O GLU A 892 27.598 -12.000 20.337 1.00155.73 O
ATOM 5279 CB GLU A 892 26.768 -11.246 22.843 1.00155.73 C
ATOM 5280 CG GLU A 892 26.483 -10.893 24.292 1.00155.73 C
ATOM 5281 CD GLU A 892 27.075 -11.896 25.267 1.00155.73 C
ATOM 5282 OE1 GLU A 892 27.114 -13.100 24.935 1.00155.73 O
ATOM 5283 OE2 GLU A 892 27.509 -11.479 26.361 1.00155.73 O
ATOM 5284 N HIS A 893 29.781 -12.159 20.869 1.00155.06 N
ATOM 5285 CA HIS A 893 30.220 -12.651 19.567 1.00155.06 C
ATOM 5286 C HIS A 893 29.929 -14.133 19.346 1.00155.06 C
ATOM 5287 O HIS A 893 30.710 -14.805 18.659 1.00155.06 O
ATOM 5288 CB HIS A 893 31.717 -12.388 19.381 1.00155.06 C
ATOM 5289 N ARG A 894 28.842 -14.640 19.919 1.00155.68 N
ATOM 5290 CA ARG A 894 28.489 -16.038 19.720 1.00155.68 C
ATOM 5291 C ARG A 894 28.111 -16.225 18.258 1.00155.68 C
ATOM 5292 O ARG A 894 27.396 -15.402 17.687 1.00155.68 O
ATOM 5293 CB ARG A 894 27.332 -16.437 20.633 1.00155.68 C
ATOM 5294 CG ARG A 894 27.596 -16.153 22.100 1.00155.68 C
ATOM 5295 CD ARG A 894 26.579 -16.840 22.994 1.00155.68 C
ATOM 5296 NE ARG A 894 26.836 -16.572 24.405 1.00155.68 N
ATOM 5297 CZ ARG A 894 27.799 -17.155 25.110 1.00155.68 C
ATOM 5298 NH1 ARG A 894 28.602 -18.038 24.532 1.00155.68 N
ATOM 5299 NH2 ARG A 894 27.962 -16.853 26.390 1.00155.68 N
ATOM 5300 N TRP A 895 28.587 -17.306 17.654 1.00155.81 N
ATOM 5301 CA TRP A 895 28.306 -17.563 16.248 1.00155.81 C
ATOM 5302 C TRP A 895 26.822 -17.776 15.966 1.00155.81 C
ATOM 5303 O TRP A 895 26.286 -17.249 14.993 1.00155.81 O
ATOM 5304 CB TRP A 895 29.100 -18.783 15.778 1.00155.81 C
ATOM 5305 CG TRP A 895 29.144 -18.943 14.296 1.00155.81 C
ATOM 5306 CD1 TRP A 895 28.134 -19.374 13.488 1.00155.81 C
ATOM 5307 CD2 TRP A 895 30.261 -18.683 13.440 1.00155.81 C
ATOM 5308 NE1 TRP A 895 28.552 -19.394 12.179 1.00155.81 N
ATOM 5309 CE2 TRP A 895 29.855 -18.974 12.123 1.00155.81 C
ATOM 5310 CE3 TRP A 895 31.565 -18.230 13.658 1.00155.81 C
ATOM 5311 CZ2 TRP A 895 30.705 -18.827 11.029 1.00155.81 C
ATOM 5312 CZ3 TRP A 895 32.408 -18.084 12.571 1.00155.81 C
ATOM 5313 CH2 TRP A 895 31.975 -18.381 11.274 1.00155.81 C
ATOM 5314 N GLU A 896 26.162 -18.549 16.822 1.00152.86 N
ATOM 5315 CA GLU A 896 24.739 -18.836 16.659 1.00152.86 C
ATOM 5316 C GLU A 896 23.832 -17.615 16.800 1.00152.86 C
ATOM 5317 O GLU A 896 22.887 -17.442 16.033 1.00152.86 O
ATOM 5318 CB GLU A 896 24.299 -19.925 17.641 1.00152.86 C
ATOM 5319 N TRP A 897 24.125 -16.773 17.786 1.00151.99 N
ATOM 5320 CA TRP A 897 23.315 -15.587 18.044 1.00151.99 C
ATOM 5321 C TRP A 897 23.311 -14.565 16.911 1.00151.99 C
ATOM 5322 O TRP A 897 22.265 -14.022 16.561 1.00151.99 O
ATOM 5323 CB TRP A 897 23.788 -14.910 19.333 1.00151.99 C
ATOM 5324 CG TRP A 897 23.574 -15.736 20.560 1.00151.99 C
ATOM 5325 CD1 TRP A 897 23.873 -17.057 20.723 1.00151.99 C
ATOM 5326 CD2 TRP A 897 23.030 -15.292 21.809 1.00151.99 C
ATOM 5327 NE1 TRP A 897 23.539 -17.466 21.991 1.00151.99 N
ATOM 5328 CE2 TRP A 897 23.020 -16.400 22.679 1.00151.99 C
ATOM 5329 CE3 TRP A 897 22.546 -14.066 22.274 1.00151.99 C
ATOM 5330 CZ2 TRP A 897 22.546 -16.319 23.987 1.00151.99 C
ATOM 5331 CZ3 TRP A 897 22.076 -13.987 23.573 1.00151.99 C
ATOM 5332 CH2 TRP A 897 22.079 -15.106 24.413 1.00151.99 C
ATOM 5333 N ILE A 898 24.482 -14.310 16.340 1.00141.69 N
ATOM 5334 CA ILE A 898 24.605 -13.333 15.264 1.00141.69 C
ATOM 5335 C ILE A 898 23.844 -13.708 13.995 1.00141.69 C
ATOM 5336 O ILE A 898 23.199 -12.862 13.376 1.00141.69 O
ATOM 5337 CB ILE A 898 26.080 -13.069 14.916 1.00141.69 C
ATOM 5338 CG1 ILE A 898 26.825 -12.547 16.147 1.00141.69 C
ATOM 5339 CG2 ILE A 898 26.183 -12.081 13.765 1.00141.69 C
ATOM 5340 CD1 ILE A 898 28.290 -12.261 15.904 1.00141.69 C
ATOM 5341 N PHE A 899 23.915 -14.979 13.616 1.00141.44 N
ATOM 5342 CA PHE A 899 23.237 -15.451 12.416 1.00141.44 C
ATOM 5343 C PHE A 899 21.724 -15.316 12.524 1.00141.44 C
ATOM 5344 O PHE A 899 21.055 -14.929 11.569 1.00141.44 O
ATOM 5345 CB PHE A 899 23.603 -16.905 12.131 1.00141.44 C
ATOM 5346 CG PHE A 899 22.774 -17.534 11.053 1.00141.44 C
ATOM 5347 CD1 PHE A 899 23.309 -17.773 9.799 1.00141.44 C
ATOM 5348 CD2 PHE A 899 21.455 -17.877 11.290 1.00141.44 C
ATOM 5349 CE1 PHE A 899 22.546 -18.352 8.803 1.00141.44 C
ATOM 5350 CE2 PHE A 899 20.685 -18.454 10.299 1.00141.44 C
ATOM 5351 CZ PHE A 899 21.232 -18.692 9.053 1.00141.44 C
ATOM 5352 N ARG A 900 21.192 -15.639 13.698 1.00141.67 N
ATOM 5353 CA ARG A 900 19.751 -15.564 13.931 1.00141.67 C
ATOM 5354 C ARG A 900 19.231 -14.144 13.774 1.00141.67 C
ATOM 5355 O ARG A 900 18.166 -13.925 13.175 1.00141.67 O
ATOM 5356 CB ARG A 900 19.428 -16.082 15.335 1.00141.67 C
ATOM 5357 CG ARG A 900 19.522 -17.586 15.512 1.00141.67 C
ATOM 5358 CD ARG A 900 19.273 -17.975 16.960 1.00141.67 C
ATOM 5359 NE ARG A 900 19.227 -19.422 17.137 1.00141.67 N
ATOM 5360 CZ ARG A 900 19.051 -20.023 18.309 1.00141.67 C
ATOM 5361 NH1 ARG A 900 18.909 -19.300 19.412 1.00141.67 N
ATOM 5362 NH2 ARG A 900 19.018 -21.347 18.379 1.00141.67 N
ATOM 5363 N SER A 901 19.989 -13.172 14.288 1.00141.40 N
ATOM 5364 CA SER A 901 19.602 -11.772 14.181 1.00141.40 C
ATOM 5365 C SER A 901 19.582 -11.318 12.730 1.00141.40 C
ATOM 5366 O SER A 901 18.542 -10.874 12.232 1.00141.40 O
ATOM 5367 CB SER A 901 20.554 -10.900 14.997 1.00141.40 C
ATOM 5368 OG SER A 901 21.845 -10.884 14.417 1.00141.40 O
ATOM 5369 N VAL A 902 20.687 -11.524 12.011 1.00135.05 N
ATOM 5370 CA VAL A 902 20.826 -10.932 10.684 1.00135.05 C
ATOM 5371 C VAL A 902 20.046 -11.721 9.639 1.00135.05 C
ATOM 5372 O VAL A 902 19.978 -11.316 8.473 1.00135.05 O
ATOM 5373 CB VAL A 902 22.306 -10.808 10.294 1.00135.05 C
ATOM 5374 CG1 VAL A 902 23.034 -9.952 11.302 1.00135.05 C
ATOM 5375 CG2 VAL A 902 22.939 -12.181 10.154 1.00135.05 C
ATOM 5376 N ILE A 903 19.469 -12.859 10.008 1.00136.73 N
ATOM 5377 CA ILE A 903 18.459 -13.406 9.109 1.00136.73 C
ATOM 5378 C ILE A 903 17.046 -12.998 9.516 1.00136.73 C
ATOM 5379 O ILE A 903 16.340 -12.372 8.723 1.00136.73 O
ATOM 5380 CB ILE A 903 18.594 -14.928 8.951 1.00136.73 C
ATOM 5381 CG1 ILE A 903 19.808 -15.228 8.079 1.00136.73 C
ATOM 5382 CG2 ILE A 903 17.346 -15.521 8.317 1.00136.73 C
ATOM 5383 CD1 ILE A 903 20.034 -16.677 7.836 1.00136.73 C
ATOM 5384 N TYR A 904 16.566 -13.303 10.725 1.00137.86 N
ATOM 5385 CA TYR A 904 15.136 -13.131 10.960 1.00137.86 C
ATOM 5386 C TYR A 904 14.775 -12.026 11.951 1.00137.86 C
ATOM 5387 O TYR A 904 13.677 -12.060 12.512 1.00137.86 O
ATOM 5388 CB TYR A 904 14.482 -14.459 11.366 1.00137.86 C
ATOM 5389 CG TYR A 904 14.994 -15.155 12.611 1.00137.86 C
ATOM 5390 CD1 TYR A 904 15.932 -16.177 12.524 1.00137.86 C
ATOM 5391 CD2 TYR A 904 14.508 -14.817 13.868 1.00137.86 C
ATOM 5392 CE1 TYR A 904 16.374 -16.830 13.657 1.00137.86 C
ATOM 5393 CE2 TYR A 904 14.953 -15.453 15.003 1.00137.86 C
ATOM 5394 CZ TYR A 904 15.885 -16.453 14.895 1.00137.86 C
ATOM 5395 OH TYR A 904 16.306 -17.075 16.041 1.00137.86 O
ATOM 5396 N GLU A 905 15.627 -11.027 12.161 1.00138.06 N
ATOM 5397 CA GLU A 905 15.093 -9.825 12.798 1.00138.06 C
ATOM 5398 C GLU A 905 14.312 -8.904 11.852 1.00138.06 C
ATOM 5399 O GLU A 905 13.235 -8.448 12.260 1.00138.06 O
ATOM 5400 CB GLU A 905 16.192 -9.024 13.503 1.00138.06 C
ATOM 5401 CG GLU A 905 16.688 -9.632 14.783 1.00138.06 C
ATOM 5402 CD GLU A 905 17.753 -8.781 15.435 1.00138.06 C
ATOM 5403 OE1 GLU A 905 18.156 -7.765 14.831 1.00138.06 O
ATOM 5404 OE2 GLU A 905 18.195 -9.126 16.547 1.00138.06 O
ATOM 5405 N PRO A 906 14.777 -8.565 10.625 1.00133.85 N
ATOM 5406 CA PRO A 906 13.982 -7.618 9.817 1.00133.85 C
ATOM 5407 C PRO A 906 12.649 -8.157 9.327 1.00133.85 C
ATOM 5408 O PRO A 906 11.690 -7.384 9.190 1.00133.85 O
ATOM 5409 CB PRO A 906 14.919 -7.292 8.651 1.00133.85 C
ATOM 5410 CG PRO A 906 16.250 -7.604 9.121 1.00133.85 C
ATOM 5411 CD PRO A 906 16.073 -8.805 9.950 1.00133.85 C
ATOM 5412 N TYR A 907 12.558 -9.459 9.052 1.00133.66 N
ATOM 5413 CA TYR A 907 11.277 -10.026 8.653 1.00133.66 C
ATOM 5414 C TYR A 907 10.283 -10.010 9.807 1.00133.66 C
ATOM 5415 O TYR A 907 9.092 -9.762 9.600 1.00133.66 O
ATOM 5416 CB TYR A 907 11.464 -11.441 8.116 1.00133.66 C
ATOM 5417 CG TYR A 907 12.167 -11.484 6.783 1.00133.66 C
ATOM 5418 CD1 TYR A 907 11.491 -11.160 5.615 1.00133.66 C
ATOM 5419 CD2 TYR A 907 13.499 -11.862 6.689 1.00133.66 C
ATOM 5420 CE1 TYR A 907 12.124 -11.200 4.390 1.00133.66 C
ATOM 5421 CE2 TYR A 907 14.140 -11.907 5.469 1.00133.66 C
ATOM 5422 CZ TYR A 907 13.447 -11.575 4.324 1.00133.66 C
ATOM 5423 OH TYR A 907 14.081 -11.618 3.107 1.00133.66 O
ATOM 5424 N LEU A 908 10.754 -10.237 11.034 1.00133.95 N
ATOM 5425 CA LEU A 908 9.859 -10.125 12.182 1.00133.95 C
ATOM 5426 C LEU A 908 9.538 -8.670 12.491 1.00133.95 C
ATOM 5427 O LEU A 908 8.506 -8.373 13.103 1.00133.95 O
ATOM 5428 CB LEU A 908 10.460 -10.816 13.404 1.00133.95 C
ATOM 5429 CG LEU A 908 10.486 -12.345 13.366 1.00133.95 C
ATOM 5430 CD1 LEU A 908 11.204 -12.904 14.587 1.00133.95 C
ATOM 5431 CD2 LEU A 908 9.075 -12.911 13.263 1.00133.95 C
ATOM 5432 N ALA A 909 10.407 -7.747 12.077 1.00132.48 N
ATOM 5433 CA ALA A 909 10.139 -6.330 12.300 1.00132.48 C
ATOM 5434 C ALA A 909 9.073 -5.817 11.344 1.00132.48 C
ATOM 5435 O ALA A 909 8.151 -5.099 11.746 1.00132.48 O
ATOM 5436 CB ALA A 909 11.424 -5.522 12.151 1.00132.48 C
ATOM 5437 N MET A 910 9.195 -6.165 10.063 1.00139.09 N
ATOM 5438 CA MET A 910 8.206 -5.728 9.083 1.00139.09 C
ATOM 5439 C MET A 910 6.904 -6.511 9.228 1.00139.09 C
ATOM 5440 O MET A 910 5.815 -5.973 8.997 1.00139.09 O
ATOM 5441 CB MET A 910 8.781 -5.866 7.675 1.00139.09 C
ATOM 5442 CG MET A 910 7.888 -5.335 6.571 1.00139.09 C
ATOM 5443 SD MET A 910 8.661 -5.417 4.948 1.00139.09 S
ATOM 5444 CE MET A 910 9.834 -4.068 5.073 1.00139.09 C
ATOM 5445 N PHE A 911 6.996 -7.780 9.630 1.00138.38 N
ATOM 5446 CA PHE A 911 5.797 -8.585 9.836 1.00138.38 C
ATOM 5447 C PHE A 911 5.089 -8.199 11.127 1.00138.38 C
ATOM 5448 O PHE A 911 3.893 -7.888 11.118 1.00138.38 O
ATOM 5449 CB PHE A 911 6.170 -10.068 9.838 1.00138.38 C
ATOM 5450 CG PHE A 911 5.014 -10.990 10.090 1.00138.38 C
ATOM 5451 CD1 PHE A 911 4.044 -11.187 9.122 1.00138.38 C
ATOM 5452 CD2 PHE A 911 4.917 -11.685 11.287 1.00138.38 C
ATOM 5453 CE1 PHE A 911 2.981 -12.041 9.350 1.00138.38 C
ATOM 5454 CE2 PHE A 911 3.860 -12.543 11.520 1.00138.38 C
ATOM 5455 CZ PHE A 911 2.890 -12.722 10.550 1.00138.38 C
ATOM 5456 N GLY A 912 5.807 -8.203 12.244 1.00133.59 N
ATOM 5457 CA GLY A 912 5.228 -7.830 13.521 1.00133.59 C
ATOM 5458 C GLY A 912 5.586 -6.419 13.940 1.00133.59 C
ATOM 5459 O GLY A 912 4.906 -5.460 13.579 1.00133.59 O
ATOM 5460 N GLU A 952 23.577 12.361 16.260 1.00131.68 N
ATOM 5461 CA GLU A 952 22.202 12.785 16.022 1.00131.68 C
ATOM 5462 C GLU A 952 22.064 13.408 14.641 1.00131.68 C
ATOM 5463 O GLU A 952 20.968 13.765 14.216 1.00131.68 O
ATOM 5464 CB GLU A 952 21.752 13.777 17.094 1.00131.68 C
ATOM 5465 N TRP A 953 23.192 13.534 13.942 1.00140.23 N
ATOM 5466 CA TRP A 953 23.233 14.071 12.588 1.00140.23 C
ATOM 5467 C TRP A 953 23.141 12.954 11.544 1.00140.23 C
ATOM 5468 O TRP A 953 23.548 13.117 10.389 1.00140.23 O
ATOM 5469 CB TRP A 953 24.500 14.918 12.426 1.00140.23 C
ATOM 5470 CG TRP A 953 24.741 15.523 11.065 1.00140.23 C
ATOM 5471 CD1 TRP A 953 25.647 15.115 10.129 1.00140.23 C
ATOM 5472 CD2 TRP A 953 24.054 16.641 10.499 1.00140.23 C
ATOM 5473 NE1 TRP A 953 25.568 15.914 9.016 1.00140.23 N
ATOM 5474 CE2 TRP A 953 24.596 16.857 9.217 1.00140.23 C
ATOM 5475 CE3 TRP A 953 23.028 17.480 10.949 1.00140.23 C
ATOM 5476 CZ2 TRP A 953 24.148 17.877 8.381 1.00140.23 C
ATOM 5477 CZ3 TRP A 953 22.585 18.493 10.119 1.00140.23 C
ATOM 5478 CH2 TRP A 953 23.145 18.683 8.850 1.00140.23 C
ATOM 5479 N ILE A 954 22.586 11.804 11.936 1.00125.21 N
ATOM 5480 CA ILE A 954 22.358 10.710 11.003 1.00125.21 C
ATOM 5481 C ILE A 954 20.958 10.738 10.417 1.00125.21 C
ATOM 5482 O ILE A 954 20.547 9.764 9.775 1.00125.21 O
ATOM 5483 CB ILE A 954 22.607 9.350 11.685 1.00125.21 C
ATOM 5484 CG1 ILE A 954 21.635 9.158 12.852 1.00125.21 C
ATOM 5485 CG2 ILE A 954 24.043 9.261 12.164 1.00125.21 C
ATOM 5486 CD1 ILE A 954 21.625 7.758 13.422 1.00125.21 C
ATOM 5487 N THR A 955 20.205 11.819 10.630 1.00113.49 N
ATOM 5488 CA THR A 955 18.832 11.880 10.143 1.00113.49 C
ATOM 5489 C THR A 955 18.789 12.014 8.627 1.00113.49 C
ATOM 5490 O THR A 955 18.161 11.204 7.939 1.00113.49 O
ATOM 5491 CB THR A 955 18.096 13.043 10.805 1.00113.49 C
ATOM 5492 N ILE A 956 19.458 13.029 8.092 1.00104.89 N
ATOM 5493 CA ILE A 956 19.499 13.288 6.651 1.00104.89 C
ATOM 5494 C ILE A 956 20.224 12.208 5.837 1.00104.89 C
ATOM 5495 O ILE A 956 19.722 11.875 4.750 1.00104.89 O
ATOM 5496 CB ILE A 956 20.091 14.679 6.361 1.00104.89 C
ATOM 5497 N PRO A 957 21.373 11.629 6.258 1.00101.76 N
ATOM 5498 CA PRO A 957 21.923 10.522 5.452 1.00101.76 C
ATOM 5499 C PRO A 957 21.052 9.277 5.420 1.00101.76 C
ATOM 5500 O PRO A 957 20.902 8.673 4.353 1.00101.76 O
ATOM 5501 CB PRO A 957 23.280 10.250 6.107 1.00101.76 C
ATOM 5502 CG PRO A 957 23.646 11.497 6.736 1.00101.76 C
ATOM 5503 CD PRO A 957 22.377 12.048 7.263 1.00101.76 C
ATOM 5504 N LEU A 958 20.461 8.880 6.548 1.00 95.41 N
ATOM 5505 CA LEU A 958 19.546 7.743 6.544 1.00 95.41 C
ATOM 5506 C LEU A 958 18.301 8.050 5.720 1.00 95.41 C
ATOM 5507 O LEU A 958 17.795 7.194 4.984 1.00 95.41 O
ATOM 5508 CB LEU A 958 19.170 7.367 7.977 1.00 95.41 C
ATOM 5509 N VAL A 959 17.825 9.295 5.804 1.00 97.50 N
ATOM 5510 CA VAL A 959 16.652 9.721 5.055 1.00 97.50 C
ATOM 5511 C VAL A 959 16.906 9.757 3.557 1.00 97.50 C
ATOM 5512 O VAL A 959 15.967 9.579 2.775 1.00 97.50 O
ATOM 5513 CB VAL A 959 16.178 11.100 5.544 1.00 97.50 C
ATOM 5514 N CYS A 960 18.143 9.980 3.120 1.00 92.47 N
ATOM 5515 CA CYS A 960 18.354 9.895 1.680 1.00 92.47 C
ATOM 5516 C CYS A 960 18.719 8.483 1.232 1.00 92.47 C
ATOM 5517 O CYS A 960 18.458 8.118 0.079 1.00 92.47 O
ATOM 5518 CB CYS A 960 19.420 10.894 1.226 1.00 92.47 C
ATOM 5519 SG CYS A 960 21.093 10.589 1.799 1.00 92.47 S
ATOM 5520 N ILE A 961 19.294 7.671 2.126 1.00 84.10 N
ATOM 5521 CA ILE A 961 19.594 6.279 1.793 1.00 84.10 C
ATOM 5522 C ILE A 961 18.313 5.468 1.615 1.00 84.10 C
ATOM 5523 O ILE A 961 18.205 4.658 0.680 1.00 84.10 O
ATOM 5524 CB ILE A 961 20.535 5.672 2.852 1.00 84.10 C
ATOM 5525 CG1 ILE A 961 21.959 6.179 2.633 1.00 84.10 C
ATOM 5526 CG2 ILE A 961 20.515 4.161 2.850 1.00 84.10 C
ATOM 5527 CD1 ILE A 961 22.900 5.833 3.758 1.00 84.10 C
ATOM 5528 N TYR A 962 17.316 5.683 2.489 1.00 84.31 N
ATOM 5529 CA TYR A 962 16.005 5.064 2.278 1.00 84.31 C
ATOM 5530 C TYR A 962 15.375 5.501 0.959 1.00 84.31 C
ATOM 5531 O TYR A 962 14.740 4.692 0.277 1.00 84.31 O
ATOM 5532 CB TYR A 962 15.044 5.370 3.428 1.00 84.31 C
ATOM 5533 CG TYR A 962 15.197 4.507 4.664 1.00 84.31 C
ATOM 5534 CD1 TYR A 962 14.755 3.191 4.671 1.00 84.31 C
ATOM 5535 CD2 TYR A 962 15.710 5.027 5.841 1.00 84.31 C
ATOM 5536 CE1 TYR A 962 14.872 2.404 5.803 1.00 84.31 C
ATOM 5537 CE2 TYR A 962 15.828 4.249 6.976 1.00 84.31 C
ATOM 5538 CZ TYR A 962 15.406 2.943 6.949 1.00 84.31 C
ATOM 5539 OH TYR A 962 15.522 2.173 8.078 1.00 84.31 O
ATOM 5540 N MET A 963 15.577 6.762 0.567 1.00 77.57 N
ATOM 5541 CA MET A 963 15.034 7.243 -0.700 1.00 77.57 C
ATOM 5542 C MET A 963 15.700 6.561 -1.889 1.00 77.57 C
ATOM 5543 O MET A 963 15.020 6.156 -2.844 1.00 77.57 O
ATOM 5544 CB MET A 963 15.193 8.758 -0.792 1.00 77.57 C
ATOM 5545 N LEU A 964 17.026 6.407 -1.836 1.00 72.97 N
ATOM 5546 CA LEU A 964 17.747 5.716 -2.902 1.00 72.97 C
ATOM 5547 C LEU A 964 17.325 4.256 -3.001 1.00 72.97 C
ATOM 5548 O LEU A 964 17.132 3.721 -4.105 1.00 72.97 O
ATOM 5549 CB LEU A 964 19.250 5.821 -2.667 1.00 72.97 C
ATOM 5550 CG LEU A 964 19.810 7.224 -2.835 1.00 72.97 C
ATOM 5551 CD1 LEU A 964 21.278 7.243 -2.486 1.00 72.97 C
ATOM 5552 CD2 LEU A 964 19.583 7.678 -4.257 1.00 72.97 C
ATOM 5553 N SER A 965 17.156 3.603 -1.849 1.00 71.27 N
ATOM 5554 CA SER A 965 16.744 2.206 -1.844 1.00 71.27 C
ATOM 5555 C SER A 965 15.330 2.039 -2.384 1.00 71.27 C
ATOM 5556 O SER A 965 15.058 1.086 -3.123 1.00 71.27 O
ATOM 5557 CB SER A 965 16.852 1.637 -0.434 1.00 71.27 C
ATOM 5558 OG SER A 965 15.916 2.254 0.427 1.00 71.27 O
ATOM 5559 N THR A 966 14.424 2.969 -2.052 1.00 69.42 N
ATOM 5560 CA THR A 966 13.067 2.898 -2.590 1.00 69.42 C
ATOM 5561 C THR A 966 13.047 3.150 -4.086 1.00 69.42 C
ATOM 5562 O THR A 966 12.223 2.572 -4.801 1.00 69.42 O
ATOM 5563 CB THR A 966 12.139 3.880 -1.885 1.00 69.42 C
ATOM 5564 OG1 THR A 966 12.730 5.182 -1.889 1.00 69.42 O
ATOM 5565 CG2 THR A 966 11.833 3.421 -0.471 1.00 69.42 C
ATOM 5566 N ASN A 967 13.974 3.968 -4.584 1.00 61.72 N
ATOM 5567 CA ASN A 967 14.089 4.135 -6.029 1.00 61.72 C
ATOM 5568 C ASN A 967 14.501 2.835 -6.708 1.00 61.72 C
ATOM 5569 O ASN A 967 13.829 2.380 -7.646 1.00 61.72 O
ATOM 5570 CB ASN A 967 15.091 5.227 -6.360 1.00 61.72 C
ATOM 5571 CG ASN A 967 15.068 5.611 -7.819 1.00 61.72 C
ATOM 5572 OD1 ASN A 967 14.254 5.137 -8.611 1.00 61.72 O
ATOM 5573 ND2 ASN A 967 15.982 6.473 -8.187 1.00 61.72 N
ATOM 5574 N ILE A 968 15.611 2.234 -6.257 1.00 62.98 N
ATOM 5575 CA ILE A 968 16.144 1.041 -6.925 1.00 62.98 C
ATOM 5576 C ILE A 968 15.174 -0.121 -6.790 1.00 62.98 C
ATOM 5577 O ILE A 968 15.052 -0.965 -7.687 1.00 62.98 O
ATOM 5578 CB ILE A 968 17.518 0.667 -6.352 1.00 62.98 C
ATOM 5579 CG1 ILE A 968 18.451 1.842 -6.419 1.00 62.98 C
ATOM 5580 CG2 ILE A 968 18.178 -0.405 -7.180 1.00 62.98 C
ATOM 5581 CD1 ILE A 968 19.731 1.631 -5.654 1.00 62.98 C
ATOM 5582 N LEU A 969 14.432 -0.153 -5.688 1.00 62.53 N
ATOM 5583 CA LEU A 969 13.479 -1.223 -5.477 1.00 62.53 C
ATOM 5584 C LEU A 969 12.239 -1.035 -6.341 1.00 62.53 C
ATOM 5585 O LEU A 969 11.748 -1.998 -6.937 1.00 62.53 O
ATOM 5586 CB LEU A 969 13.116 -1.260 -3.998 1.00 62.53 C
ATOM 5587 CG LEU A 969 12.485 -2.526 -3.459 1.00 62.53 C
ATOM 5588 CD1 LEU A 969 13.545 -3.611 -3.508 1.00 62.53 C
ATOM 5589 CD2 LEU A 969 11.970 -2.289 -2.044 1.00 62.53 C
ATOM 5590 N LEU A 970 11.729 0.200 -6.436 1.00 59.83 N
ATOM 5591 CA LEU A 970 10.479 0.447 -7.147 1.00 59.83 C
ATOM 5592 C LEU A 970 10.646 0.318 -8.652 1.00 59.83 C
ATOM 5593 O LEU A 970 9.706 -0.091 -9.350 1.00 59.83 O
ATOM 5594 CB LEU A 970 9.957 1.837 -6.783 1.00 59.83 C
ATOM 5595 CG LEU A 970 8.655 2.338 -7.402 1.00 59.83 C
ATOM 5596 CD1 LEU A 970 7.510 1.416 -7.060 1.00 59.83 C
ATOM 5597 CD2 LEU A 970 8.366 3.736 -6.907 1.00 59.83 C
ATOM 5598 N VAL A 971 11.827 0.677 -9.173 1.00 59.48 N
ATOM 5599 CA VAL A 971 12.045 0.633 -10.620 1.00 59.48 C
ATOM 5600 C VAL A 971 11.986 -0.799 -11.138 1.00 59.48 C
ATOM 5601 O VAL A 971 11.437 -1.059 -12.214 1.00 59.48 O
ATOM 5602 CB VAL A 971 13.377 1.327 -10.965 1.00 59.48 C
ATOM 5603 CG1 VAL A 971 13.789 1.067 -12.376 1.00 59.48 C
ATOM 5604 CG2 VAL A 971 13.220 2.815 -10.804 1.00 59.48 C
ATOM 5605 N ASN A 972 12.462 -1.754 -10.336 1.00 60.30 N
ATOM 5606 CA ASN A 972 12.403 -3.161 -10.714 1.00 60.30 C
ATOM 5607 C ASN A 972 10.966 -3.662 -10.824 1.00 60.30 C
ATOM 5608 O ASN A 972 10.614 -4.363 -11.775 1.00 60.30 O
ATOM 5609 CB ASN A 972 13.181 -3.995 -9.702 1.00 60.30 C
ATOM 5610 CG ASN A 972 14.662 -3.930 -9.936 1.00 60.30 C
ATOM 5611 OD1 ASN A 972 15.141 -4.214 -11.030 1.00 60.30 O
ATOM 5612 ND2 ASN A 972 15.396 -3.490 -8.927 1.00 60.30 N
ATOM 5613 N LEU A 973 10.113 -3.291 -9.868 1.00 61.21 N
ATOM 5614 CA LEU A 973 8.730 -3.752 -9.902 1.00 61.21 C
ATOM 5615 C LEU A 973 7.956 -3.074 -11.023 1.00 61.21 C
ATOM 5616 O LEU A 973 7.079 -3.684 -11.645 1.00 61.21 O
ATOM 5617 CB LEU A 973 8.061 -3.519 -8.546 1.00 61.21 C
ATOM 5618 CG LEU A 973 6.660 -4.077 -8.286 1.00 61.21 C
ATOM 5619 CD1 LEU A 973 6.578 -4.537 -6.864 1.00 61.21 C
ATOM 5620 CD2 LEU A 973 5.587 -3.027 -8.505 1.00 61.21 C
ATOM 5621 N LEU A 974 8.267 -1.807 -11.301 1.00 63.76 N
ATOM 5622 CA LEU A 974 7.578 -1.130 -12.393 1.00 63.76 C
ATOM 5623 C LEU A 974 8.054 -1.640 -13.742 1.00 63.76 C
ATOM 5624 O LEU A 974 7.323 -1.560 -14.731 1.00 63.76 O
ATOM 5625 CB LEU A 974 7.759 0.376 -12.300 1.00 63.76 C
ATOM 5626 CG LEU A 974 7.053 1.013 -11.112 1.00 63.76 C
ATOM 5627 CD1 LEU A 974 7.326 2.497 -11.072 1.00 63.76 C
ATOM 5628 CD2 LEU A 974 5.574 0.734 -11.190 1.00 63.76 C
ATOM 5629 N VAL A 975 9.277 -2.165 -13.806 1.00 63.87 N
ATOM 5630 CA VAL A 975 9.664 -2.954 -14.968 1.00 63.87 C
ATOM 5631 C VAL A 975 8.898 -4.267 -14.983 1.00 63.87 C
ATOM 5632 O VAL A 975 8.452 -4.726 -16.037 1.00 63.87 O
ATOM 5633 CB VAL A 975 11.189 -3.163 -14.982 1.00 63.87 C
ATOM 5634 CG1 VAL A 975 11.608 -4.217 -15.988 1.00 63.87 C
ATOM 5635 CG2 VAL A 975 11.857 -1.873 -15.346 1.00 63.87 C
ATOM 5636 N ALA A 976 8.674 -4.852 -13.804 1.00 68.03 N
ATOM 5637 CA ALA A 976 8.080 -6.183 -13.723 1.00 68.03 C
ATOM 5638 C ALA A 976 6.605 -6.172 -14.100 1.00 68.03 C
ATOM 5639 O ALA A 976 6.065 -7.196 -14.529 1.00 68.03 O
ATOM 5640 CB ALA A 976 8.264 -6.749 -12.319 1.00 68.03 C
ATOM 5641 N MET A 977 5.932 -5.033 -13.931 1.00 75.16 N
ATOM 5642 CA MET A 977 4.577 -4.902 -14.457 1.00 75.16 C
ATOM 5643 C MET A 977 4.574 -4.966 -15.976 1.00 75.16 C
ATOM 5644 O MET A 977 3.605 -5.423 -16.587 1.00 75.16 O
ATOM 5645 CB MET A 977 3.937 -3.595 -13.990 1.00 75.16 C
ATOM 5646 CG MET A 977 3.542 -3.555 -12.528 1.00 75.16 C
ATOM 5647 SD MET A 977 2.683 -2.022 -12.130 1.00 75.16 S
ATOM 5648 CE MET A 977 2.376 -2.235 -10.381 1.00 75.16 C
ATOM 5649 N PHE A 978 5.638 -4.487 -16.597 1.00 76.98 N
ATOM 5650 CA PHE A 978 5.786 -4.484 -18.039 1.00 76.98 C
ATOM 5651 C PHE A 978 6.781 -5.551 -18.478 1.00 76.98 C
ATOM 5652 O PHE A 978 7.096 -6.490 -17.745 1.00 76.98 O
ATOM 5653 CB PHE A 978 6.194 -3.103 -18.509 1.00 76.98 C
ATOM 5654 CG PHE A 978 5.161 -2.072 -18.235 1.00 76.98 C
ATOM 5655 CD1 PHE A 978 4.097 -1.899 -19.095 1.00 76.98 C
ATOM 5656 CD2 PHE A 978 5.223 -1.308 -17.086 1.00 76.98 C
ATOM 5657 CE1 PHE A 978 3.133 -0.953 -18.833 1.00 76.98 C
ATOM 5658 CE2 PHE A 978 4.268 -0.365 -16.817 1.00 76.98 C
ATOM 5659 CZ PHE A 978 3.221 -0.185 -17.690 1.00 76.98 C
ATOM 5660 N GLY A 979 7.226 -5.435 -19.719 1.00 83.15 N
ATOM 5661 CA GLY A 979 8.246 -6.298 -20.256 1.00 83.15 C
ATOM 5662 C GLY A 979 7.742 -7.267 -21.296 1.00 83.15 C
ATOM 5663 O GLY A 979 8.436 -7.515 -22.287 1.00 83.15 O
ATOM 5664 N TYR A 980 6.540 -7.805 -21.100 1.00 82.82 N
ATOM 5665 CA TYR A 980 5.857 -8.495 -22.183 1.00 82.82 C
ATOM 5666 C TYR A 980 5.438 -7.511 -23.266 1.00 82.82 C
ATOM 5667 O TYR A 980 5.268 -7.890 -24.430 1.00 82.82 O
ATOM 5668 CB TYR A 980 4.649 -9.251 -21.632 1.00 82.82 C
ATOM 5669 CG TYR A 980 3.597 -8.359 -21.018 1.00 82.82 C
ATOM 5670 CD1 TYR A 980 3.678 -7.975 -19.688 1.00 82.82 C
ATOM 5671 CD2 TYR A 980 2.507 -7.920 -21.762 1.00 82.82 C
ATOM 5672 CE1 TYR A 980 2.728 -7.166 -19.129 1.00 82.82 C
ATOM 5673 CE2 TYR A 980 1.554 -7.111 -21.208 1.00 82.82 C
ATOM 5674 CZ TYR A 980 1.671 -6.737 -19.894 1.00 82.82 C
ATOM 5675 OH TYR A 980 0.720 -5.930 -19.339 1.00 82.82 O
ATOM 5676 N THR A 981 5.248 -6.245 -22.888 1.00 85.56 N
ATOM 5677 CA THR A 981 4.883 -5.192 -23.825 1.00 85.56 C
ATOM 5678 C THR A 981 6.005 -4.915 -24.814 1.00 85.56 C
ATOM 5679 O THR A 981 5.801 -4.979 -26.031 1.00 85.56 O
ATOM 5680 CB THR A 981 4.542 -3.917 -23.058 1.00 85.56 C
ATOM 5681 OG1 THR A 981 5.704 -3.469 -22.350 1.00 85.56 O
ATOM 5682 CG2 THR A 981 3.438 -4.181 -22.061 1.00 85.56 C
ATOM 5683 N VAL A 982 7.199 -4.617 -24.304 1.00 86.26 N
ATOM 5684 CA VAL A 982 8.297 -4.200 -25.170 1.00 86.26 C
ATOM 5685 C VAL A 982 8.935 -5.401 -25.854 1.00 86.26 C
ATOM 5686 O VAL A 982 9.649 -5.257 -26.852 1.00 86.26 O
ATOM 5687 CB VAL A 982 9.328 -3.390 -24.368 1.00 86.26 C
ATOM 5688 CG1 VAL A 982 8.708 -2.098 -23.887 1.00 86.26 C
ATOM 5689 CG2 VAL A 982 9.825 -4.200 -23.192 1.00 86.26 C
ATOM 5690 N GLY A 983 8.699 -6.596 -25.331 1.00 88.40 N
ATOM 5691 CA GLY A 983 9.272 -7.790 -25.918 1.00 88.40 C
ATOM 5692 C GLY A 983 8.532 -8.269 -27.152 1.00 88.40 C
ATOM 5693 O GLY A 983 8.404 -7.545 -28.139 1.00 88.40 O
ATOM 5694 N ASN A 988 0.950 -10.627 -34.387 1.00 79.24 N
ATOM 5695 CA ASN A 988 1.835 -11.779 -34.333 1.00 79.24 C
ATOM 5696 C ASN A 988 1.907 -12.330 -32.924 1.00 79.24 C
ATOM 5697 O ASN A 988 2.707 -13.214 -32.634 1.00 79.24 O
ATOM 5698 CB ASN A 988 3.228 -11.412 -34.828 1.00 79.24 C
ATOM 5699 CG ASN A 988 3.255 -11.138 -36.307 1.00 79.24 C
ATOM 5700 OD1 ASN A 988 2.608 -11.834 -37.088 1.00 79.24 O
ATOM 5701 ND2 ASN A 988 4.003 -10.119 -36.706 1.00 79.24 N
ATOM 5702 N ASN A 989 1.068 -11.796 -32.037 1.00 72.51 N
ATOM 5703 CA ASN A 989 0.865 -12.446 -30.749 1.00 72.51 C
ATOM 5704 C ASN A 989 0.002 -13.690 -30.909 1.00 72.51 C
ATOM 5705 O ASN A 989 0.015 -14.583 -30.052 1.00 72.51 O
ATOM 5706 CB ASN A 989 0.232 -11.472 -29.758 1.00 72.51 C
ATOM 5707 N ASP A 990 -0.748 -13.759 -32.014 1.00 70.82 N
ATOM 5708 CA ASP A 990 -1.665 -14.863 -32.275 1.00 70.82 C
ATOM 5709 C ASP A 990 -0.925 -16.192 -32.411 1.00 70.82 C
ATOM 5710 O ASP A 990 -1.285 -17.180 -31.755 1.00 70.82 O
ATOM 5711 CB ASP A 990 -2.453 -14.551 -33.546 1.00 70.82 C
ATOM 5712 CG ASP A 990 -3.684 -15.404 -33.701 1.00 70.82 C
ATOM 5713 OD1 ASP A 990 -3.971 -16.234 -32.814 1.00 70.82 O
ATOM 5714 OD2 ASP A 990 -4.376 -15.242 -34.726 1.00 70.82 O
ATOM 5715 N GLN A 991 0.121 -16.225 -33.240 1.00 63.98 N
ATOM 5716 CA GLN A 991 0.852 -17.463 -33.485 1.00 63.98 C
ATOM 5717 C GLN A 991 1.612 -17.918 -32.248 1.00 63.98 C
ATOM 5718 O GLN A 991 1.633 -19.114 -31.931 1.00 63.98 O
ATOM 5719 CB GLN A 991 1.807 -17.268 -34.656 1.00 63.98 C
ATOM 5720 CG GLN A 991 1.096 -17.019 -35.957 1.00 63.98 C
ATOM 5721 CD GLN A 991 2.047 -16.763 -37.103 1.00 63.98 C
ATOM 5722 OE1 GLN A 991 3.262 -16.692 -36.919 1.00 63.98 O
ATOM 5723 NE2 GLN A 991 1.497 -16.621 -38.299 1.00 63.98 N
ATOM 5724 N VAL A 992 2.222 -16.970 -31.532 1.00 62.88 N
ATOM 5725 CA VAL A 992 2.969 -17.285 -30.317 1.00 62.88 C
ATOM 5726 C VAL A 992 2.039 -17.834 -29.250 1.00 62.88 C
ATOM 5727 O VAL A 992 2.359 -18.818 -28.563 1.00 62.88 O
ATOM 5728 CB VAL A 992 3.711 -16.034 -29.818 1.00 62.88 C
ATOM 5729 CG1 VAL A 992 4.474 -16.329 -28.542 1.00 62.88 C
ATOM 5730 CG2 VAL A 992 4.634 -15.511 -30.888 1.00 62.88 C
ATOM 5731 N TRP A 993 0.857 -17.234 -29.127 1.00 60.68 N
ATOM 5732 CA TRP A 993 -0.131 -17.731 -28.183 1.00 60.68 C
ATOM 5733 C TRP A 993 -0.594 -19.139 -28.527 1.00 60.68 C
ATOM 5734 O TRP A 993 -0.653 -20.003 -27.638 1.00 60.68 O
ATOM 5735 CB TRP A 993 -1.316 -16.779 -28.120 1.00 60.68 C
ATOM 5736 CG TRP A 993 -2.480 -17.430 -27.533 1.00 60.68 C
ATOM 5737 CD1 TRP A 993 -2.581 -17.988 -26.294 1.00 60.68 C
ATOM 5738 CD2 TRP A 993 -3.737 -17.625 -28.166 1.00 60.68 C
ATOM 5739 NE1 TRP A 993 -3.808 -18.555 -26.140 1.00 60.68 N
ATOM 5740 CE2 TRP A 993 -4.555 -18.314 -27.259 1.00 60.68 C
ATOM 5741 CE3 TRP A 993 -4.254 -17.279 -29.411 1.00 60.68 C
ATOM 5742 CZ2 TRP A 993 -5.860 -18.664 -27.556 1.00 60.68 C
ATOM 5743 CZ3 TRP A 993 -5.549 -17.627 -29.705 1.00 60.68 C
ATOM 5744 CH2 TRP A 993 -6.341 -18.315 -28.783 1.00 60.68 C
ATOM 5745 N LYS A 994 -0.952 -19.379 -29.793 1.00 58.70 N
ATOM 5746 CA LYS A 994 -1.454 -20.694 -30.178 1.00 58.70 C
ATOM 5747 C LYS A 994 -0.394 -21.769 -29.998 1.00 58.70 C
ATOM 5748 O LYS A 994 -0.709 -22.886 -29.569 1.00 58.70 O
ATOM 5749 CB LYS A 994 -1.968 -20.674 -31.616 1.00 58.70 C
ATOM 5750 CG LYS A 994 -3.315 -19.983 -31.773 1.00 58.70 C
ATOM 5751 CD LYS A 994 -3.826 -20.062 -33.202 1.00 58.70 C
ATOM 5752 CE LYS A 994 -5.169 -19.374 -33.344 1.00 58.70 C
ATOM 5753 NZ LYS A 994 -5.670 -19.457 -34.737 1.00 58.70 N
ATOM 5754 N PHE A 995 0.873 -21.428 -30.252 1.00 57.20 N
ATOM 5755 CA PHE A 995 1.952 -22.383 -30.026 1.00 57.20 C
ATOM 5756 C PHE A 995 2.112 -22.712 -28.551 1.00 57.20 C
ATOM 5757 O PHE A 995 2.318 -23.879 -28.196 1.00 57.20 O
ATOM 5758 CB PHE A 995 3.267 -21.848 -30.573 1.00 57.20 C
ATOM 5759 CG PHE A 995 4.400 -22.797 -30.404 1.00 57.20 C
ATOM 5760 CD1 PHE A 995 4.507 -23.891 -31.225 1.00 57.20 C
ATOM 5761 CD2 PHE A 995 5.344 -22.615 -29.412 1.00 57.20 C
ATOM 5762 CE1 PHE A 995 5.539 -24.781 -31.075 1.00 57.20 C
ATOM 5763 CE2 PHE A 995 6.377 -23.507 -29.254 1.00 57.20 C
ATOM 5764 CZ PHE A 995 6.475 -24.589 -30.088 1.00 57.20 C
ATOM 5765 N GLN A 996 2.039 -21.703 -27.679 1.00 56.13 N
ATOM 5766 CA GLN A 996 2.236 -21.973 -26.258 1.00 56.13 C
ATOM 5767 C GLN A 996 1.088 -22.797 -25.684 1.00 56.13 C
ATOM 5768 O GLN A 996 1.308 -23.716 -24.877 1.00 56.13 O
ATOM 5769 CB GLN A 996 2.391 -20.667 -25.495 1.00 56.13 C
ATOM 5770 CG GLN A 996 2.814 -20.878 -24.080 1.00 56.13 C
ATOM 5771 CD GLN A 996 4.197 -21.449 -24.006 1.00 56.13 C
ATOM 5772 OE1 GLN A 996 5.085 -21.035 -24.746 1.00 56.13 O
ATOM 5773 NE2 GLN A 996 4.396 -22.409 -23.117 1.00 56.13 N
ATOM 5774 N ARG A 997 -0.139 -22.509 -26.127 1.00 60.21 N
ATOM 5775 CA ARG A 997 -1.298 -23.285 -25.693 1.00 60.21 C
ATOM 5776 C ARG A 997 -1.210 -24.722 -26.182 1.00 60.21 C
ATOM 5777 O ARG A 997 -1.511 -25.664 -25.435 1.00 60.21 O
ATOM 5778 CB ARG A 997 -2.578 -22.599 -26.177 1.00 60.21 C
ATOM 5779 CG ARG A 997 -3.859 -23.397 -26.045 1.00 60.21 C
ATOM 5780 CD ARG A 997 -4.301 -23.894 -27.414 1.00 60.21 C
ATOM 5781 NE ARG A 997 -5.497 -24.718 -27.350 1.00 60.21 N
ATOM 5782 CZ ARG A 997 -6.731 -24.239 -27.376 1.00 60.21 C
ATOM 5783 NH1 ARG A 997 -6.934 -22.932 -27.457 1.00 60.21 N
ATOM 5784 NH2 ARG A 997 -7.761 -25.072 -27.314 1.00 60.21 N
ATOM 5785 N PHE A 998 -0.776 -24.904 -27.433 1.00 55.22 N
ATOM 5786 CA PHE A 998 -0.593 -26.239 -27.986 1.00 55.22 C
ATOM 5787 C PHE A 998 0.448 -27.026 -27.216 1.00 55.22 C
ATOM 5788 O PHE A 998 0.266 -28.221 -26.954 1.00 55.22 O
ATOM 5789 CB PHE A 998 -0.180 -26.135 -29.446 1.00 55.22 C
ATOM 5790 CG PHE A 998 0.059 -27.451 -30.098 1.00 55.22 C
ATOM 5791 CD1 PHE A 998 -0.996 -28.244 -30.480 1.00 55.22 C
ATOM 5792 CD2 PHE A 998 1.341 -27.890 -30.345 1.00 55.22 C
ATOM 5793 CE1 PHE A 998 -0.787 -29.453 -31.083 1.00 55.22 C
ATOM 5794 CE2 PHE A 998 1.557 -29.086 -30.954 1.00 55.22 C
ATOM 5795 CZ PHE A 998 0.493 -29.875 -31.319 1.00 55.22 C
ATOM 5796 N PHE A 999 1.548 -26.369 -26.854 1.00 57.67 N
ATOM 5797 CA PHE A 999 2.607 -27.057 -26.132 1.00 57.67 C
ATOM 5798 C PHE A 999 2.154 -27.472 -24.744 1.00 57.67 C
ATOM 5799 O PHE A 999 2.470 -28.580 -24.296 1.00 57.67 O
ATOM 5800 CB PHE A 999 3.846 -26.177 -26.051 1.00 57.67 C
ATOM 5801 CG PHE A 999 4.945 -26.778 -25.249 1.00 57.67 C
ATOM 5802 CD1 PHE A 999 5.638 -27.868 -25.723 1.00 57.67 C
ATOM 5803 CD2 PHE A 999 5.298 -26.242 -24.025 1.00 57.67 C
ATOM 5804 CE1 PHE A 999 6.655 -28.426 -24.986 1.00 57.67 C
ATOM 5805 CE2 PHE A 999 6.318 -26.794 -23.283 1.00 57.67 C
ATOM 5806 CZ PHE A 999 6.997 -27.887 -23.763 1.00 57.67 C
ATOM 5807 N LEU A1000 1.364 -26.629 -24.072 1.00 60.76 N
ATOM 5808 CA LEU A1000 0.881 -27.012 -22.745 1.00 60.76 C
ATOM 5809 C LEU A1000 -0.127 -28.154 -22.808 1.00 60.76 C
ATOM 5810 O LEU A1000 -0.074 -29.074 -21.978 1.00 60.76 O
ATOM 5811 CB LEU A1000 0.271 -25.818 -22.026 1.00 60.76 C
ATOM 5812 CG LEU A1000 1.310 -24.825 -21.538 1.00 60.76 C
ATOM 5813 CD1 LEU A1000 0.636 -23.637 -20.905 1.00 60.76 C
ATOM 5814 CD2 LEU A1000 2.220 -25.515 -20.548 1.00 60.76 C
ATOM 5815 N VAL A1001 -1.037 -28.125 -23.790 1.00 59.08 N
ATOM 5816 CA VAL A1001 -2.019 -29.201 -23.912 1.00 59.08 C
ATOM 5817 C VAL A1001 -1.335 -30.519 -24.246 1.00 59.08 C
ATOM 5818 O VAL A1001 -1.611 -31.551 -23.620 1.00 59.08 O
ATOM 5819 CB VAL A1001 -3.095 -28.843 -24.951 1.00 59.08 C
ATOM 5820 CG1 VAL A1001 -4.012 -30.016 -25.182 1.00 59.08 C
ATOM 5821 CG2 VAL A1001 -3.907 -27.679 -24.465 1.00 59.08 C
ATOM 5822 N GLN A1002 -0.391 -30.496 -25.190 1.00 61.62 N
ATOM 5823 CA GLN A1002 0.266 -31.733 -25.591 1.00 61.62 C
ATOM 5824 C GLN A1002 1.181 -32.254 -24.493 1.00 61.62 C
ATOM 5825 O GLN A1002 1.361 -33.469 -24.352 1.00 61.62 O
ATOM 5826 CB GLN A1002 1.047 -31.515 -26.880 1.00 61.62 C
ATOM 5827 CG GLN A1002 1.561 -32.790 -27.481 1.00 61.62 C
ATOM 5828 CD GLN A1002 2.349 -32.555 -28.724 1.00 61.62 C
ATOM 5829 OE1 GLN A1002 2.549 -31.420 -29.130 1.00 61.62 O
ATOM 5830 NE2 GLN A1002 2.819 -33.629 -29.338 1.00 61.62 N
ATOM 5831 N GLU A1003 1.746 -31.356 -23.682 1.00 73.98 N
ATOM 5832 CA GLU A1003 2.516 -31.810 -22.531 1.00 73.98 C
ATOM 5833 C GLU A1003 1.616 -32.466 -21.495 1.00 73.98 C
ATOM 5834 O GLU A1003 2.006 -33.457 -20.865 1.00 73.98 O
ATOM 5835 CB GLU A1003 3.286 -30.646 -21.912 1.00 73.98 C
ATOM 5836 CG GLU A1003 4.175 -31.050 -20.749 1.00 73.98 C
ATOM 5837 CD GLU A1003 4.948 -29.887 -20.171 1.00 73.98 C
ATOM 5838 OE1 GLU A1003 4.810 -28.763 -20.694 1.00 73.98 O
ATOM 5839 OE2 GLU A1003 5.686 -30.092 -19.186 1.00 73.98 O
ATOM 5840 N TYR A1004 0.398 -31.953 -21.316 1.00 70.32 N
ATOM 5841 CA TYR A1004 -0.472 -32.568 -20.319 1.00 70.32 C
ATOM 5842 C TYR A1004 -1.053 -33.888 -20.818 1.00 70.32 C
ATOM 5843 O TYR A1004 -1.359 -34.775 -20.014 1.00 70.32 O
ATOM 5844 CB TYR A1004 -1.589 -31.615 -19.905 1.00 70.32 C
ATOM 5845 CG TYR A1004 -2.420 -32.185 -18.784 1.00 70.32 C
ATOM 5846 CD1 TYR A1004 -1.930 -32.213 -17.490 1.00 70.32 C
ATOM 5847 CD2 TYR A1004 -3.675 -32.729 -19.026 1.00 70.32 C
ATOM 5848 CE1 TYR A1004 -2.672 -32.746 -16.461 1.00 70.32 C
ATOM 5849 CE2 TYR A1004 -4.423 -33.271 -18.003 1.00 70.32 C
ATOM 5850 CZ TYR A1004 -3.917 -33.275 -16.723 1.00 70.32 C
ATOM 5851 OH TYR A1004 -4.662 -33.808 -15.700 1.00 70.32 O
ATOM 5852 N CYS A1005 -1.202 -34.043 -22.140 1.00 76.40 N
ATOM 5853 CA CYS A1005 -1.822 -35.252 -22.690 1.00 76.40 C
ATOM 5854 C CYS A1005 -0.973 -36.495 -22.456 1.00 76.40 C
ATOM 5855 O CYS A1005 -1.492 -37.616 -22.448 1.00 76.40 O
ATOM 5856 CB CYS A1005 -2.085 -35.092 -24.187 1.00 76.40 C
ATOM 5857 SG CYS A1005 -3.425 -33.980 -24.632 1.00 76.40 S
ATOM 5858 N SER A1006 0.332 -36.322 -22.268 1.00 81.30 N
ATOM 5859 CA SER A1006 1.226 -37.470 -22.261 1.00 81.30 C
ATOM 5860 C SER A1006 1.352 -38.127 -20.893 1.00 81.30 C
ATOM 5861 O SER A1006 2.130 -39.074 -20.754 1.00 81.30 O
ATOM 5862 CB SER A1006 2.599 -37.053 -22.778 1.00 81.30 C
ATOM 5863 OG SER A1006 2.523 -36.678 -24.143 1.00 81.30 O
ATOM 5864 N ARG A1007 0.625 -37.662 -19.882 1.00 91.49 N
ATOM 5865 CA ARG A1007 0.605 -38.384 -18.615 1.00 91.49 C
ATOM 5866 C ARG A1007 -0.304 -39.606 -18.684 1.00 91.49 C
ATOM 5867 O ARG A1007 -0.820 -39.973 -19.742 1.00 91.49 O
ATOM 5868 CB ARG A1007 0.148 -37.490 -17.465 1.00 91.49 C
ATOM 5869 CG ARG A1007 1.186 -36.532 -16.925 1.00 91.49 C
ATOM 5870 CD ARG A1007 0.609 -35.818 -15.719 1.00 91.49 C
ATOM 5871 NE ARG A1007 1.555 -34.932 -15.054 1.00 91.49 N
ATOM 5872 CZ ARG A1007 1.726 -33.656 -15.373 1.00 91.49 C
ATOM 5873 NH1 ARG A1007 1.027 -33.120 -16.365 1.00 91.49 N
ATOM 5874 NH2 ARG A1007 2.595 -32.914 -14.707 1.00 91.49 N
ATOM 5875 N LEU A1008 -0.489 -40.243 -17.525 1.00 96.69 N
ATOM 5876 CA LEU A1008 -1.352 -41.414 -17.423 1.00 96.69 C
ATOM 5877 C LEU A1008 -2.814 -41.032 -17.616 1.00 96.69 C
ATOM 5878 O LEU A1008 -3.183 -39.858 -17.537 1.00 96.69 O
ATOM 5879 CB LEU A1008 -1.159 -42.093 -16.070 1.00 96.69 C
ATOM 5880 N THR A1009 -3.650 -42.039 -17.868 1.00101.15 N
ATOM 5881 CA THR A1009 -5.027 -41.777 -18.269 1.00101.15 C
ATOM 5882 C THR A1009 -5.995 -42.055 -17.120 1.00101.15 C
ATOM 5883 O THR A1009 -7.063 -41.444 -17.027 1.00101.15 O
ATOM 5884 CB THR A1009 -5.347 -42.619 -19.503 1.00101.15 C
ATOM 5885 OG1 THR A1009 -4.331 -42.388 -20.485 1.00101.15 O
ATOM 5886 CG2 THR A1009 -6.677 -42.227 -20.114 1.00101.15 C
ATOM 5887 N ILE A1010 -5.626 -42.972 -16.233 1.00100.77 N
ATOM 5888 CA ILE A1010 -6.417 -43.356 -15.064 1.00100.77 C
ATOM 5889 C ILE A1010 -6.621 -42.167 -14.127 1.00100.77 C
ATOM 5890 O ILE A1010 -5.682 -41.389 -13.911 1.00100.77 O
ATOM 5891 CB ILE A1010 -5.739 -44.534 -14.349 1.00100.77 C
ATOM 5892 CG1 ILE A1010 -5.666 -45.729 -15.295 1.00100.77 C
ATOM 5893 CG2 ILE A1010 -6.462 -44.933 -13.089 1.00100.77 C
ATOM 5894 CD1 ILE A1010 -7.017 -46.212 -15.755 1.00100.77 C
ATOM 5895 N PRO A1011 -7.833 -41.955 -13.607 1.00 96.76 N
ATOM 5896 CA PRO A1011 -8.047 -40.908 -12.600 1.00 96.76 C
ATOM 5897 C PRO A1011 -7.255 -41.162 -11.327 1.00 96.76 C
ATOM 5898 O PRO A1011 -6.873 -42.296 -11.039 1.00 96.76 O
ATOM 5899 CB PRO A1011 -9.551 -40.983 -12.335 1.00 96.76 C
ATOM 5900 CG PRO A1011 -10.116 -41.556 -13.563 1.00 96.76 C
ATOM 5901 CD PRO A1011 -9.104 -42.532 -14.069 1.00 96.76 C
ATOM 5902 N PHE A1012 -7.068 -40.085 -10.550 1.00 98.24 N
ATOM 5903 CA PHE A1012 -6.099 -39.982 -9.446 1.00 98.24 C
ATOM 5904 C PHE A1012 -6.078 -41.133 -8.439 1.00 98.24 C
ATOM 5905 O PHE A1012 -5.035 -41.799 -8.355 1.00 98.24 O
ATOM 5906 CB PHE A1012 -6.317 -38.635 -8.738 1.00 98.24 C
ATOM 5907 CG PHE A1012 -5.344 -38.361 -7.641 1.00 98.24 C
ATOM 5908 CD1 PHE A1012 -4.055 -37.982 -7.941 1.00 98.24 C
ATOM 5909 CD2 PHE A1012 -5.724 -38.455 -6.313 1.00 98.24 C
ATOM 5910 CE1 PHE A1012 -3.159 -37.715 -6.940 1.00 98.24 C
ATOM 5911 CE2 PHE A1012 -4.832 -38.186 -5.303 1.00 98.24 C
ATOM 5912 CZ PHE A1012 -3.546 -37.817 -5.618 1.00 98.24 C
ATOM 5913 N PRO A1013 -7.164 -41.480 -7.718 1.00 97.01 N
ATOM 5914 CA PRO A1013 -7.008 -42.421 -6.593 1.00 97.01 C
ATOM 5915 C PRO A1013 -6.727 -43.843 -7.027 1.00 97.01 C
ATOM 5916 O PRO A1013 -6.440 -44.696 -6.182 1.00 97.01 O
ATOM 5917 CB PRO A1013 -8.366 -42.347 -5.881 1.00 97.01 C
ATOM 5918 CG PRO A1013 -9.078 -41.196 -6.490 1.00 97.01 C
ATOM 5919 CD PRO A1013 -8.597 -41.173 -7.887 1.00 97.01 C
ATOM 5920 N PHE A1014 -6.807 -44.115 -8.324 1.00102.22 N
ATOM 5921 CA PHE A1014 -6.625 -45.439 -8.883 1.00102.22 C
ATOM 5922 C PHE A1014 -5.330 -45.545 -9.676 1.00102.22 C
ATOM 5923 O PHE A1014 -5.028 -46.635 -10.181 1.00102.22 O
ATOM 5924 CB PHE A1014 -7.817 -45.780 -9.777 1.00102.22 C
ATOM 5925 CG PHE A1014 -9.138 -45.837 -9.056 1.00102.22 C
ATOM 5926 CD1 PHE A1014 -9.213 -46.134 -7.704 1.00102.22 C
ATOM 5927 CD2 PHE A1014 -10.307 -45.536 -9.736 1.00102.22 C
ATOM 5928 CE1 PHE A1014 -10.432 -46.166 -7.058 1.00102.22 C
ATOM 5929 CE2 PHE A1014 -11.526 -45.562 -9.095 1.00102.22 C
ATOM 5930 CZ PHE A1014 -11.588 -45.877 -7.755 1.00102.22 C
ATOM 5931 N VAL A1015 -4.557 -44.445 -9.769 1.00107.87 N
ATOM 5932 CA VAL A1015 -3.404 -44.362 -10.676 1.00107.87 C
ATOM 5933 C VAL A1015 -2.371 -45.443 -10.373 1.00107.87 C
ATOM 5934 O VAL A1015 -1.842 -46.087 -11.293 1.00107.87 O
ATOM 5935 CB VAL A1015 -2.782 -42.951 -10.616 1.00107.87 C
ATOM 5936 CG1 VAL A1015 -1.400 -42.918 -11.238 1.00107.87 C
ATOM 5937 CG2 VAL A1015 -3.636 -41.983 -11.372 1.00107.87 C
ATOM 5938 N ILE A1016 -2.155 -45.730 -9.085 1.00110.01 N
ATOM 5939 CA ILE A1016 -1.133 -46.690 -8.667 1.00110.01 C
ATOM 5940 C ILE A1016 -1.449 -48.097 -9.159 1.00110.01 C
ATOM 5941 O ILE A1016 -0.532 -48.906 -9.359 1.00110.01 O
ATOM 5942 CB ILE A1016 -0.945 -46.639 -7.138 1.00110.01 C
ATOM 5943 CG1 ILE A1016 0.221 -47.525 -6.683 1.00110.01 C
ATOM 5944 CG2 ILE A1016 -2.242 -46.977 -6.431 1.00110.01 C
ATOM 5945 CD1 ILE A1016 0.672 -47.304 -5.259 1.00110.01 C
ATOM 5946 N PHE A1017 -2.741 -48.398 -9.393 1.00113.47 N
ATOM 5947 CA PHE A1017 -3.118 -49.677 -9.993 1.00113.47 C
ATOM 5948 C PHE A1017 -2.454 -49.869 -11.344 1.00113.47 C
ATOM 5949 O PHE A1017 -1.850 -50.921 -11.596 1.00113.47 O
ATOM 5950 CB PHE A1017 -4.633 -49.782 -10.147 1.00113.47 C
ATOM 5951 CG PHE A1017 -5.356 -50.059 -8.872 1.00113.47 C
ATOM 5952 CD1 PHE A1017 -4.681 -50.538 -7.762 1.00113.47 C
ATOM 5953 CD2 PHE A1017 -6.719 -49.847 -8.786 1.00113.47 C
ATOM 5954 CE1 PHE A1017 -5.352 -50.790 -6.587 1.00113.47 C
ATOM 5955 CE2 PHE A1017 -7.396 -50.096 -7.614 1.00113.47 C
ATOM 5956 CZ PHE A1017 -6.712 -50.569 -6.513 1.00113.47 C
ATOM 5957 N ALA A1018 -2.490 -48.831 -12.186 1.00119.86 N
ATOM 5958 CA ALA A1018 -1.776 -48.873 -13.456 1.00119.86 C
ATOM 5959 C ALA A1018 -0.280 -49.018 -13.225 1.00119.86 C
ATOM 5960 O ALA A1018 0.386 -49.812 -13.904 1.00119.86 O
ATOM 5961 CB ALA A1018 -2.080 -47.620 -14.276 1.00119.86 C
ATOM 5962 N TYR A1019 0.241 -48.324 -12.202 1.00114.74 N
ATOM 5963 CA TYR A1019 1.650 -48.456 -11.850 1.00114.74 C
ATOM 5964 C TYR A1019 1.951 -49.869 -11.386 1.00114.74 C
ATOM 5965 O TYR A1019 2.988 -50.440 -11.749 1.00114.74 O
ATOM 5966 CB TYR A1019 2.030 -47.451 -10.763 1.00114.74 C
ATOM 5967 CG TYR A1019 2.058 -46.003 -11.198 1.00114.74 C
ATOM 5968 CD1 TYR A1019 2.074 -45.652 -12.542 1.00114.74 C
ATOM 5969 CD2 TYR A1019 2.073 -44.984 -10.254 1.00114.74 C
ATOM 5970 CE1 TYR A1019 2.097 -44.326 -12.933 1.00114.74 C
ATOM 5971 CE2 TYR A1019 2.100 -43.658 -10.634 1.00114.74 C
ATOM 5972 CZ TYR A1019 2.110 -43.335 -11.972 1.00114.74 C
ATOM 5973 OH TYR A1019 2.135 -42.012 -12.347 1.00114.74 O
ATOM 5974 N ILE A1020 0.990 -50.485 -10.684 1.00120.15 N
ATOM 5975 CA ILE A1020 1.162 -51.846 -10.189 1.00120.15 C
ATOM 5976 C ILE A1020 1.232 -52.827 -11.349 1.00120.15 C
ATOM 5977 O ILE A1020 1.791 -53.922 -11.220 1.00120.15 O
ATOM 5978 CB ILE A1020 0.032 -52.208 -9.209 1.00120.15 C
ATOM 5979 N PHE A1021 0.680 -52.449 -12.503 1.00127.11 N
ATOM 5980 CA PHE A1021 0.845 -53.297 -13.672 1.00127.11 C
ATOM 5981 C PHE A1021 2.035 -52.853 -14.510 1.00127.11 C
ATOM 5982 O PHE A1021 2.682 -53.689 -15.152 1.00127.11 O
ATOM 5983 CB PHE A1021 -0.445 -53.315 -14.486 1.00127.11 C
ATOM 5984 CG PHE A1021 -1.554 -54.092 -13.831 1.00127.11 C
ATOM 5985 CD1 PHE A1021 -1.271 -55.032 -12.848 1.00127.11 C
ATOM 5986 CD2 PHE A1021 -2.875 -53.870 -14.176 1.00127.11 C
ATOM 5987 CE1 PHE A1021 -2.281 -55.746 -12.235 1.00127.11 C
ATOM 5988 CE2 PHE A1021 -3.895 -54.582 -13.563 1.00127.11 C
ATOM 5989 CZ PHE A1021 -3.594 -55.521 -12.592 1.00127.11 C
ATOM 5990 N MET A1022 2.374 -51.555 -14.463 1.00133.35 N
ATOM 5991 CA MET A1022 3.312 -50.994 -15.436 1.00133.35 C
ATOM 5992 C MET A1022 4.723 -51.522 -15.220 1.00133.35 C
ATOM 5993 O MET A1022 5.358 -52.023 -16.157 1.00133.35 O
ATOM 5994 CB MET A1022 3.302 -49.468 -15.367 1.00133.35 C
ATOM 5995 N VAL A1023 5.205 -51.468 -13.979 1.00139.15 N
ATOM 5996 CA VAL A1023 6.478 -52.097 -13.645 1.00139.15 C
ATOM 5997 C VAL A1023 6.345 -53.616 -13.731 1.00139.15 C
ATOM 5998 O VAL A1023 7.310 -54.325 -14.043 1.00139.15 O
ATOM 5999 CB VAL A1023 6.942 -51.617 -12.256 1.00139.15 C
ATOM 6000 CG1 VAL A1023 8.323 -52.146 -11.902 1.00139.15 C
ATOM 6001 CG2 VAL A1023 6.925 -50.101 -12.203 1.00139.15 C
ATOM 6002 N MET A1024 5.129 -54.134 -13.513 1.00137.70 N
ATOM 6003 CA MET A1024 4.882 -55.552 -13.755 1.00137.70 C
ATOM 6004 C MET A1024 4.949 -55.866 -15.242 1.00137.70 C
ATOM 6005 O MET A1024 5.288 -56.988 -15.634 1.00137.70 O
ATOM 6006 CB MET A1024 3.527 -55.963 -13.180 1.00137.70 C
ATOM 6007 N ARG A1025 4.634 -54.883 -16.088 1.00144.16 N
ATOM 6008 CA ARG A1025 4.782 -55.086 -17.522 1.00144.16 C
ATOM 6009 C ARG A1025 6.242 -54.965 -17.934 1.00144.16 C
ATOM 6010 O ARG A1025 6.712 -55.697 -18.812 1.00144.16 O
ATOM 6011 CB ARG A1025 3.912 -54.087 -18.286 1.00144.16 C
ATOM 6012 CG ARG A1025 3.875 -54.321 -19.782 1.00144.16 C
ATOM 6013 CD ARG A1025 3.237 -55.667 -20.075 1.00144.16 C
ATOM 6014 NE ARG A1025 3.137 -55.937 -21.505 1.00144.16 N
ATOM 6015 CZ ARG A1025 2.809 -57.119 -22.018 1.00144.16 C
ATOM 6016 NH1 ARG A1025 2.739 -57.279 -23.334 1.00144.16 N
ATOM 6017 NH2 ARG A1025 2.556 -58.144 -21.215 1.00144.16 N
ATOM 6018 N LYS A1026 6.978 -54.059 -17.300 1.00138.37 N
ATOM 6019 CA LYS A1026 8.393 -53.887 -17.596 1.00138.37 C
ATOM 6020 C LYS A1026 9.246 -54.702 -16.631 1.00138.37 C
ATOM 6021 O LYS A1026 8.905 -55.837 -16.299 1.00138.37 O
ATOM 6022 CB LYS A1026 8.781 -52.409 -17.528 1.00138.37 C
ATOM 6023 N GLU A1038 12.424 -57.868 -35.167 1.00125.76 N
ATOM 6024 CA GLU A1038 12.294 -57.332 -36.516 1.00125.76 C
ATOM 6025 C GLU A1038 11.655 -55.946 -36.494 1.00125.76 C
ATOM 6026 O GLU A1038 10.452 -55.820 -36.273 1.00125.76 O
ATOM 6027 CB GLU A1038 11.474 -58.277 -37.395 1.00125.76 C
ATOM 6028 N PRO A1039 12.465 -54.910 -36.710 1.00123.05 N
ATOM 6029 CA PRO A1039 11.928 -53.544 -36.702 1.00123.05 C
ATOM 6030 C PRO A1039 11.114 -53.247 -37.951 1.00123.05 C
ATOM 6031 O PRO A1039 11.439 -53.701 -39.050 1.00123.05 O
ATOM 6032 CB PRO A1039 13.186 -52.672 -36.641 1.00123.05 C
ATOM 6033 CG PRO A1039 14.254 -53.572 -36.116 1.00123.05 C
ATOM 6034 CD PRO A1039 13.935 -54.916 -36.683 1.00123.05 C
ATOM 6035 N SER A1040 10.050 -52.470 -37.770 1.00110.02 N
ATOM 6036 CA SER A1040 9.251 -52.016 -38.899 1.00110.02 C
ATOM 6037 C SER A1040 10.028 -50.997 -39.720 1.00110.02 C
ATOM 6038 O SER A1040 10.946 -50.342 -39.221 1.00110.02 O
ATOM 6039 CB SER A1040 7.934 -51.414 -38.414 1.00110.02 C
ATOM 6040 OG SER A1040 7.128 -52.399 -37.793 1.00110.02 O
ATOM 6041 N VAL A1041 9.674 -50.884 -40.988 1.00 93.04 N
ATOM 6042 CA VAL A1041 10.407 -50.042 -41.915 1.00 93.04 C
ATOM 6043 C VAL A1041 9.524 -48.889 -42.377 1.00 93.04 C
ATOM 6044 O VAL A1041 8.336 -48.817 -42.060 1.00 93.04 O
ATOM 6045 CB VAL A1041 10.917 -50.878 -43.093 1.00 93.04 C
ATOM 6046 CG1 VAL A1041 11.965 -51.854 -42.607 1.00 93.04 C
ATOM 6047 CG2 VAL A1041 9.773 -51.642 -43.676 1.00 93.04 C
ATOM 6048 N CYS A1042 10.117 -47.966 -43.138 1.00 76.85 N
ATOM 6049 CA CYS A1042 9.420 -46.725 -43.466 1.00 76.85 C
ATOM 6050 C CYS A1042 8.402 -46.914 -44.586 1.00 76.85 C
ATOM 6051 O CYS A1042 7.212 -46.648 -44.390 1.00 76.85 O
ATOM 6052 CB CYS A1042 10.423 -45.632 -43.833 1.00 76.85 C
ATOM 6053 SG CYS A1042 9.643 -44.073 -44.329 1.00 76.85 S
ATOM 6054 N CYS A1043 8.833 -47.367 -45.763 1.00 71.40 N
ATOM 6055 CA CYS A1043 7.981 -47.315 -46.947 1.00 71.40 C
ATOM 6056 C CYS A1043 7.765 -48.667 -47.612 1.00 71.40 C
ATOM 6057 O CYS A1043 7.700 -48.733 -48.842 1.00 71.40 O
ATOM 6058 CB CYS A1043 8.545 -46.337 -47.979 1.00 71.40 C
ATOM 6059 SG CYS A1043 8.381 -44.594 -47.584 1.00 71.40 S
ATOM 6060 N SER A1044 7.641 -49.752 -46.850 1.00 82.90 N
ATOM 6061 CA SER A1044 7.347 -51.037 -47.467 1.00 82.90 C
ATOM 6062 C SER A1044 5.933 -51.533 -47.221 1.00 82.90 C
ATOM 6063 O SER A1044 5.484 -52.433 -47.935 1.00 82.90 O
ATOM 6064 CB SER A1044 8.333 -52.109 -46.990 1.00 82.90 C
ATOM 6065 OG SER A1044 8.037 -53.364 -47.573 1.00 82.90 O
ATOM 6066 N ARG A1045 5.227 -50.981 -46.241 1.00 91.70 N
ATOM 6067 CA ARG A1045 3.847 -51.377 -45.998 1.00 91.70 C
ATOM 6068 C ARG A1045 2.945 -50.830 -47.098 1.00 91.70 C
ATOM 6069 O ARG A1045 3.311 -49.895 -47.813 1.00 91.70 O
ATOM 6070 CB ARG A1045 3.393 -50.872 -44.635 1.00 91.70 C
ATOM 6071 CG ARG A1045 4.236 -51.399 -43.497 1.00 91.70 C
ATOM 6072 CD ARG A1045 4.055 -52.891 -43.334 1.00 91.70 C
ATOM 6073 NE ARG A1045 2.664 -53.229 -43.053 1.00 91.70 N
ATOM 6074 CZ ARG A1045 2.121 -53.216 -41.840 1.00 91.70 C
ATOM 6075 NH1 ARG A1045 2.851 -52.881 -40.785 1.00 91.70 N
ATOM 6076 NH2 ARG A1045 0.846 -53.539 -41.679 1.00 91.70 N
ATOM 6077 N ASN A1046 1.759 -51.424 -47.243 1.00 87.36 N
ATOM 6078 CA ASN A1046 0.923 -51.092 -48.393 1.00 87.36 C
ATOM 6079 C ASN A1046 0.160 -49.790 -48.174 1.00 87.36 C
ATOM 6080 O ASN A1046 0.061 -48.962 -49.088 1.00 87.36 O
ATOM 6081 CB ASN A1046 -0.040 -52.238 -48.688 1.00 87.36 C
ATOM 6082 CG ASN A1046 -0.654 -52.144 -50.072 1.00 87.36 C
ATOM 6083 OD1 ASN A1046 -0.365 -51.228 -50.841 1.00 87.36 O
ATOM 6084 ND2 ASN A1046 -1.504 -53.107 -50.399 1.00 87.36 N
ATOM 6085 N GLU A1047 -0.392 -49.592 -46.974 1.00 87.69 N
ATOM 6086 CA GLU A1047 -1.144 -48.369 -46.702 1.00 87.69 C
ATOM 6087 C GLU A1047 -0.224 -47.155 -46.645 1.00 87.69 C
ATOM 6088 O GLU A1047 -0.650 -46.027 -46.933 1.00 87.69 O
ATOM 6089 CB GLU A1047 -1.946 -48.520 -45.406 1.00 87.69 C
ATOM 6090 CG GLU A1047 -1.119 -48.617 -44.133 1.00 87.69 C
ATOM 6091 CD GLU A1047 -0.684 -50.036 -43.802 1.00 87.69 C
ATOM 6092 OE1 GLU A1047 -0.779 -50.925 -44.675 1.00 87.69 O
ATOM 6093 OE2 GLU A1047 -0.235 -50.261 -42.660 1.00 87.69 O
ATOM 6094 N ASP A1048 1.050 -47.373 -46.310 1.00 83.25 N
ATOM 6095 CA ASP A1048 2.025 -46.297 -46.386 1.00 83.25 C
ATOM 6096 C ASP A1048 2.256 -45.888 -47.830 1.00 83.25 C
ATOM 6097 O ASP A1048 2.447 -44.708 -48.128 1.00 83.25 O
ATOM 6098 CB ASP A1048 3.330 -46.721 -45.721 1.00 83.25 C
ATOM 6099 CG ASP A1048 3.185 -46.885 -44.226 1.00 83.25 C
ATOM 6100 OD1 ASP A1048 2.297 -46.228 -43.650 1.00 83.25 O
ATOM 6101 OD2 ASP A1048 3.954 -47.662 -43.624 1.00 83.25 O
ATOM 6102 N ASN A1049 2.212 -46.852 -48.747 1.00 80.95 N
ATOM 6103 CA ASN A1049 2.263 -46.505 -50.162 1.00 80.95 C
ATOM 6104 C ASN A1049 0.963 -45.856 -50.616 1.00 80.95 C
ATOM 6105 O ASN A1049 0.951 -45.086 -51.583 1.00 80.95 O
ATOM 6106 CB ASN A1049 2.564 -47.745 -50.995 1.00 80.95 C
ATOM 6107 CG ASN A1049 3.989 -48.213 -50.839 1.00 80.95 C
ATOM 6108 OD1 ASN A1049 4.917 -47.408 -50.828 1.00 80.95 O
ATOM 6109 ND2 ASN A1049 4.173 -49.521 -50.711 1.00 80.95 N
ATOM 6110 N GLU A1050 -0.143 -46.156 -49.933 1.00 72.92 N
ATOM 6111 CA GLU A1050 -1.420 -45.563 -50.313 1.00 72.92 C
ATOM 6112 C GLU A1050 -1.496 -44.092 -49.919 1.00 72.92 C
ATOM 6113 O GLU A1050 -2.085 -43.281 -50.640 1.00 72.92 O
ATOM 6114 CB GLU A1050 -2.569 -46.345 -49.683 1.00 72.92 C
ATOM 6115 N ILE A1051 -0.915 -43.731 -48.774 1.00 62.72 N
ATOM 6116 CA ILE A1051 -0.996 -42.344 -48.311 1.00 62.72 C
ATOM 6117 C ILE A1051 -0.087 -41.436 -49.138 1.00 62.72 C
ATOM 6118 O ILE A1051 -0.472 -40.316 -49.513 1.00 62.72 O
ATOM 6119 CB ILE A1051 -0.662 -42.265 -46.811 1.00 62.72 C
ATOM 6120 CG1 ILE A1051 -1.693 -43.031 -46.003 1.00 62.72 C
ATOM 6121 CG2 ILE A1051 -0.653 -40.845 -46.322 1.00 62.72 C
ATOM 6122 CD1 ILE A1051 -1.322 -43.156 -44.558 1.00 62.72 C
ATOM 6123 N LEU A1052 1.124 -41.907 -49.449 1.00 62.67 N
ATOM 6124 CA LEU A1052 2.143 -41.021 -50.005 1.00 62.67 C
ATOM 6125 C LEU A1052 1.826 -40.619 -51.439 1.00 62.67 C
ATOM 6126 O LEU A1052 2.153 -39.504 -51.861 1.00 62.67 O
ATOM 6127 CB LEU A1052 3.515 -41.680 -49.926 1.00 62.67 C
ATOM 6128 CG LEU A1052 4.054 -41.879 -48.511 1.00 62.67 C
ATOM 6129 CD1 LEU A1052 5.380 -42.604 -48.534 1.00 62.67 C
ATOM 6130 CD2 LEU A1052 4.186 -40.566 -47.787 1.00 62.67 C
ATOM 6131 N ALA A1053 1.171 -41.499 -52.198 1.00 61.94 N
ATOM 6132 CA ALA A1053 0.766 -41.134 -53.553 1.00 61.94 C
ATOM 6133 C ALA A1053 -0.315 -40.064 -53.527 1.00 61.94 C
ATOM 6134 O ALA A1053 -0.342 -39.167 -54.384 1.00 61.94 O
ATOM 6135 CB ALA A1053 0.280 -42.366 -54.307 1.00 61.94 C
ATOM 6136 N TRP A1054 -1.201 -40.137 -52.536 1.00 60.37 N
ATOM 6137 CA TRP A1054 -2.196 -39.094 -52.338 1.00 60.37 C
ATOM 6138 C TRP A1054 -1.538 -37.769 -51.995 1.00 60.37 C
ATOM 6139 O TRP A1054 -1.949 -36.710 -52.493 1.00 60.37 O
ATOM 6140 CB TRP A1054 -3.152 -39.523 -51.235 1.00 60.37 C
ATOM 6141 CG TRP A1054 -4.140 -38.517 -50.895 1.00 60.37 C
ATOM 6142 CD1 TRP A1054 -5.099 -38.011 -51.702 1.00 60.37 C
ATOM 6143 CD2 TRP A1054 -4.293 -37.883 -49.637 1.00 60.37 C
ATOM 6144 NE1 TRP A1054 -5.846 -37.087 -51.024 1.00 60.37 N
ATOM 6145 CE2 TRP A1054 -5.367 -36.993 -49.748 1.00 60.37 C
ATOM 6146 CE3 TRP A1054 -3.624 -37.980 -48.424 1.00 60.37 C
ATOM 6147 CZ2 TRP A1054 -5.787 -36.208 -48.694 1.00 60.37 C
ATOM 6148 CZ3 TRP A1054 -4.037 -37.196 -47.383 1.00 60.37 C
ATOM 6149 CH2 TRP A1054 -5.114 -36.330 -47.516 1.00 60.37 C
ATOM 6150 N GLU A1055 -0.489 -37.820 -51.171 1.00 60.56 N
ATOM 6151 CA GLU A1055 0.258 -36.605 -50.860 1.00 60.56 C
ATOM 6152 C GLU A1055 0.949 -36.050 -52.097 1.00 60.56 C
ATOM 6153 O GLU A1055 1.029 -34.832 -52.274 1.00 60.56 O
ATOM 6154 CB GLU A1055 1.271 -36.869 -49.753 1.00 60.56 C
ATOM 6155 CG GLU A1055 2.023 -35.625 -49.310 1.00 60.56 C
ATOM 6156 CD GLU A1055 2.951 -35.880 -48.150 1.00 60.56 C
ATOM 6157 OE1 GLU A1055 2.967 -37.020 -47.654 1.00 60.56 O
ATOM 6158 OE2 GLU A1055 3.684 -34.955 -47.744 1.00 60.56 O
ATOM 6159 N ALA A1056 1.410 -36.929 -52.988 1.00 59.67 N
ATOM 6160 CA ALA A1056 2.044 -36.474 -54.224 1.00 59.67 C
ATOM 6161 C ALA A1056 1.047 -35.776 -55.141 1.00 59.67 C
ATOM 6162 O ALA A1056 1.367 -34.747 -55.759 1.00 59.67 O
ATOM 6163 CB ALA A1056 2.694 -37.653 -54.945 1.00 59.67 C
ATOM 6164 N VAL A1057 -0.171 -36.316 -55.227 1.00 59.06 N
ATOM 6165 CA VAL A1057 -1.218 -35.680 -56.026 1.00 59.06 C
ATOM 6166 C VAL A1057 -1.573 -34.316 -55.452 1.00 59.06 C
ATOM 6167 O VAL A1057 -1.730 -33.327 -56.190 1.00 59.06 O
ATOM 6168 CB VAL A1057 -2.446 -36.600 -56.110 1.00 59.06 C
ATOM 6169 CG1 VAL A1057 -3.584 -35.908 -56.814 1.00 59.06 C
ATOM 6170 CG2 VAL A1057 -2.088 -37.859 -56.844 1.00 59.06 C
ATOM 6171 N MET A1058 -1.647 -34.226 -54.123 1.00 57.61 N
ATOM 6172 CA MET A1058 -1.929 -32.940 -53.498 1.00 57.61 C
ATOM 6173 C MET A1058 -0.783 -31.954 -53.682 1.00 57.61 C
ATOM 6174 O MET A1058 -1.010 -30.744 -53.784 1.00 57.61 O
ATOM 6175 CB MET A1058 -2.246 -33.128 -52.022 1.00 57.61 C
ATOM 6176 CG MET A1058 -3.576 -33.788 -51.804 1.00 57.61 C
ATOM 6177 SD MET A1058 -4.850 -32.871 -52.669 1.00 57.61 S
ATOM 6178 CE MET A1058 -4.714 -31.287 -51.842 1.00 57.61 C
ATOM 6179 N LYS A1059 0.449 -32.455 -53.768 1.00 56.48 N
ATOM 6180 CA LYS A1059 1.579 -31.579 -54.050 1.00 56.48 C
ATOM 6181 C LYS A1059 1.491 -31.004 -55.452 1.00 56.48 C
ATOM 6182 O LYS A1059 1.781 -29.820 -55.662 1.00 56.48 O
ATOM 6183 CB LYS A1059 2.894 -32.330 -53.874 1.00 56.48 C
ATOM 6184 CG LYS A1059 4.109 -31.483 -54.182 1.00 56.48 C
ATOM 6185 CD LYS A1059 5.392 -32.206 -53.910 1.00 56.48 C
ATOM 6186 CE LYS A1059 5.800 -33.081 -55.071 1.00 56.48 C
ATOM 6187 NZ LYS A1059 5.240 -34.453 -54.983 1.00 56.48 N
ATOM 6188 N GLU A1060 1.076 -31.818 -56.424 1.00 60.34 N
ATOM 6189 CA GLU A1060 0.940 -31.286 -57.778 1.00 60.34 C
ATOM 6190 C GLU A1060 -0.190 -30.266 -57.865 1.00 60.34 C
ATOM 6191 O GLU A1060 -0.071 -29.250 -58.570 1.00 60.34 O
ATOM 6192 CB GLU A1060 0.727 -32.415 -58.777 1.00 60.34 C
ATOM 6193 CG GLU A1060 1.948 -33.279 -58.960 1.00 60.34 C
ATOM 6194 CD GLU A1060 1.753 -34.332 -60.022 1.00 60.34 C
ATOM 6195 OE1 GLU A1060 0.627 -34.437 -60.552 1.00 60.34 O
ATOM 6196 OE2 GLU A1060 2.723 -35.056 -60.328 1.00 60.34 O
ATOM 6197 N ASN A1061 -1.273 -30.489 -57.118 1.00 58.25 N
ATOM 6198 CA ASN A1061 -2.350 -29.502 -57.106 1.00 58.25 C
ATOM 6199 C ASN A1061 -1.945 -28.236 -56.360 1.00 58.25 C
ATOM 6200 O ASN A1061 -2.506 -27.162 -56.600 1.00 58.25 O
ATOM 6201 CB ASN A1061 -3.618 -30.097 -56.508 1.00 58.25 C
ATOM 6202 CG ASN A1061 -4.325 -31.023 -57.467 1.00 58.25 C
ATOM 6203 OD1 ASN A1061 -4.406 -30.747 -58.662 1.00 58.25 O
ATOM 6204 ND2 ASN A1061 -4.854 -32.121 -56.951 1.00 58.25 N
ATOM 6205 N TYR A1062 -0.983 -28.340 -55.445 1.00 55.70 N
ATOM 6206 CA TYR A1062 -0.388 -27.135 -54.872 1.00 55.70 C
ATOM 6207 C TYR A1062 0.459 -26.394 -55.894 1.00 55.70 C
ATOM 6208 O TYR A1062 0.423 -25.158 -55.965 1.00 55.70 O
ATOM 6209 CB TYR A1062 0.469 -27.495 -53.667 1.00 55.70 C
ATOM 6210 CG TYR A1062 1.163 -26.315 -53.046 1.00 55.70 C
ATOM 6211 CD1 TYR A1062 0.470 -25.444 -52.234 1.00 55.70 C
ATOM 6212 CD2 TYR A1062 2.515 -26.078 -53.265 1.00 55.70 C
ATOM 6213 CE1 TYR A1062 1.091 -24.373 -51.658 1.00 55.70 C
ATOM 6214 CE2 TYR A1062 3.145 -25.004 -52.697 1.00 55.70 C
ATOM 6215 CZ TYR A1062 2.426 -24.155 -51.893 1.00 55.70 C
ATOM 6216 OH TYR A1062 3.043 -23.077 -51.312 1.00 55.70 O
ATOM 6217 N LEU A1063 1.271 -27.134 -56.654 1.00 59.92 N
ATOM 6218 CA LEU A1063 2.227 -26.506 -57.561 1.00 59.92 C
ATOM 6219 C LEU A1063 1.531 -25.795 -58.706 1.00 59.92 C
ATOM 6220 O LEU A1063 2.017 -24.766 -59.188 1.00 59.92 O
ATOM 6221 CB LEU A1063 3.206 -27.534 -58.107 1.00 59.92 C
ATOM 6222 CG LEU A1063 4.210 -28.026 -57.081 1.00 59.92 C
ATOM 6223 CD1 LEU A1063 5.083 -29.093 -57.692 1.00 59.92 C
ATOM 6224 CD2 LEU A1063 5.038 -26.864 -56.595 1.00 59.92 C
ATOM 6225 N VAL A1064 0.382 -26.313 -59.139 1.00 59.89 N
ATOM 6226 CA VAL A1064 -0.371 -25.616 -60.178 1.00 59.89 C
ATOM 6227 C VAL A1064 -0.912 -24.291 -59.647 1.00 59.89 C
ATOM 6228 O VAL A1064 -0.817 -23.253 -60.316 1.00 59.89 O
ATOM 6229 CB VAL A1064 -1.486 -26.523 -60.722 1.00 59.89 C
ATOM 6230 CG1 VAL A1064 -2.374 -25.766 -61.682 1.00 59.89 C
ATOM 6231 CG2 VAL A1064 -0.876 -27.715 -61.428 1.00 59.89 C
ATOM 6232 N LYS A1065 -1.414 -24.290 -58.411 1.00 60.49 N
ATOM 6233 CA LYS A1065 -1.951 -23.061 -57.832 1.00 60.49 C
ATOM 6234 C LYS A1065 -0.855 -22.052 -57.525 1.00 60.49 C
ATOM 6235 O LYS A1065 -1.119 -20.848 -57.462 1.00 60.49 O
ATOM 6236 CB LYS A1065 -2.741 -23.362 -56.563 1.00 60.49 C
ATOM 6237 CG LYS A1065 -4.072 -24.029 -56.795 1.00 60.49 C
ATOM 6238 CD LYS A1065 -4.798 -24.234 -55.480 1.00 60.49 C
ATOM 6239 CE LYS A1065 -6.126 -24.938 -55.688 1.00 60.49 C
ATOM 6240 NZ LYS A1065 -6.832 -25.175 -54.400 1.00 60.49 N
ATOM 6241 N ILE A1066 0.375 -22.513 -57.305 1.00 63.50 N
ATOM 6242 CA ILE A1066 1.442 -21.559 -57.010 1.00 63.50 C
ATOM 6243 C ILE A1066 2.145 -21.125 -58.297 1.00 63.50 C
ATOM 6244 O ILE A1066 2.861 -20.118 -58.328 1.00 63.50 O
ATOM 6245 CB ILE A1066 2.424 -22.141 -55.978 1.00 63.50 C
ATOM 6246 CG1 ILE A1066 3.172 -21.015 -55.269 1.00 63.50 C
ATOM 6247 CG2 ILE A1066 3.430 -23.055 -56.638 1.00 63.50 C
ATOM 6248 CD1 ILE A1066 3.941 -21.461 -54.071 1.00 63.50 C
ATOM 6249 N ASN A1067 1.941 -21.865 -59.391 1.00 70.17 N
ATOM 6250 CA ASN A1067 2.544 -21.441 -60.650 1.00 70.17 C
ATOM 6251 C ASN A1067 1.581 -20.664 -61.534 1.00 70.17 C
ATOM 6252 O ASN A1067 2.016 -20.090 -62.538 1.00 70.17 O
ATOM 6253 CB ASN A1067 3.094 -22.643 -61.411 1.00 70.17 C
ATOM 6254 CG ASN A1067 4.355 -23.189 -60.789 1.00 70.17 C
ATOM 6255 OD1 ASN A1067 5.225 -22.431 -60.366 1.00 70.17 O
ATOM 6256 ND2 ASN A1067 4.463 -24.509 -60.729 1.00 70.17 N
ATOM 6257 N THR A1068 0.289 -20.626 -61.195 1.00 74.15 N
ATOM 6258 CA THR A1068 -0.618 -19.724 -61.908 1.00 74.15 C
ATOM 6259 C THR A1068 -0.371 -18.262 -61.548 1.00 74.15 C
ATOM 6260 O THR A1068 -0.885 -17.362 -62.222 1.00 74.15 O
ATOM 6261 CB THR A1068 -2.080 -20.078 -61.633 1.00 74.15 C
ATOM 6262 OG1 THR A1068 -2.301 -20.175 -60.220 1.00 74.15 O
ATOM 6263 CG2 THR A1068 -2.493 -21.358 -62.342 1.00 74.15 C
ATOM 6264 N LYS A1069 0.385 -18.005 -60.473 1.00 75.89 N
ATOM 6265 CA LYS A1069 0.587 -16.641 -59.989 1.00 75.89 C
ATOM 6266 C LYS A1069 1.379 -15.795 -60.980 1.00 75.89 C
ATOM 6267 O LYS A1069 1.172 -14.579 -61.072 1.00 75.89 O
ATOM 6268 CB LYS A1069 1.292 -16.669 -58.634 1.00 75.89 C
ATOM 6269 N ALA A1070 2.279 -16.414 -61.734 1.00 82.00 N
ATOM 6270 CA ALA A1070 3.056 -15.687 -62.729 1.00 82.00 C
ATOM 6271 C ALA A1070 2.210 -15.383 -63.959 1.00 82.00 C
ATOM 6272 O ALA A1070 1.110 -15.913 -64.114 1.00 82.00 O
ATOM 6273 CB ALA A1070 4.293 -16.476 -63.115 1.00 82.00 C
ATOM 6274 N UNK A1077 3.136 -8.702 -66.773 1.00299.40 N
ATOM 6275 CA UNK A1077 2.390 -7.609 -67.387 1.00299.40 C
ATOM 6276 C UNK A1077 3.316 -6.703 -68.196 1.00299.40 C
ATOM 6277 O UNK A1077 2.976 -6.279 -69.303 1.00299.40 O
ATOM 6278 CB UNK A1077 1.653 -6.798 -66.320 1.00299.40 C
ATOM 6279 N UNK A1078 4.482 -6.409 -67.630 1.00303.56 N
ATOM 6280 CA UNK A1078 5.503 -5.629 -68.320 1.00303.56 C
ATOM 6281 C UNK A1078 6.077 -6.453 -69.463 1.00303.56 C
ATOM 6282 O UNK A1078 6.357 -5.935 -70.546 1.00303.56 O
ATOM 6283 CB UNK A1078 6.612 -5.208 -67.355 1.00303.56 C
ATOM 6284 N UNK A1079 6.233 -7.750 -69.213 1.00305.13 N
ATOM 6285 CA UNK A1079 6.671 -8.684 -70.239 1.00305.13 C
ATOM 6286 C UNK A1079 5.571 -8.861 -71.279 1.00305.13 C
ATOM 6287 O UNK A1079 5.854 -9.024 -72.462 1.00305.13 O
ATOM 6288 CB UNK A1079 7.048 -10.032 -69.622 1.00305.13 C
ATOM 6289 N UNK A1080 4.319 -8.798 -70.834 1.00305.91 N
ATOM 6290 CA UNK A1080 3.174 -8.890 -71.734 1.00305.91 C
ATOM 6291 C UNK A1080 3.090 -7.663 -72.636 1.00305.91 C
ATOM 6292 O UNK A1080 2.833 -7.783 -73.836 1.00305.91 O
ATOM 6293 CB UNK A1080 1.878 -9.048 -70.940 1.00305.91 C
ATOM 6294 N UNK A1081 3.330 -6.490 -72.056 1.00310.60 N
ATOM 6295 CA UNK A1081 3.343 -5.241 -72.814 1.00310.60 C
ATOM 6296 C UNK A1081 4.523 -5.213 -73.781 1.00310.60 C
ATOM 6297 O UNK A1081 4.409 -4.707 -74.895 1.00310.60 O
ATOM 6298 CB UNK A1081 3.402 -4.037 -71.873 1.00310.60 C
ATOM 6299 N UNK A1082 5.645 -5.790 -73.358 1.00314.03 N
ATOM 6300 CA UNK A1082 6.821 -5.906 -74.213 1.00314.03 C
ATOM 6301 C UNK A1082 6.564 -6.861 -75.377 1.00314.03 C
ATOM 6302 O UNK A1082 7.021 -6.622 -76.492 1.00314.03 O
ATOM 6303 CB UNK A1082 8.026 -6.380 -73.401 1.00314.03 C
ATOM 6304 N UNK A1083 5.818 -7.928 -75.110 1.00315.42 N
ATOM 6305 CA UNK A1083 5.445 -8.895 -76.137 1.00315.42 C
ATOM 6306 C UNK A1083 4.482 -8.272 -77.135 1.00315.42 C
ATOM 6307 O UNK A1083 4.561 -8.536 -78.337 1.00315.42 O
ATOM 6308 CB UNK A1083 4.813 -10.136 -75.505 1.00315.42 C
ATOM 6309 N UNK A1084 3.581 -7.440 -76.621 1.00316.91 N
ATOM 6310 CA UNK A1084 2.652 -6.689 -77.458 1.00316.91 C
ATOM 6311 C UNK A1084 3.410 -5.699 -78.338 1.00316.91 C
ATOM 6312 O UNK A1084 3.089 -5.546 -79.517 1.00316.91 O
ATOM 6313 CB UNK A1084 1.621 -5.957 -76.596 1.00316.91 C
ATOM 6314 N UNK A1085 4.427 -5.060 -77.762 1.00318.19 N
ATOM 6315 CA UNK A1085 5.295 -4.140 -78.492 1.00318.19 C
ATOM 6316 C UNK A1085 6.078 -4.859 -79.589 1.00318.19 C
ATOM 6317 O UNK A1085 6.207 -4.345 -80.695 1.00318.19 O
ATOM 6318 CB UNK A1085 6.262 -3.443 -77.533 1.00318.19 C
ATOM 6319 N UNK A1086 6.570 -6.056 -79.280 1.00321.87 N
ATOM 6320 CA UNK A1086 7.310 -6.876 -80.241 1.00321.87 C
ATOM 6321 C UNK A1086 6.423 -7.359 -81.391 1.00321.87 C
ATOM 6322 O UNK A1086 6.843 -7.339 -82.548 1.00321.87 O
ATOM 6323 CB UNK A1086 7.946 -8.077 -79.538 1.00321.87 C
ATOM 6324 N UNK A1087 5.200 -7.776 -81.071 1.00323.49 N
ATOM 6325 CA UNK A1087 4.239 -8.200 -82.089 1.00323.49 C
ATOM 6326 C UNK A1087 3.807 -7.023 -82.967 1.00323.49 C
ATOM 6327 O UNK A1087 3.643 -7.172 -84.181 1.00323.49 O
ATOM 6328 CB UNK A1087 3.016 -8.847 -81.438 1.00323.49 C
ATOM 6329 N UNK A1088 3.647 -5.853 -82.351 1.00323.30 N
ATOM 6330 CA UNK A1088 3.307 -4.639 -83.078 1.00323.30 C
ATOM 6331 C UNK A1088 4.454 -4.220 -83.985 1.00323.30 C
ATOM 6332 O UNK A1088 4.225 -3.749 -85.097 1.00323.30 O
ATOM 6333 CB UNK A1088 2.964 -3.510 -82.107 1.00323.30 C
ATOM 6334 N UNK A1089 5.682 -4.416 -83.512 1.00325.54 N
ATOM 6335 CA UNK A1089 6.875 -4.136 -84.303 1.00325.54 C
ATOM 6336 C UNK A1089 6.978 -5.100 -85.480 1.00325.54 C
ATOM 6337 O UNK A1089 7.380 -4.701 -86.569 1.00325.54 O
ATOM 6338 CB UNK A1089 8.131 -4.224 -83.433 1.00325.54 C
ATOM 6339 N UNK A1090 6.590 -6.354 -85.257 1.00325.81 N
ATOM 6340 CA UNK A1090 6.544 -7.357 -86.320 1.00325.81 C
ATOM 6341 C UNK A1090 5.516 -6.990 -87.392 1.00325.81 C
ATOM 6342 O UNK A1090 5.793 -7.093 -88.590 1.00325.81 O
ATOM 6343 CB UNK A1090 6.223 -8.735 -85.739 1.00325.81 C
ATOM 6344 N UNK A1091 4.341 -6.546 -86.953 1.00326.47 N
ATOM 6345 CA UNK A1091 3.283 -6.120 -87.872 1.00326.47 C
ATOM 6346 C UNK A1091 3.669 -4.859 -88.648 1.00326.47 C
ATOM 6347 O UNK A1091 3.374 -4.745 -89.840 1.00326.47 O
ATOM 6348 CB UNK A1091 1.977 -5.880 -87.113 1.00326.47 C
ATOM 6349 N UNK A1092 4.342 -3.928 -87.975 1.00326.79 N
ATOM 6350 CA UNK A1092 4.835 -2.717 -88.620 1.00326.79 C
ATOM 6351 C UNK A1092 5.947 -3.044 -89.611 1.00326.79 C
ATOM 6352 O UNK A1092 6.047 -2.408 -90.658 1.00326.79 O
ATOM 6353 CB UNK A1092 5.338 -1.717 -87.578 1.00326.79 C
ATOM 6354 N UNK A1093 6.755 -4.051 -89.288 1.00326.86 N
ATOM 6355 CA UNK A1093 7.799 -4.534 -90.183 1.00326.86 C
ATOM 6356 C UNK A1093 7.192 -5.165 -91.431 1.00326.86 C
ATOM 6357 O UNK A1093 7.688 -4.949 -92.537 1.00326.86 O
ATOM 6358 CB UNK A1093 8.696 -5.544 -89.464 1.00326.86 C
ATOM 6359 N UNK A1094 6.116 -5.924 -91.243 1.00326.93 N
ATOM 6360 CA UNK A1094 5.382 -6.529 -92.356 1.00326.93 C
ATOM 6361 C UNK A1094 4.752 -5.468 -93.257 1.00326.93 C
ATOM 6362 O UNK A1094 4.831 -5.563 -94.486 1.00326.93 O
ATOM 6363 CB UNK A1094 4.299 -7.473 -91.834 1.00326.93 C
ATOM 6364 N UNK A1095 4.154 -4.454 -92.637 1.00325.94 N
ATOM 6365 CA UNK A1095 3.551 -3.341 -93.368 1.00325.94 C
ATOM 6366 C UNK A1095 4.595 -2.514 -94.121 1.00325.94 C
ATOM 6367 O UNK A1095 4.330 -2.055 -95.229 1.00325.94 O
ATOM 6368 CB UNK A1095 2.768 -2.438 -92.415 1.00325.94 C
ATOM 6369 N UNK A1096 5.776 -2.347 -93.530 1.00326.09 N
ATOM 6370 CA UNK A1096 6.863 -1.618 -94.176 1.00326.09 C
ATOM 6371 C UNK A1096 7.478 -2.414 -95.329 1.00326.09 C
ATOM 6372 O UNK A1096 7.844 -1.840 -96.356 1.00326.09 O
ATOM 6373 CB UNK A1096 7.945 -1.261 -93.155 1.00326.09 C
ATOM 6374 N UNK A1097 7.589 -3.726 -95.157 1.00325.38 N
ATOM 6375 CA UNK A1097 8.155 -4.590 -96.188 1.00325.38 C
ATOM 6376 C UNK A1097 7.188 -4.779 -97.352 1.00325.38 C
ATOM 6377 O UNK A1097 7.615 -4.995 -98.486 1.00325.38 O
ATOM 6378 CB UNK A1097 8.535 -5.949 -95.596 1.00325.38 C
ATOM 6379 N UNK A1098 5.890 -4.701 -97.075 1.00320.25 N
ATOM 6380 CA UNK A1098 4.894 -4.829 -98.130 1.00320.25 C
ATOM 6381 C UNK A1098 4.549 -3.474 -98.750 1.00320.25 C
ATOM 6382 O UNK A1098 4.007 -3.419 -99.856 1.00320.25 O
ATOM 6383 CB UNK A1098 3.627 -5.495 -97.587 1.00320.25 C
ATOM 6384 N UNK A1099 4.870 -2.391 -98.047 1.00316.21 N
ATOM 6385 CA UNK A1099 4.529 -1.048 -98.508 1.00316.21 C
ATOM 6386 C UNK A1099 5.665 -0.390 -99.286 1.00316.21 C
ATOM 6387 O UNK A1099 5.452 0.611 -99.972 1.00316.21 O
ATOM 6388 CB UNK A1099 4.140 -0.163 -97.323 1.00316.21 C
ATOM 6389 N UNK A1100 6.867 -0.947 -99.177 1.00310.31 N
ATOM 6390 CA UNK A1100 8.018 -0.411 -99.897 1.00310.31 C
ATOM 6391 C UNK A1100 8.020 -0.880-101.351 1.00310.31 C
ATOM 6392 O UNK A1100 7.600 -0.153-102.252 1.00310.31 O
ATOM 6393 CB UNK A1100 9.321 -0.822 -99.208 1.00310.31 C
HETATM25577 C21 KXP A1301 -12.579 -26.159 -20.425 1.00116.76 C
HETATM25578 C22 KXP A1301 -12.671 -24.705 -20.886 1.00116.76 C
HETATM25579 C18 KXP A1301 -11.874 -27.465 -18.611 1.00116.76 C
HETATM25580 C23 KXP A1301 -11.941 -24.457 -22.205 1.00116.76 C
HETATM25581 C29 KXP A1301 -13.640 -22.483 -26.143 1.00116.76 C
HETATM25582 C30 KXP A1301 -12.528 -23.498 -26.459 1.00116.76 C
HETATM25583 C31 KXP A1301 -12.540 -23.926 -27.935 1.00116.76 C
HETATM25584 C32 KXP A1301 -12.510 -22.720 -28.884 1.00116.76 C
HETATM25585 C33 KXP A1301 -13.623 -21.709 -28.568 1.00116.76 C
HETATM25586 C34 KXP A1301 -13.609 -21.279 -27.092 1.00116.76 C
HETATM25587 C49 KXP A1301 -14.738 -24.249 -19.879 1.00116.76 C
HETATM25588 O20 KXP A1301 -11.979 -26.185 -19.162 1.00116.76 O
HETATM25589 O24 KXP A1301 -12.321 -23.204 -22.698 1.00116.76 O
HETATM25590 O26 KXP A1301 -14.041 -24.454 -24.161 1.00116.76 O
HETATM25591 O27 KXP A1301 -14.836 -22.620 -22.713 1.00116.76 O
HETATM25592 O28 KXP A1301 -13.476 -22.027 -24.824 1.00116.76 O
HETATM25593 O35 KXP A1301 -14.734 -20.472 -26.842 1.00116.76 O
HETATM25594 O36 KXP A1301 -13.449 -20.574 -29.373 1.00116.76 O
HETATM25595 O38 KXP A1301 -15.011 -18.544 -29.684 1.00116.76 O
HETATM25596 O39 KXP A1301 -15.974 -20.808 -29.849 1.00116.76 O
HETATM25597 O40 KXP A1301 -14.511 -19.958 -31.641 1.00116.76 O
HETATM25598 O41 KXP A1301 -12.671 -23.176 -30.203 1.00116.76 O
HETATM25599 O43 KXP A1301 -10.323 -24.222 -30.425 1.00116.76 O
HETATM25600 O44 KXP A1301 -10.719 -21.998 -31.412 1.00116.76 O
HETATM25601 O45 KXP A1301 -11.710 -24.002 -32.451 1.00116.76 O
HETATM25602 O46 KXP A1301 -11.414 -24.730 -28.184 1.00116.76 O
HETATM25603 O47 KXP A1301 -11.285 -22.916 -26.165 1.00116.76 O
HETATM25604 O48 KXP A1301 -14.023 -24.398 -21.071 1.00116.76 O
HETATM25605 O50 KXP A1301 -14.474 -24.924 -18.942 1.00116.76 O
HETATM25606 P25 KXP A1301 -13.703 -23.096 -23.591 1.00116.76 P
HETATM25607 P37 KXP A1301 -14.764 -19.958 -30.154 1.00116.76 P
HETATM25608 P42 KXP A1301 -11.327 -23.353 -31.143 1.00116.76 P
HETATM25623 C17 KXP A1301 -15.861 -23.219 -19.786 1.00116.76 C
HETATM25624 C12 KXS A1302 0.041 -30.072 -14.536 1.00 88.90 C
HETATM25625 C14 KXS A1302 0.150 -28.110 -15.901 1.00 88.90 C
HETATM25626 C15 KXS A1302 -1.228 -27.993 -15.835 1.00 88.90 C
HETATM25627 C16 KXS A1302 -1.969 -28.917 -15.120 1.00 88.90 C
HETATM25628 C18 KXS A1302 1.954 -27.667 -17.385 1.00 88.90 C
HETATM25629 C20 KXS A1302 0.438 -34.591 -11.590 1.00 88.90 C
HETATM25630 C01 KXS A1302 -4.068 -31.298 -8.028 1.00 88.90 C
HETATM25631 C02 KXS A1302 -3.744 -32.250 -9.192 1.00 88.90 C
HETATM25632 C03 KXS A1302 -2.649 -33.198 -8.704 1.00 88.90 C
HETATM25633 C04 KXS A1302 -2.260 -34.093 -9.864 1.00 88.90 C
HETATM25634 C05 KXS A1302 -1.585 -33.244 -10.937 1.00 88.90 C
HETATM25635 C06 KXS A1302 -2.579 -32.229 -11.523 1.00 88.90 C
HETATM25636 C07 KXS A1302 -3.358 -31.463 -10.452 1.00 88.90 C
HETATM25637 C08 KXS A1302 -1.793 -31.176 -12.314 1.00 88.90 C
HETATM25638 C11 KXS A1302 -1.334 -29.957 -14.464 1.00 88.90 C
HETATM25639 C13 KXS A1302 0.782 -29.149 -15.243 1.00 88.90 C
HETATM25640 C19 KXS A1302 -0.951 -34.144 -12.025 1.00 88.90 C
HETATM25641 C21 KXS A1302 -1.801 -35.350 -12.412 1.00 88.90 C
HETATM25642 N10 KXS A1302 -2.089 -30.942 -13.710 1.00 88.90 N
HETATM25643 O09 KXS A1302 -0.931 -30.563 -11.781 1.00 88.90 O
HETATM25644 O17 KXS A1302 0.891 -27.167 -16.622 1.00 88.90 O
TER 25645 KXS A1302
ATOM 6395 N UNK B 53 -8.105 55.559 -67.323 1.00146.36 N
ATOM 6396 CA UNK B 53 -7.452 56.487 -68.238 1.00146.36 C
ATOM 6397 C UNK B 53 -7.038 57.760 -67.510 1.00146.36 C
ATOM 6398 O UNK B 53 -7.393 58.862 -67.923 1.00146.36 O
ATOM 6399 CB UNK B 53 -8.376 56.827 -69.409 1.00146.36 C
ATOM 6400 N UNK B 54 -6.282 57.600 -66.429 1.00148.00 N
ATOM 6401 CA UNK B 54 -5.860 58.736 -65.617 1.00148.00 C
ATOM 6402 C UNK B 54 -4.694 59.485 -66.248 1.00148.00 C
ATOM 6403 O UNK B 54 -4.081 59.028 -67.212 1.00148.00 O
ATOM 6404 CB UNK B 54 -5.473 58.273 -64.212 1.00148.00 C
ATOM 6405 N UNK B 55 -4.394 60.649 -65.684 1.00141.16 N
ATOM 6406 CA UNK B 55 -3.274 61.460 -66.139 1.00141.16 C
ATOM 6407 C UNK B 55 -2.178 61.464 -65.081 1.00141.16 C
ATOM 6408 O UNK B 55 -2.456 61.588 -63.889 1.00141.16 O
ATOM 6409 CB UNK B 55 -3.728 62.888 -66.445 1.00141.16 C
ATOM 6410 N UNK B 56 -0.934 61.333 -65.522 1.00131.26 N
ATOM 6411 CA UNK B 56 0.192 61.250 -64.604 1.00131.26 C
ATOM 6412 C UNK B 56 0.525 62.600 -63.978 1.00131.26 C
ATOM 6413 O UNK B 56 0.052 63.642 -64.430 1.00131.26 O
ATOM 6414 CB UNK B 56 1.419 60.696 -65.326 1.00131.26 C
ATOM 6415 N UNK B 57 1.350 62.563 -62.937 1.00128.32 N
ATOM 6416 CA UNK B 57 1.754 63.763 -62.214 1.00128.32 C
ATOM 6417 C UNK B 57 3.040 63.511 -61.439 1.00128.32 C
ATOM 6418 O UNK B 57 3.037 62.741 -60.480 1.00128.32 O
ATOM 6419 CB UNK B 57 0.651 64.212 -61.253 1.00128.32 C
ATOM 6420 N UNK B 58 4.130 64.154 -61.845 1.00129.76 N
ATOM 6421 CA UNK B 58 5.405 63.969 -61.163 1.00129.76 C
ATOM 6422 C UNK B 58 6.317 65.184 -61.290 1.00129.76 C
ATOM 6423 O UNK B 58 5.933 66.208 -61.857 1.00129.76 O
ATOM 6424 CB UNK B 58 6.119 62.731 -61.701 1.00129.76 C
ATOM 6425 N UNK B 59 7.532 65.051 -60.764 1.00131.22 N
ATOM 6426 CA UNK B 59 8.486 66.156 -60.703 1.00131.22 C
ATOM 6427 C UNK B 59 9.061 66.512 -62.070 1.00131.22 C
ATOM 6428 O UNK B 59 9.433 65.616 -62.828 1.00131.22 O
ATOM 6429 CB UNK B 59 9.626 65.815 -59.742 1.00131.22 C
ATOM 6430 N UNK B 60 9.123 67.818 -62.349 1.00127.31 N
ATOM 6431 CA UNK B 60 9.620 68.403 -63.604 1.00127.31 C
ATOM 6432 C UNK B 60 8.922 67.840 -64.837 1.00127.31 C
ATOM 6433 O UNK B 60 9.548 67.655 -65.880 1.00127.31 O
ATOM 6434 CB UNK B 60 11.136 68.207 -63.732 1.00127.31 C
ATOM 6435 N UNK B 61 7.625 67.580 -64.716 1.00125.56 N
ATOM 6436 CA UNK B 61 6.905 66.856 -65.751 1.00125.56 C
ATOM 6437 C UNK B 61 5.581 67.501 -66.130 1.00125.56 C
ATOM 6438 O UNK B 61 4.616 67.451 -65.370 1.00125.56 O
ATOM 6439 CB UNK B 61 6.655 65.420 -65.296 1.00125.56 C
ATOM 6440 N UNK B 62 5.540 68.098 -67.315 1.00125.06 N
ATOM 6441 CA UNK B 62 4.291 68.598 -67.866 1.00125.06 C
ATOM 6442 C UNK B 62 3.479 67.418 -68.380 1.00125.06 C
ATOM 6443 O UNK B 62 4.013 66.556 -69.074 1.00125.06 O
ATOM 6444 CB UNK B 62 4.553 69.604 -68.986 1.00125.06 C
ATOM 6445 N UNK B 63 2.198 67.369 -68.038 1.00121.17 N
ATOM 6446 CA UNK B 63 1.354 66.256 -68.454 1.00121.17 C
ATOM 6447 C UNK B 63 0.619 66.567 -69.753 1.00121.17 C
ATOM 6448 O UNK B 63 0.624 67.701 -70.236 1.00121.17 O
ATOM 6449 CB UNK B 63 0.351 65.904 -67.355 1.00121.17 C
ATOM 6450 N UNK B 64 -0.008 65.543 -70.318 1.00127.95 N
ATOM 6451 CA UNK B 64 -0.783 65.685 -71.541 1.00127.95 C
ATOM 6452 C UNK B 64 -1.829 64.584 -71.587 1.00127.95 C
ATOM 6453 O UNK B 64 -1.674 63.556 -70.932 1.00127.95 O
ATOM 6454 CB UNK B 64 0.118 65.623 -72.774 1.00127.95 C
ATOM 6455 N UNK B 65 -2.886 64.794 -72.360 1.00130.05 N
ATOM 6456 CA UNK B 65 -3.978 63.831 -72.423 1.00130.05 C
ATOM 6457 C UNK B 65 -3.627 62.639 -73.304 1.00130.05 C
ATOM 6458 O UNK B 65 -2.594 62.624 -73.977 1.00130.05 O
ATOM 6459 CB UNK B 65 -5.254 64.500 -72.937 1.00130.05 C
ATOM 6460 N UNK B 66 -4.499 61.638 -73.289 1.00140.73 N
ATOM 6461 CA UNK B 66 -4.328 60.462 -74.128 1.00140.73 C
ATOM 6462 C UNK B 66 -4.818 60.748 -75.540 1.00140.73 C
ATOM 6463 O UNK B 66 -5.530 59.938 -76.133 1.00140.73 O
ATOM 6464 CB UNK B 66 -5.081 59.268 -73.542 1.00140.73 C
ATOM 6465 N UNK B 105 0.265 56.877 -60.967 1.00125.02 N
ATOM 6466 CA UNK B 105 1.600 56.549 -61.458 1.00125.02 C
ATOM 6467 C UNK B 105 2.431 57.802 -61.690 1.00125.02 C
ATOM 6468 O UNK B 105 2.336 58.423 -62.747 1.00125.02 O
ATOM 6469 CB UNK B 105 1.509 55.746 -62.754 1.00125.02 C
ATOM 6470 N UNK B 106 3.247 58.165 -60.704 1.00130.02 N
ATOM 6471 CA UNK B 106 4.112 59.330 -60.816 1.00130.02 C
ATOM 6472 C UNK B 106 5.251 59.058 -61.792 1.00130.02 C
ATOM 6473 O UNK B 106 6.213 58.365 -61.462 1.00130.02 O
ATOM 6474 CB UNK B 106 4.668 59.719 -59.448 1.00130.02 C
ATOM 6475 N UNK B 107 5.133 59.610 -62.995 1.00126.69 N
ATOM 6476 CA UNK B 107 6.094 59.351 -64.057 1.00126.69 C
ATOM 6477 C UNK B 107 6.964 60.571 -64.335 1.00126.69 C
ATOM 6478 O UNK B 107 6.485 61.567 -64.875 1.00126.69 O
ATOM 6479 CB UNK B 107 5.365 58.924 -65.331 1.00126.69 C
ATOM 6480 N UNK B 108 8.239 60.490 -63.968 1.00120.94 N
ATOM 6481 CA UNK B 108 9.164 61.605 -64.148 1.00120.94 C
ATOM 6482 C UNK B 108 9.589 61.770 -65.605 1.00120.94 C
ATOM 6483 O UNK B 108 10.698 61.386 -65.976 1.00120.94 O
ATOM 6484 CB UNK B 108 10.401 61.414 -63.270 1.00120.94 C
ATOM 6485 N UNK B 109 8.720 62.362 -66.418 1.00120.31 N
ATOM 6486 CA UNK B 109 8.975 62.501 -67.848 1.00120.31 C
ATOM 6487 C UNK B 109 9.975 63.611 -68.155 1.00120.31 C
ATOM 6488 O UNK B 109 10.540 64.229 -67.254 1.00120.31 O
ATOM 6489 CB UNK B 109 7.668 62.761 -68.598 1.00120.31 C
ATOM 6490 N UNK B 110 10.196 63.857 -69.442 1.00120.85 N
ATOM 6491 CA UNK B 110 11.111 64.907 -69.871 1.00120.85 C
ATOM 6492 C UNK B 110 10.674 65.480 -71.213 1.00120.85 C
ATOM 6493 O UNK B 110 11.504 65.889 -72.025 1.00120.85 O
ATOM 6494 CB UNK B 110 12.542 64.377 -69.964 1.00120.85 C
ATOM 6495 N UNK B 111 9.364 65.506 -71.432 1.00117.29 N
ATOM 6496 CA UNK B 111 8.792 66.025 -72.668 1.00117.29 C
ATOM 6497 C UNK B 111 8.939 67.540 -72.756 1.00117.29 C
ATOM 6498 O UNK B 111 8.694 68.135 -73.808 1.00117.29 O
ATOM 6499 CB UNK B 111 7.318 65.636 -72.775 1.00117.29 C
ATOM 6500 N LYS B 116 10.479 55.595 -63.556 1.00113.28 N
ATOM 6501 CA LYS B 116 9.449 55.629 -64.585 1.00113.28 C
ATOM 6502 C LYS B 116 9.690 56.781 -65.547 1.00113.28 C
ATOM 6503 O LYS B 116 8.758 57.486 -65.925 1.00113.28 O
ATOM 6504 CB LYS B 116 8.064 55.750 -63.952 1.00113.28 C
ATOM 6505 N TYR B 117 10.952 56.957 -65.935 1.00112.66 N
ATOM 6506 CA TYR B 117 11.336 58.081 -66.777 1.00112.66 C
ATOM 6507 C TYR B 117 10.795 57.912 -68.190 1.00112.66 C
ATOM 6508 O TYR B 117 10.851 56.827 -68.770 1.00112.66 O
ATOM 6509 CB TYR B 117 12.857 58.215 -66.812 1.00112.66 C
ATOM 6510 N ILE B 118 10.260 58.995 -68.740 1.00114.90 N
ATOM 6511 CA ILE B 118 9.676 59.004 -70.074 1.00114.90 C
ATOM 6512 C ILE B 118 10.400 60.052 -70.901 1.00114.90 C
ATOM 6513 O ILE B 118 10.510 61.209 -70.483 1.00114.90 O
ATOM 6514 CB ILE B 118 8.167 59.300 -70.032 1.00114.90 C
ATOM 6515 CG1 ILE B 118 7.432 58.216 -69.253 1.00114.90 C
ATOM 6516 CG2 ILE B 118 7.601 59.409 -71.437 1.00114.90 C
ATOM 6517 CD1 ILE B 118 5.992 58.557 -68.973 1.00114.90 C
ATOM 6518 N ARG B 119 10.895 59.652 -72.066 1.00118.68 N
ATOM 6519 CA ARG B 119 11.500 60.579 -73.010 1.00118.68 C
ATOM 6520 C ARG B 119 10.783 60.468 -74.345 1.00118.68 C
ATOM 6521 O ARG B 119 10.694 59.377 -74.917 1.00118.68 O
ATOM 6522 CB ARG B 119 12.993 60.297 -73.183 1.00118.68 C
ATOM 6523 N LEU B 120 10.263 61.590 -74.832 1.00128.32 N
ATOM 6524 CA LEU B 120 9.756 61.654 -76.194 1.00128.32 C
ATOM 6525 C LEU B 120 10.910 62.006 -77.120 1.00128.32 C
ATOM 6526 O LEU B 120 11.758 62.834 -76.774 1.00128.32 O
ATOM 6527 CB LEU B 120 8.638 62.689 -76.311 1.00128.32 C
ATOM 6528 N SER B 121 10.951 61.377 -78.291 1.00133.31 N
ATOM 6529 CA SER B 121 12.135 61.480 -79.128 1.00133.31 C
ATOM 6530 C SER B 121 11.752 61.510 -80.599 1.00133.31 C
ATOM 6531 O SER B 121 10.758 60.914 -81.018 1.00133.31 O
ATOM 6532 CB SER B 121 13.099 60.319 -78.862 1.00133.31 C
ATOM 6533 OG SER B 121 12.515 59.085 -79.244 1.00133.31 O
ATOM 6534 N CYS B 122 12.562 62.221 -81.377 1.00129.30 N
ATOM 6535 CA CYS B 122 12.483 62.135 -82.824 1.00129.30 C
ATOM 6536 C CYS B 122 13.305 60.948 -83.320 1.00129.30 C
ATOM 6537 O CYS B 122 14.225 60.472 -82.651 1.00129.30 O
ATOM 6538 CB CYS B 122 12.975 63.430 -83.467 1.00129.30 C
ATOM 6539 N ASP B 123 12.967 60.475 -84.518 1.00123.46 N
ATOM 6540 CA ASP B 123 13.560 59.253 -85.059 1.00123.46 C
ATOM 6541 C ASP B 123 14.959 59.556 -85.591 1.00123.46 C
ATOM 6542 O ASP B 123 15.170 59.796 -86.782 1.00123.46 O
ATOM 6543 CB ASP B 123 12.666 58.666 -86.142 1.00123.46 C
ATOM 6544 N THR B 124 15.935 59.517 -84.680 1.00132.57 N
ATOM 6545 CA THR B 124 17.338 59.737 -85.020 1.00132.57 C
ATOM 6546 C THR B 124 18.219 59.171 -83.911 1.00132.57 C
ATOM 6547 O THR B 124 17.770 58.964 -82.781 1.00132.57 O
ATOM 6548 CB THR B 124 17.646 61.226 -85.230 1.00132.57 C
ATOM 6549 N ASP B 125 19.489 58.923 -84.267 1.00134.63 N
ATOM 6550 CA ASP B 125 20.602 58.709 -83.326 1.00134.63 C
ATOM 6551 C ASP B 125 20.394 57.509 -82.401 1.00134.63 C
ATOM 6552 O ASP B 125 20.238 57.652 -81.187 1.00134.63 O
ATOM 6553 CB ASP B 125 20.870 59.976 -82.510 1.00134.63 C
ATOM 6554 N SER B 126 20.386 56.311 -82.994 1.00136.98 N
ATOM 6555 CA SER B 126 20.196 55.089 -82.215 1.00136.98 C
ATOM 6556 C SER B 126 21.385 54.817 -81.299 1.00136.98 C
ATOM 6557 O SER B 126 21.213 54.366 -80.159 1.00136.98 O
ATOM 6558 CB SER B 126 19.972 53.904 -83.154 1.00136.98 C
ATOM 6559 OG SER B 126 18.789 54.070 -83.910 1.00136.98 O
ATOM 6560 N GLU B 127 22.600 55.079 -81.789 1.00132.35 N
ATOM 6561 CA GLU B 127 23.793 54.836 -80.985 1.00132.35 C
ATOM 6562 C GLU B 127 23.869 55.799 -79.808 1.00132.35 C
ATOM 6563 O GLU B 127 24.210 55.394 -78.691 1.00132.35 O
ATOM 6564 CB GLU B 127 25.045 54.952 -81.855 1.00132.35 C
ATOM 6565 N THR B 128 23.520 57.068 -80.037 1.00131.45 N
ATOM 6566 CA THR B 128 23.447 58.029 -78.942 1.00131.45 C
ATOM 6567 C THR B 128 22.325 57.675 -77.977 1.00131.45 C
ATOM 6568 O THR B 128 22.441 57.911 -76.770 1.00131.45 O
ATOM 6569 CB THR B 128 23.250 59.440 -79.494 1.00131.45 C
ATOM 6570 N LEU B 129 21.244 57.078 -78.490 1.00130.87 N
ATOM 6571 CA LEU B 129 20.135 56.646 -77.642 1.00130.87 C
ATOM 6572 C LEU B 129 20.550 55.524 -76.700 1.00130.87 C
ATOM 6573 O LEU B 129 20.255 55.568 -75.496 1.00130.87 O
ATOM 6574 CB LEU B 129 18.966 56.198 -78.513 1.00130.87 C
ATOM 6575 CG LEU B 129 17.744 55.669 -77.776 1.00130.87 C
ATOM 6576 CD1 LEU B 129 17.174 56.737 -76.872 1.00130.87 C
ATOM 6577 CD2 LEU B 129 16.708 55.198 -78.774 1.00130.87 C
ATOM 6578 N TYR B 130 21.236 54.509 -77.231 1.00132.30 N
ATOM 6579 CA TYR B 130 21.721 53.429 -76.381 1.00132.30 C
ATOM 6580 C TYR B 130 22.809 53.918 -75.435 1.00132.30 C
ATOM 6581 O TYR B 130 22.896 53.452 -74.293 1.00132.30 O
ATOM 6582 CB TYR B 130 22.225 52.267 -77.234 1.00132.30 C
ATOM 6583 CG TYR B 130 22.775 51.113 -76.426 1.00132.30 C
ATOM 6584 CD1 TYR B 130 21.929 50.276 -75.712 1.00132.30 C
ATOM 6585 CD2 TYR B 130 24.140 50.855 -76.386 1.00132.30 C
ATOM 6586 CE1 TYR B 130 22.428 49.223 -74.971 1.00132.30 C
ATOM 6587 CE2 TYR B 130 24.648 49.802 -75.650 1.00132.30 C
ATOM 6588 CZ TYR B 130 23.786 48.990 -74.947 1.00132.30 C
ATOM 6589 OH TYR B 130 24.285 47.943 -74.212 1.00132.30 O
ATOM 6590 N ASP B 131 23.630 54.876 -75.882 1.00130.49 N
ATOM 6591 CA ASP B 131 24.635 55.465 -75.004 1.00130.49 C
ATOM 6592 C ASP B 131 23.986 56.222 -73.850 1.00130.49 C
ATOM 6593 O ASP B 131 24.476 56.177 -72.718 1.00130.49 O
ATOM 6594 CB ASP B 131 25.551 56.390 -75.803 1.00130.49 C
ATOM 6595 N LEU B 132 22.863 56.892 -74.117 1.00131.15 N
ATOM 6596 CA LEU B 132 22.125 57.568 -73.056 1.00131.15 C
ATOM 6597 C LEU B 132 21.499 56.569 -72.093 1.00131.15 C
ATOM 6598 O LEU B 132 21.533 56.768 -70.874 1.00131.15 O
ATOM 6599 CB LEU B 132 21.052 58.474 -73.657 1.00131.15 C
ATOM 6600 N MET B 133 20.936 55.479 -72.619 1.00132.58 N
ATOM 6601 CA MET B 133 20.297 54.493 -71.747 1.00132.58 C
ATOM 6602 C MET B 133 21.324 53.725 -70.919 1.00132.58 C
ATOM 6603 O MET B 133 21.006 53.204 -69.843 1.00132.58 O
ATOM 6604 CB MET B 133 19.439 53.536 -72.566 1.00132.58 C
ATOM 6605 CG MET B 133 18.197 54.177 -73.131 1.00132.58 C
ATOM 6606 SD MET B 133 17.148 52.983 -73.969 1.00132.58 S
ATOM 6607 CE MET B 133 18.097 52.711 -75.461 1.00132.58 C
ATOM 6608 N THR B 134 22.563 53.637 -71.405 1.00133.60 N
ATOM 6609 CA THR B 134 23.614 53.020 -70.601 1.00133.60 C
ATOM 6610 C THR B 134 24.178 53.996 -69.576 1.00133.60 C
ATOM 6611 O THR B 134 24.384 53.636 -68.412 1.00133.60 O
ATOM 6612 CB THR B 134 24.731 52.487 -71.495 1.00133.60 C
ATOM 6613 OG1 THR B 134 25.183 53.523 -72.373 1.00133.60 O
ATOM 6614 CG2 THR B 134 24.264 51.278 -72.289 1.00133.60 C
ATOM 6615 N GLN B 135 24.448 55.236 -69.993 1.00132.56 N
ATOM 6616 CA GLN B 135 25.137 56.176 -69.116 1.00132.56 C
ATOM 6617 C GLN B 135 24.218 56.705 -68.024 1.00132.56 C
ATOM 6618 O GLN B 135 24.660 56.942 -66.894 1.00132.56 O
ATOM 6619 CB GLN B 135 25.707 57.330 -69.938 1.00132.56 C
ATOM 6620 N HIS B 136 22.937 56.904 -68.337 1.00134.98 N
ATOM 6621 CA HIS B 136 22.051 57.553 -67.379 1.00134.98 C
ATOM 6622 C HIS B 136 21.418 56.553 -66.418 1.00134.98 C
ATOM 6623 O HIS B 136 21.506 56.726 -65.197 1.00134.98 O
ATOM 6624 CB HIS B 136 20.986 58.358 -68.120 1.00134.98 C
ATOM 6625 CG HIS B 136 21.538 59.532 -68.869 1.00134.98 C
ATOM 6626 ND1 HIS B 136 21.976 60.675 -68.237 1.00134.98 N
ATOM 6627 CD2 HIS B 136 21.727 59.741 -70.193 1.00134.98 C
ATOM 6628 CE1 HIS B 136 22.411 61.536 -69.139 1.00134.98 C
ATOM 6629 NE2 HIS B 136 22.272 60.993 -70.335 1.00134.98 N
ATOM 6630 N TRP B 137 20.781 55.501 -66.933 1.00132.91 N
ATOM 6631 CA TRP B 137 20.021 54.631 -66.042 1.00132.91 C
ATOM 6632 C TRP B 137 20.577 53.216 -65.906 1.00132.91 C
ATOM 6633 O TRP B 137 20.909 52.783 -64.796 1.00132.91 O
ATOM 6634 CB TRP B 137 18.573 54.515 -66.517 1.00132.91 C
ATOM 6635 CG TRP B 137 17.777 55.775 -66.503 1.00132.91 C
ATOM 6636 CD1 TRP B 137 17.119 56.317 -65.442 1.00132.91 C
ATOM 6637 CD2 TRP B 137 17.488 56.612 -67.627 1.00132.91 C
ATOM 6638 NE1 TRP B 137 16.465 57.463 -65.826 1.00132.91 N
ATOM 6639 CE2 TRP B 137 16.674 57.661 -67.165 1.00132.91 C
ATOM 6640 CE3 TRP B 137 17.850 56.580 -68.976 1.00132.91 C
ATOM 6641 CZ2 TRP B 137 16.220 58.675 -68.004 1.00132.91 C
ATOM 6642 CZ3 TRP B 137 17.398 57.583 -69.805 1.00132.91 C
ATOM 6643 CH2 TRP B 137 16.591 58.616 -69.318 1.00132.91 C
ATOM 6644 N HIS B 138 20.694 52.492 -67.015 1.00125.03 N
ATOM 6645 CA HIS B 138 20.751 51.038 -66.975 1.00125.03 C
ATOM 6646 C HIS B 138 22.147 50.506 -67.263 1.00125.03 C
ATOM 6647 O HIS B 138 22.935 51.120 -67.984 1.00125.03 O
ATOM 6648 CB HIS B 138 19.766 50.433 -67.974 1.00125.03 C
ATOM 6649 N LEU B 139 22.436 49.339 -66.690 1.00117.22 N
ATOM 6650 CA LEU B 139 23.699 48.652 -66.916 1.00117.22 C
ATOM 6651 C LEU B 139 23.654 47.844 -68.210 1.00117.22 C
ATOM 6652 O LEU B 139 22.599 47.658 -68.820 1.00117.22 O
ATOM 6653 CB LEU B 139 24.031 47.765 -65.713 1.00117.22 C
ATOM 6654 CG LEU B 139 22.996 46.771 -65.170 1.00117.22 C
ATOM 6655 CD1 LEU B 139 23.087 45.394 -65.797 1.00117.22 C
ATOM 6656 CD2 LEU B 139 23.115 46.670 -63.658 1.00117.22 C
ATOM 6657 N LYS B 140 24.826 47.374 -68.636 1.00114.05 N
ATOM 6658 CA LYS B 140 24.910 46.567 -69.847 1.00114.05 C
ATOM 6659 C LYS B 140 24.306 45.194 -69.601 1.00114.05 C
ATOM 6660 O LYS B 140 24.596 44.542 -68.595 1.00114.05 O
ATOM 6661 CB LYS B 140 26.363 46.429 -70.298 1.00114.05 C
ATOM 6662 N THR B 141 23.471 44.744 -70.535 1.00112.59 N
ATOM 6663 CA THR B 141 22.671 43.569 -70.210 1.00112.59 C
ATOM 6664 C THR B 141 22.950 42.422 -71.166 1.00112.59 C
ATOM 6665 O THR B 141 23.033 42.637 -72.383 1.00112.59 O
ATOM 6666 CB THR B 141 21.191 43.914 -70.241 1.00112.59 C
ATOM 6667 OG1 THR B 141 20.870 44.530 -71.492 1.00112.59 O
ATOM 6668 CG2 THR B 141 20.848 44.843 -69.090 1.00112.59 C
ATOM 6669 N PRO B 142 23.074 41.200 -70.641 1.00110.32 N
ATOM 6670 CA PRO B 142 23.540 40.087 -71.480 1.00110.32 C
ATOM 6671 C PRO B 142 22.490 39.564 -72.437 1.00110.32 C
ATOM 6672 O PRO B 142 22.834 38.886 -73.409 1.00110.32 O
ATOM 6673 CB PRO B 142 23.928 39.016 -70.450 1.00110.32 C
ATOM 6674 CG PRO B 142 24.064 39.752 -69.156 1.00110.32 C
ATOM 6675 CD PRO B 142 23.062 40.841 -69.215 1.00110.32 C
ATOM 6676 N ASN B 143 21.216 39.842 -72.187 1.00111.94 N
ATOM 6677 CA ASN B 143 20.141 39.267 -72.980 1.00111.94 C
ATOM 6678 C ASN B 143 19.104 40.344 -73.256 1.00111.94 C
ATOM 6679 O ASN B 143 19.012 41.331 -72.525 1.00111.94 O
ATOM 6680 CB ASN B 143 19.504 38.077 -72.251 1.00111.94 C
ATOM 6681 CG ASN B 143 18.655 37.221 -73.157 1.00111.94 C
ATOM 6682 OD1 ASN B 143 18.535 37.488 -74.349 1.00111.94 O
ATOM 6683 ND2 ASN B 143 18.061 36.179 -72.597 1.00111.94 N
ATOM 6684 N LEU B 144 18.335 40.158 -74.326 1.00107.67 N
ATOM 6685 CA LEU B 144 17.193 41.016 -74.611 1.00107.67 C
ATOM 6686 C LEU B 144 16.167 40.246 -75.429 1.00107.67 C
ATOM 6687 O LEU B 144 16.512 39.587 -76.413 1.00107.67 O
ATOM 6688 CB LEU B 144 17.631 42.305 -75.314 1.00107.67 C
ATOM 6689 CG LEU B 144 18.349 42.317 -76.656 1.00107.67 C
ATOM 6690 CD1 LEU B 144 17.374 42.489 -77.809 1.00107.67 C
ATOM 6691 CD2 LEU B 144 19.363 43.427 -76.632 1.00107.67 C
ATOM 6692 N VAL B 145 14.911 40.318 -75.003 1.00106.15 N
ATOM 6693 CA VAL B 145 13.810 39.603 -75.629 1.00106.15 C
ATOM 6694 C VAL B 145 12.849 40.625 -76.211 1.00106.15 C
ATOM 6695 O VAL B 145 12.281 41.436 -75.474 1.00106.15 O
ATOM 6696 CB VAL B 145 13.090 38.699 -74.614 1.00106.15 C
ATOM 6697 CG1 VAL B 145 11.875 38.059 -75.237 1.00106.15 C
ATOM 6698 CG2 VAL B 145 14.028 37.642 -74.089 1.00106.15 C
ATOM 6699 N ILE B 146 12.660 40.587 -77.524 1.00112.43 N
ATOM 6700 CA ILE B 146 11.650 41.390 -78.203 1.00112.43 C
ATOM 6701 C ILE B 146 10.438 40.516 -78.490 1.00112.43 C
ATOM 6702 O ILE B 146 10.556 39.457 -79.115 1.00112.43 O
ATOM 6703 CB ILE B 146 12.201 42.037 -79.490 1.00112.43 C
ATOM 6704 CG1 ILE B 146 11.181 42.997 -80.117 1.00112.43 C
ATOM 6705 CG2 ILE B 146 12.703 41.001 -80.461 1.00112.43 C
ATOM 6706 CD1 ILE B 146 11.718 43.885 -81.174 1.00112.43 C
ATOM 6707 N SER B 147 9.279 40.950 -78.009 1.00110.62 N
ATOM 6708 CA SER B 147 8.024 40.251 -78.224 1.00110.62 C
ATOM 6709 C SER B 147 7.030 41.195 -78.876 1.00110.62 C
ATOM 6710 O SER B 147 6.942 42.368 -78.504 1.00110.62 O
ATOM 6711 CB SER B 147 7.458 39.725 -76.910 1.00110.62 C
ATOM 6712 OG SER B 147 7.093 40.796 -76.064 1.00110.62 O
ATOM 6713 N VAL B 148 6.294 40.682 -79.852 1.00119.15 N
ATOM 6714 CA VAL B 148 5.247 41.450 -80.504 1.00119.15 C
ATOM 6715 C VAL B 148 3.896 40.791 -80.272 1.00119.15 C
ATOM 6716 O VAL B 148 3.667 39.657 -80.695 1.00119.15 O
ATOM 6717 CB VAL B 148 5.522 41.605 -82.003 1.00119.15 C
ATOM 6718 CG1 VAL B 148 4.373 42.329 -82.668 1.00119.15 C
ATOM 6719 CG2 VAL B 148 6.823 42.350 -82.225 1.00119.15 C
ATOM 6720 N LYS B 153 -6.169 45.107 -81.167 1.00129.46 N
ATOM 6721 CA LYS B 153 -5.235 44.006 -80.973 1.00129.46 C
ATOM 6722 C LYS B 153 -5.544 43.245 -79.690 1.00129.46 C
ATOM 6723 O LYS B 153 -4.640 42.741 -79.026 1.00129.46 O
ATOM 6724 CB LYS B 153 -3.797 44.522 -80.941 1.00129.46 C
ATOM 6725 N ASN B 154 -6.826 43.167 -79.346 1.00129.68 N
ATOM 6726 CA ASN B 154 -7.236 42.474 -78.133 1.00129.68 C
ATOM 6727 C ASN B 154 -7.207 40.966 -78.337 1.00129.68 C
ATOM 6728 O ASN B 154 -7.424 40.466 -79.444 1.00129.68 O
ATOM 6729 CB ASN B 154 -8.635 42.918 -77.712 1.00129.68 C
ATOM 6730 N PHE B 155 -6.930 40.239 -77.257 1.00127.06 N
ATOM 6731 CA PHE B 155 -6.859 38.787 -77.289 1.00127.06 C
ATOM 6732 C PHE B 155 -7.355 38.234 -75.962 1.00127.06 C
ATOM 6733 O PHE B 155 -7.645 38.978 -75.023 1.00127.06 O
ATOM 6734 CB PHE B 155 -5.434 38.292 -77.570 1.00127.06 C
ATOM 6735 N ALA B 156 -7.454 36.910 -75.897 1.00124.64 N
ATOM 6736 CA ALA B 156 -7.932 36.207 -74.714 1.00124.64 C
ATOM 6737 C ALA B 156 -6.838 35.280 -74.205 1.00124.64 C
ATOM 6738 O ALA B 156 -6.113 34.672 -75.000 1.00124.64 O
ATOM 6739 CB ALA B 156 -9.205 35.421 -75.022 1.00124.64 C
ATOM 6740 N LEU B 157 -6.719 35.178 -72.885 1.00122.55 N
ATOM 6741 CA LEU B 157 -5.706 34.317 -72.297 1.00122.55 C
ATOM 6742 C LEU B 157 -6.178 32.869 -72.287 1.00122.55 C
ATOM 6743 O LEU B 157 -7.362 32.583 -72.098 1.00122.55 O
ATOM 6744 CB LEU B 157 -5.367 34.787 -70.877 1.00122.55 C
ATOM 6745 CG LEU B 157 -6.360 34.709 -69.707 1.00122.55 C
ATOM 6746 CD1 LEU B 157 -6.174 33.444 -68.864 1.00122.55 C
ATOM 6747 CD2 LEU B 157 -6.281 35.955 -68.836 1.00122.55 C
ATOM 6748 N LYS B 158 -5.239 31.957 -72.496 1.00129.76 N
ATOM 6749 CA LYS B 158 -5.475 30.530 -72.334 1.00129.76 C
ATOM 6750 C LYS B 158 -4.975 30.140 -70.949 1.00129.76 C
ATOM 6751 O LYS B 158 -4.206 30.897 -70.346 1.00129.76 O
ATOM 6752 CB LYS B 158 -4.762 29.745 -73.440 1.00129.76 C
ATOM 6753 N PRO B 159 -5.382 28.993 -70.396 1.00128.04 N
ATOM 6754 CA PRO B 159 -4.790 28.583 -69.110 1.00128.04 C
ATOM 6755 C PRO B 159 -3.359 28.080 -69.225 1.00128.04 C
ATOM 6756 O PRO B 159 -2.676 27.958 -68.202 1.00128.04 O
ATOM 6757 CB PRO B 159 -5.748 27.492 -68.616 1.00128.04 C
ATOM 6758 CG PRO B 159 -6.409 26.982 -69.839 1.00128.04 C
ATOM 6759 CD PRO B 159 -6.548 28.162 -70.747 1.00128.04 C
ATOM 6760 N ARG B 160 -2.880 27.773 -70.433 1.00128.62 N
ATOM 6761 CA ARG B 160 -1.495 27.338 -70.610 1.00128.62 C
ATOM 6762 C ARG B 160 -0.560 28.517 -70.862 1.00128.62 C
ATOM 6763 O ARG B 160 0.551 28.559 -70.322 1.00128.62 O
ATOM 6764 CB ARG B 160 -1.383 26.334 -71.762 1.00128.62 C
ATOM 6765 CG ARG B 160 -0.001 25.712 -71.868 1.00128.62 C
ATOM 6766 CD ARG B 160 0.137 24.801 -73.065 1.00128.62 C
ATOM 6767 NE ARG B 160 0.139 25.555 -74.312 1.00128.62 N
ATOM 6768 CZ ARG B 160 0.111 24.997 -75.516 1.00128.62 C
ATOM 6769 NH1 ARG B 160 0.083 23.677 -75.636 1.00128.62 N
ATOM 6770 NH2 ARG B 160 0.115 25.758 -76.602 1.00128.62 N
ATOM 6771 N MET B 161 -0.993 29.467 -71.698 1.00128.49 N
ATOM 6772 CA MET B 161 -0.204 30.621 -72.127 1.00128.49 C
ATOM 6773 C MET B 161 0.263 31.495 -70.968 1.00128.49 C
ATOM 6774 O MET B 161 1.339 32.105 -71.035 1.00128.49 O
ATOM 6775 CB MET B 161 -1.018 31.463 -73.106 1.00128.49 C
ATOM 6776 CG MET B 161 -1.327 30.758 -74.410 1.00128.49 C
ATOM 6777 SD MET B 161 0.145 30.359 -75.366 1.00128.49 S
ATOM 6778 CE MET B 161 0.662 31.993 -75.886 1.00128.49 C
ATOM 6779 N ARG B 162 -0.553 31.558 -69.910 1.00126.55 N
ATOM 6780 CA ARG B 162 -0.184 32.283 -68.698 1.00126.55 C
ATOM 6781 C ARG B 162 1.058 31.688 -68.049 1.00126.55 C
ATOM 6782 O ARG B 162 1.966 32.423 -67.635 1.00126.55 O
ATOM 6783 CB ARG B 162 -1.354 32.266 -67.719 1.00126.55 C
ATOM 6784 N LYS B 163 1.117 30.354 -67.971 1.00128.67 N
ATOM 6785 CA LYS B 163 2.303 29.665 -67.469 1.00128.67 C
ATOM 6786 C LYS B 163 3.513 29.923 -68.357 1.00128.67 C
ATOM 6787 O LYS B 163 4.630 30.097 -67.855 1.00128.67 O
ATOM 6788 CB LYS B 163 2.008 28.166 -67.357 1.00128.67 C
ATOM 6789 CG LYS B 163 3.156 27.282 -66.888 1.00128.67 C
ATOM 6790 CD LYS B 163 3.738 26.474 -68.044 1.00128.67 C
ATOM 6791 CE LYS B 163 4.817 25.525 -67.568 1.00128.67 C
ATOM 6792 NZ LYS B 163 4.263 24.483 -66.663 1.00128.67 N
ATOM 6793 N ILE B 164 3.300 29.994 -69.674 1.00122.87 N
ATOM 6794 CA ILE B 164 4.396 30.221 -70.615 1.00122.87 C
ATOM 6795 C ILE B 164 4.991 31.611 -70.430 1.00122.87 C
ATOM 6796 O ILE B 164 6.215 31.776 -70.366 1.00122.87 O
ATOM 6797 CB ILE B 164 3.900 30.006 -72.054 1.00122.87 C
ATOM 6798 CG1 ILE B 164 3.422 28.569 -72.222 1.00122.87 C
ATOM 6799 CG2 ILE B 164 4.994 30.312 -73.055 1.00122.87 C
ATOM 6800 CD1 ILE B 164 2.689 28.324 -73.508 1.00122.87 C
ATOM 6801 N PHE B 165 4.139 32.623 -70.291 1.00123.24 N
ATOM 6802 CA PHE B 165 4.658 33.983 -70.183 1.00123.24 C
ATOM 6803 C PHE B 165 5.223 34.262 -68.794 1.00123.24 C
ATOM 6804 O PHE B 165 6.192 35.025 -68.659 1.00123.24 O
ATOM 6805 CB PHE B 165 3.567 34.972 -70.570 1.00123.24 C
ATOM 6806 CG PHE B 165 3.265 34.965 -72.037 1.00123.24 C
ATOM 6807 CD1 PHE B 165 4.211 34.517 -72.946 1.00123.24 C
ATOM 6808 CD2 PHE B 165 2.025 35.351 -72.509 1.00123.24 C
ATOM 6809 CE1 PHE B 165 3.939 34.489 -74.298 1.00123.24 C
ATOM 6810 CE2 PHE B 165 1.746 35.318 -73.865 1.00123.24 C
ATOM 6811 CZ PHE B 165 2.706 34.891 -74.758 1.00123.24 C
ATOM 6812 N SER B 166 4.669 33.624 -67.756 1.00123.57 N
ATOM 6813 CA SER B 166 5.286 33.713 -66.436 1.00123.57 C
ATOM 6814 C SER B 166 6.648 33.029 -66.423 1.00123.57 C
ATOM 6815 O SER B 166 7.592 33.520 -65.792 1.00123.57 O
ATOM 6816 CB SER B 166 4.369 33.098 -65.383 1.00123.57 C
ATOM 6817 OG SER B 166 4.244 31.703 -65.577 1.00123.57 O
ATOM 6818 N ARG B 167 6.772 31.915 -67.152 1.00118.92 N
ATOM 6819 CA ARG B 167 8.056 31.245 -67.306 1.00118.92 C
ATOM 6820 C ARG B 167 9.058 32.131 -68.033 1.00118.92 C
ATOM 6821 O ARG B 167 10.236 32.191 -67.656 1.00118.92 O
ATOM 6822 CB ARG B 167 7.848 29.936 -68.063 1.00118.92 C
ATOM 6823 CG ARG B 167 9.099 29.127 -68.274 1.00118.92 C
ATOM 6824 CD ARG B 167 9.622 28.635 -66.951 1.00118.92 C
ATOM 6825 NE ARG B 167 8.670 27.737 -66.312 1.00118.92 N
ATOM 6826 CZ ARG B 167 8.755 27.337 -65.050 1.00118.92 C
ATOM 6827 NH1 ARG B 167 9.753 27.755 -64.286 1.00118.92 N
ATOM 6828 NH2 ARG B 167 7.841 26.518 -64.552 1.00118.92 N
ATOM 6829 N LEU B 168 8.595 32.846 -69.063 1.00113.41 N
ATOM 6830 CA LEU B 168 9.478 33.717 -69.832 1.00113.41 C
ATOM 6831 C LEU B 168 9.989 34.875 -68.986 1.00113.41 C
ATOM 6832 O LEU B 168 11.181 35.200 -69.024 1.00113.41 O
ATOM 6833 CB LEU B 168 8.740 34.228 -71.069 1.00113.41 C
ATOM 6834 CG LEU B 168 9.517 34.920 -72.188 1.00113.41 C
ATOM 6835 CD1 LEU B 168 8.850 34.578 -73.492 1.00113.41 C
ATOM 6836 CD2 LEU B 168 9.553 36.430 -72.035 1.00113.41 C
ATOM 6837 N ILE B 169 9.106 35.497 -68.203 1.00113.49 N
ATOM 6838 CA ILE B 169 9.540 36.610 -67.362 1.00113.49 C
ATOM 6839 C ILE B 169 10.419 36.109 -66.216 1.00113.49 C
ATOM 6840 O ILE B 169 11.354 36.801 -65.785 1.00113.49 O
ATOM 6841 CB ILE B 169 8.311 37.402 -66.877 1.00113.49 C
ATOM 6842 CG1 ILE B 169 7.596 38.000 -68.081 1.00113.49 C
ATOM 6843 CG2 ILE B 169 8.685 38.545 -65.956 1.00113.49 C
ATOM 6844 CD1 ILE B 169 6.285 38.644 -67.747 1.00113.49 C
ATOM 6845 N TYR B 170 10.193 34.872 -65.762 1.00115.22 N
ATOM 6846 CA TYR B 170 11.069 34.288 -64.751 1.00115.22 C
ATOM 6847 C TYR B 170 12.479 34.064 -65.288 1.00115.22 C
ATOM 6848 O TYR B 170 13.467 34.346 -64.596 1.00115.22 O
ATOM 6849 CB TYR B 170 10.475 32.976 -64.249 1.00115.22 C
ATOM 6850 CG TYR B 170 11.284 32.343 -63.153 1.00115.22 C
ATOM 6851 CD1 TYR B 170 11.276 32.876 -61.870 1.00115.22 C
ATOM 6852 CD2 TYR B 170 12.052 31.214 -63.394 1.00115.22 C
ATOM 6853 CE1 TYR B 170 12.012 32.306 -60.856 1.00115.22 C
ATOM 6854 CE2 TYR B 170 12.795 30.634 -62.385 1.00115.22 C
ATOM 6855 CZ TYR B 170 12.770 31.186 -61.117 1.00115.22 C
ATOM 6856 OH TYR B 170 13.505 30.617 -60.103 1.00115.22 O
ATOM 6857 N ILE B 171 12.588 33.576 -66.528 1.00111.46 N
ATOM 6858 CA ILE B 171 13.894 33.426 -67.172 1.00111.46 C
ATOM 6859 C ILE B 171 14.552 34.786 -67.373 1.00111.46 C
ATOM 6860 O ILE B 171 15.761 34.947 -67.159 1.00111.46 O
ATOM 6861 CB ILE B 171 13.741 32.662 -68.500 1.00111.46 C
ATOM 6862 CG1 ILE B 171 13.306 31.227 -68.232 1.00111.46 C
ATOM 6863 CG2 ILE B 171 15.029 32.649 -69.297 1.00111.46 C
ATOM 6864 CD1 ILE B 171 12.851 30.504 -69.467 1.00111.46 C
ATOM 6865 N ALA B 172 13.754 35.792 -67.741 1.00107.79 N
ATOM 6866 CA ALA B 172 14.291 37.129 -67.979 1.00107.79 C
ATOM 6867 C ALA B 172 14.811 37.767 -66.698 1.00107.79 C
ATOM 6868 O ALA B 172 15.749 38.571 -66.733 1.00107.79 O
ATOM 6869 CB ALA B 172 13.224 38.014 -68.614 1.00107.79 C
ATOM 6870 N GLN B 173 14.212 37.432 -65.557 1.00113.29 N
ATOM 6871 CA GLN B 173 14.747 37.936 -64.297 1.00113.29 C
ATOM 6872 C GLN B 173 15.965 37.136 -63.857 1.00113.29 C
ATOM 6873 O GLN B 173 16.898 37.693 -63.266 1.00113.29 O
ATOM 6874 CB GLN B 173 13.673 37.916 -63.213 1.00113.29 C
ATOM 6875 CG GLN B 173 14.100 38.559 -61.903 1.00113.29 C
ATOM 6876 CD GLN B 173 12.996 38.579 -60.873 1.00113.29 C
ATOM 6877 OE1 GLN B 173 11.890 38.099 -61.122 1.00113.29 O
ATOM 6878 NE2 GLN B 173 13.291 39.125 -59.703 1.00113.29 N
ATOM 6879 N SER B 174 15.976 35.829 -64.138 1.00109.84 N
ATOM 6880 CA SER B 174 17.085 34.988 -63.697 1.00109.84 C
ATOM 6881 C SER B 174 18.372 35.313 -64.444 1.00109.84 C
ATOM 6882 O SER B 174 19.435 35.441 -63.827 1.00109.84 O
ATOM 6883 CB SER B 174 16.730 33.516 -63.875 1.00109.84 C
ATOM 6884 OG SER B 174 16.621 33.195 -65.247 1.00109.84 O
ATOM 6885 N LYS B 175 18.304 35.454 -65.767 1.00100.44 N
ATOM 6886 CA LYS B 175 19.515 35.796 -66.506 1.00100.44 C
ATOM 6887 C LYS B 175 19.837 37.279 -66.401 1.00100.44 C
ATOM 6888 O LYS B 175 21.010 37.657 -66.331 1.00100.44 O
ATOM 6889 CB LYS B 175 19.375 35.405 -67.973 1.00100.44 C
ATOM 6890 CG LYS B 175 19.170 33.932 -68.204 1.00100.44 C
ATOM 6891 CD LYS B 175 20.398 33.148 -67.816 1.00100.44 C
ATOM 6892 CE LYS B 175 20.249 31.692 -68.211 1.00100.44 C
ATOM 6893 NZ LYS B 175 19.224 30.998 -67.387 1.00100.44 N
ATOM 6894 N GLY B 176 18.816 38.129 -66.415 1.00106.52 N
ATOM 6895 CA GLY B 176 19.018 39.561 -66.465 1.00106.52 C
ATOM 6896 C GLY B 176 18.902 40.017 -67.902 1.00106.52 C
ATOM 6897 O GLY B 176 19.838 39.828 -68.683 1.00106.52 O
ATOM 6898 N ALA B 177 17.773 40.607 -68.270 1.00108.71 N
ATOM 6899 CA ALA B 177 17.472 40.847 -69.671 1.00108.71 C
ATOM 6900 C ALA B 177 16.622 42.095 -69.858 1.00108.71 C
ATOM 6901 O ALA B 177 16.237 42.765 -68.899 1.00108.71 O
ATOM 6902 CB ALA B 177 16.749 39.649 -70.289 1.00108.71 C
ATOM 6903 N TRP B 178 16.340 42.392 -71.119 1.00105.82 N
ATOM 6904 CA TRP B 178 15.471 43.491 -71.504 1.00105.82 C
ATOM 6905 C TRP B 178 14.278 42.951 -72.273 1.00105.82 C
ATOM 6906 O TRP B 178 14.433 42.096 -73.148 1.00105.82 O
ATOM 6907 CB TRP B 178 16.214 44.513 -72.354 1.00105.82 C
ATOM 6908 CG TRP B 178 17.085 45.400 -71.565 1.00105.82 C
ATOM 6909 CD1 TRP B 178 17.151 45.471 -70.215 1.00105.82 C
ATOM 6910 CD2 TRP B 178 17.997 46.377 -72.065 1.00105.82 C
ATOM 6911 NE1 TRP B 178 18.050 46.429 -69.836 1.00105.82 N
ATOM 6912 CE2 TRP B 178 18.591 46.995 -70.957 1.00105.82 C
ATOM 6913 CE3 TRP B 178 18.375 46.784 -73.348 1.00105.82 C
ATOM 6914 CZ2 TRP B 178 19.546 47.998 -71.085 1.00105.82 C
ATOM 6915 CZ3 TRP B 178 19.321 47.779 -73.475 1.00105.82 C
ATOM 6916 CH2 TRP B 178 19.895 48.375 -72.351 1.00105.82 C
ATOM 6917 N ILE B 179 13.094 43.442 -71.936 1.00103.75 N
ATOM 6918 CA ILE B 179 11.875 43.117 -72.656 1.00103.75 C
ATOM 6919 C ILE B 179 11.465 44.343 -73.459 1.00103.75 C
ATOM 6920 O ILE B 179 11.316 45.435 -72.900 1.00103.75 O
ATOM 6921 CB ILE B 179 10.752 42.677 -71.705 1.00103.75 C
ATOM 6922 CG1 ILE B 179 11.111 41.366 -71.010 1.00103.75 C
ATOM 6923 CG2 ILE B 179 9.445 42.546 -72.454 1.00103.75 C
ATOM 6924 CD1 ILE B 179 10.142 40.986 -69.923 1.00103.75 C
ATOM 6925 N PHE B 180 11.301 44.169 -74.766 1.00105.37 N
ATOM 6926 CA PHE B 180 10.777 45.203 -75.640 1.00105.37 C
ATOM 6927 C PHE B 180 9.387 44.795 -76.096 1.00105.37 C
ATOM 6928 O PHE B 180 9.220 43.757 -76.739 1.00105.37 O
ATOM 6929 CB PHE B 180 11.697 45.427 -76.834 1.00105.37 C
ATOM 6930 CG PHE B 180 12.982 46.105 -76.481 1.00105.37 C
ATOM 6931 CD1 PHE B 180 13.043 47.479 -76.390 1.00105.37 C
ATOM 6932 CD2 PHE B 180 14.120 45.372 -76.213 1.00105.37 C
ATOM 6933 CE1 PHE B 180 14.220 48.115 -76.055 1.00105.37 C
ATOM 6934 CE2 PHE B 180 15.303 46.000 -75.877 1.00105.37 C
ATOM 6935 CZ PHE B 180 15.351 47.376 -75.798 1.00105.37 C
ATOM 6936 N THR B 181 8.392 45.601 -75.744 1.00113.95 N
ATOM 6937 CA THR B 181 7.007 45.248 -75.998 1.00113.95 C
ATOM 6938 C THR B 181 6.333 46.378 -76.753 1.00113.95 C
ATOM 6939 O THR B 181 6.935 47.419 -77.022 1.00113.95 O
ATOM 6940 CB THR B 181 6.245 44.960 -74.703 1.00113.95 C
ATOM 6941 N GLY B 182 5.061 46.157 -77.087 1.00124.47 N
ATOM 6942 CA GLY B 182 4.337 47.126 -77.895 1.00124.47 C
ATOM 6943 C GLY B 182 3.992 48.395 -77.139 1.00124.47 C
ATOM 6944 O GLY B 182 3.789 49.450 -77.744 1.00124.47 O
ATOM 6945 N GLY B 183 3.916 48.312 -75.814 1.00125.75 N
ATOM 6946 CA GLY B 183 3.529 49.471 -75.028 1.00125.75 C
ATOM 6947 C GLY B 183 2.072 49.837 -75.177 1.00125.75 C
ATOM 6948 O GLY B 183 1.714 51.012 -75.052 1.00125.75 O
ATOM 6949 N THR B 184 1.215 48.852 -75.433 1.00132.79 N
ATOM 6950 CA THR B 184 -0.184 49.067 -75.781 1.00132.79 C
ATOM 6951 C THR B 184 -0.969 49.506 -74.555 1.00132.79 C
ATOM 6952 O THR B 184 -0.430 49.526 -73.441 1.00132.79 O
ATOM 6953 CB THR B 184 -0.798 47.802 -76.378 1.00132.79 C
ATOM 6954 N HIS B 185 -2.222 49.902 -74.776 1.00136.89 N
ATOM 6955 CA HIS B 185 -3.151 50.294 -73.714 1.00136.89 C
ATOM 6956 C HIS B 185 -3.346 49.095 -72.789 1.00136.89 C
ATOM 6957 O HIS B 185 -2.813 49.111 -71.672 1.00136.89 O
ATOM 6958 CB HIS B 185 -4.418 50.831 -74.359 1.00136.89 C
ATOM 6959 N TYR B 186 -4.008 48.032 -73.235 1.00134.27 N
ATOM 6960 CA TYR B 186 -4.239 46.830 -72.448 1.00134.27 C
ATOM 6961 C TYR B 186 -4.427 45.667 -73.405 1.00134.27 C
ATOM 6962 O TYR B 186 -4.918 45.848 -74.523 1.00134.27 O
ATOM 6963 CB TYR B 186 -5.460 46.954 -71.525 1.00134.27 C
ATOM 6964 CG TYR B 186 -5.252 47.883 -70.355 1.00134.27 C
ATOM 6965 CD1 TYR B 186 -4.527 47.473 -69.244 1.00134.27 C
ATOM 6966 CD2 TYR B 186 -5.758 49.175 -70.368 1.00134.27 C
ATOM 6967 CE1 TYR B 186 -4.320 48.320 -68.173 1.00134.27 C
ATOM 6968 CE2 TYR B 186 -5.557 50.033 -69.299 1.00134.27 C
ATOM 6969 CZ TYR B 186 -4.838 49.598 -68.205 1.00134.27 C
ATOM 6970 OH TYR B 186 -4.635 50.445 -67.139 1.00134.27 O
ATOM 6971 N GLY B 187 -4.019 44.486 -72.965 1.00133.71 N
ATOM 6972 CA GLY B 187 -4.101 43.288 -73.767 1.00133.71 C
ATOM 6973 C GLY B 187 -3.096 42.272 -73.276 1.00133.71 C
ATOM 6974 O GLY B 187 -3.028 41.969 -72.081 1.00133.71 O
ATOM 6975 N LEU B 188 -2.297 41.748 -74.203 1.00128.29 N
ATOM 6976 CA LEU B 188 -1.259 40.799 -73.829 1.00128.29 C
ATOM 6977 C LEU B 188 -0.111 41.511 -73.118 1.00128.29 C
ATOM 6978 O LEU B 188 0.466 40.978 -72.157 1.00128.29 O
ATOM 6979 CB LEU B 188 -0.788 40.065 -75.085 1.00128.29 C
ATOM 6980 N MET B 189 0.217 42.724 -73.571 1.00123.61 N
ATOM 6981 CA MET B 189 1.281 43.508 -72.950 1.00123.61 C
ATOM 6982 C MET B 189 0.898 43.933 -71.540 1.00123.61 C
ATOM 6983 O MET B 189 1.758 44.072 -70.663 1.00123.61 O
ATOM 6984 CB MET B 189 1.600 44.726 -73.816 1.00123.61 C
ATOM 6985 N LYS B 190 -0.399 44.125 -71.302 1.00121.53 N
ATOM 6986 CA LYS B 190 -0.917 44.383 -69.965 1.00121.53 C
ATOM 6987 C LYS B 190 -0.658 43.205 -69.041 1.00121.53 C
ATOM 6988 O LYS B 190 -0.267 43.390 -67.884 1.00121.53 O
ATOM 6989 CB LYS B 190 -2.413 44.671 -70.016 1.00121.53 C
ATOM 6990 N TYR B 191 -0.859 41.990 -69.550 1.00118.93 N
ATOM 6991 CA TYR B 191 -0.628 40.805 -68.733 1.00118.93 C
ATOM 6992 C TYR B 191 0.857 40.613 -68.454 1.00118.93 C
ATOM 6993 O TYR B 191 1.242 40.191 -67.356 1.00118.93 O
ATOM 6994 CB TYR B 191 -1.214 39.568 -69.409 1.00118.93 C
ATOM 6995 CG TYR B 191 -1.070 38.343 -68.553 1.00118.93 C
ATOM 6996 CD1 TYR B 191 -1.832 38.196 -67.404 1.00118.93 C
ATOM 6997 CD2 TYR B 191 -0.173 37.340 -68.883 1.00118.93 C
ATOM 6998 CE1 TYR B 191 -1.705 37.089 -66.606 1.00118.93 C
ATOM 6999 CE2 TYR B 191 -0.040 36.222 -68.090 1.00118.93 C
ATOM 7000 CZ TYR B 191 -0.810 36.104 -66.953 1.00118.93 C
ATOM 7001 OH TYR B 191 -0.689 35.004 -66.144 1.00118.93 O
ATOM 7002 N ILE B 192 1.704 40.927 -69.442 1.00119.23 N
ATOM 7003 CA ILE B 192 3.150 40.880 -69.227 1.00119.23 C
ATOM 7004 C ILE B 192 3.568 41.891 -68.165 1.00119.23 C
ATOM 7005 O ILE B 192 4.349 41.565 -67.264 1.00119.23 O
ATOM 7006 CB ILE B 192 3.908 41.094 -70.551 1.00119.23 C
ATOM 7007 CG1 ILE B 192 3.713 39.900 -71.479 1.00119.23 C
ATOM 7008 CG2 ILE B 192 5.391 41.298 -70.323 1.00119.23 C
ATOM 7009 CD1 ILE B 192 4.353 40.094 -72.833 1.00119.23 C
ATOM 7010 N GLY B 193 3.021 43.109 -68.222 1.00114.79 N
ATOM 7011 CA GLY B 193 3.323 44.102 -67.198 1.00114.79 C
ATOM 7012 C GLY B 193 2.828 43.702 -65.820 1.00114.79 C
ATOM 7013 O GLY B 193 3.484 43.977 -64.809 1.00114.79 O
ATOM 7014 N GLU B 194 1.688 43.009 -65.766 1.00110.99 N
ATOM 7015 CA GLU B 194 1.169 42.516 -64.493 1.00110.99 C
ATOM 7016 C GLU B 194 2.080 41.449 -63.894 1.00110.99 C
ATOM 7017 O GLU B 194 2.374 41.480 -62.691 1.00110.99 O
ATOM 7018 CB GLU B 194 -0.244 41.969 -64.683 1.00110.99 C
ATOM 7019 N VAL B 195 2.549 40.510 -64.719 1.00108.66 N
ATOM 7020 CA VAL B 195 3.433 39.459 -64.213 1.00108.66 C
ATOM 7021 C VAL B 195 4.798 40.040 -63.843 1.00108.66 C
ATOM 7022 O VAL B 195 5.446 39.583 -62.891 1.00108.66 O
ATOM 7023 CB VAL B 195 3.521 38.311 -65.241 1.00108.66 C
ATOM 7024 CG1 VAL B 195 4.478 37.219 -64.807 1.00108.66 C
ATOM 7025 CG2 VAL B 195 2.154 37.697 -65.439 1.00108.66 C
ATOM 7026 N VAL B 196 5.223 41.099 -64.544 1.00108.66 N
ATOM 7027 CA VAL B 196 6.436 41.827 -64.167 1.00108.66 C
ATOM 7028 C VAL B 196 6.289 42.450 -62.786 1.00108.66 C
ATOM 7029 O VAL B 196 7.181 42.312 -61.938 1.00108.66 O
ATOM 7030 CB VAL B 196 6.784 42.883 -65.235 1.00108.66 C
ATOM 7031 CG1 VAL B 196 7.760 43.907 -64.697 1.00108.66 C
ATOM 7032 CG2 VAL B 196 7.426 42.209 -66.420 1.00108.66 C
ATOM 7033 N ARG B 197 5.159 43.120 -62.530 1.00106.04 N
ATOM 7034 CA ARG B 197 4.927 43.715 -61.214 1.00106.04 C
ATOM 7035 C ARG B 197 4.865 42.652 -60.127 1.00106.04 C
ATOM 7036 O ARG B 197 5.417 42.835 -59.033 1.00106.04 O
ATOM 7037 CB ARG B 197 3.640 44.536 -61.223 1.00106.04 C
ATOM 7038 CG ARG B 197 3.345 45.246 -59.911 1.00106.04 C
ATOM 7039 CD ARG B 197 2.086 46.096 -60.003 1.00106.04 C
ATOM 7040 NE ARG B 197 0.887 45.301 -60.253 1.00106.04 N
ATOM 7041 CZ ARG B 197 0.169 44.709 -59.305 1.00106.04 C
ATOM 7042 NH1 ARG B 197 0.525 44.823 -58.033 1.00106.04 N
ATOM 7043 NH2 ARG B 197 -0.908 44.007 -59.627 1.00106.04 N
ATOM 7044 N ASP B 198 4.254 41.506 -60.446 1.00102.75 N
ATOM 7045 CA ASP B 198 4.161 40.406 -59.495 1.00102.75 C
ATOM 7046 C ASP B 198 5.533 39.834 -59.157 1.00102.75 C
ATOM 7047 O ASP B 198 5.824 39.553 -57.990 1.00102.75 O
ATOM 7048 CB ASP B 198 3.251 39.315 -60.056 1.00102.75 C
ATOM 7049 N ASN B 199 6.401 39.678 -60.155 1.00107.09 N
ATOM 7050 CA ASN B 199 7.712 39.103 -59.878 1.00107.09 C
ATOM 7051 C ASN B 199 8.653 40.123 -59.250 1.00107.09 C
ATOM 7052 O ASN B 199 9.637 39.747 -58.603 1.00107.09 O
ATOM 7053 CB ASN B 199 8.311 38.513 -61.151 1.00107.09 C
ATOM 7054 CG ASN B 199 7.646 37.208 -61.553 1.00107.09 C
ATOM 7055 OD1 ASN B 199 7.358 36.364 -60.708 1.00107.09 O
ATOM 7056 ND2 ASN B 199 7.404 37.039 -62.844 1.00107.09 N
ATOM 7057 N THR B 200 8.382 41.418 -59.426 1.00103.21 N
ATOM 7058 CA THR B 200 9.154 42.408 -58.681 1.00103.21 C
ATOM 7059 C THR B 200 8.767 42.416 -57.212 1.00103.21 C
ATOM 7060 O THR B 200 9.632 42.560 -56.342 1.00103.21 O
ATOM 7061 CB THR B 200 8.993 43.810 -59.262 1.00103.21 C
ATOM 7062 OG1 THR B 200 7.604 44.143 -59.350 1.00103.21 O
ATOM 7063 CG2 THR B 200 9.671 43.928 -60.610 1.00103.21 C
ATOM 7064 N ILE B 201 7.475 42.276 -56.904 1.00 96.25 N
ATOM 7065 CA ILE B 201 7.104 42.254 -55.490 1.00 96.25 C
ATOM 7066 C ILE B 201 7.356 40.874 -54.890 1.00 96.25 C
ATOM 7067 O ILE B 201 7.339 40.704 -53.666 1.00 96.25 O
ATOM 7068 CB ILE B 201 5.652 42.738 -55.281 1.00 96.25 C
ATOM 7069 CG1 ILE B 201 4.619 41.905 -56.042 1.00 96.25 C
ATOM 7070 CG2 ILE B 201 5.526 44.200 -55.669 1.00 96.25 C
ATOM 7071 CD1 ILE B 201 3.934 40.822 -55.233 1.00 96.25 C
ATOM 7072 N SER B 202 7.596 39.869 -55.733 1.00101.02 N
ATOM 7073 CA SER B 202 7.901 38.538 -55.221 1.00101.02 C
ATOM 7074 C SER B 202 9.343 38.442 -54.734 1.00101.02 C
ATOM 7075 O SER B 202 9.587 38.145 -53.559 1.00101.02 O
ATOM 7076 CB SER B 202 7.631 37.492 -56.299 1.00101.02 C
ATOM 7077 OG SER B 202 7.971 36.197 -55.842 1.00101.02 O
ATOM 7078 N ARG B 203 10.309 38.698 -55.617 1.00109.45 N
ATOM 7079 CA ARG B 203 11.727 38.494 -55.341 1.00109.45 C
ATOM 7080 C ARG B 203 12.417 39.832 -55.132 1.00109.45 C
ATOM 7081 O ARG B 203 11.875 40.881 -55.495 1.00109.45 O
ATOM 7082 CB ARG B 203 12.415 37.743 -56.486 1.00109.45 C
ATOM 7083 CG ARG B 203 12.057 36.276 -56.584 1.00109.45 C
ATOM 7084 CD ARG B 203 12.859 35.594 -57.680 1.00109.45 C
ATOM 7085 N SER B 204 13.610 39.792 -54.538 1.00115.41 N
ATOM 7086 CA SER B 204 14.422 40.991 -54.338 1.00115.41 C
ATOM 7087 C SER B 204 15.548 41.024 -55.375 1.00115.41 C
ATOM 7088 O SER B 204 16.704 40.684 -55.115 1.00115.41 O
ATOM 7089 CB SER B 204 14.962 41.037 -52.916 1.00115.41 C
ATOM 7090 N SER B 205 15.181 41.443 -56.584 1.00117.94 N
ATOM 7091 CA SER B 205 16.138 41.629 -57.664 1.00117.94 C
ATOM 7092 C SER B 205 15.679 42.799 -58.516 1.00117.94 C
ATOM 7093 O SER B 205 14.602 43.361 -58.303 1.00117.94 O
ATOM 7094 CB SER B 205 16.292 40.369 -58.522 1.00117.94 C
ATOM 7095 N GLU B 206 16.508 43.167 -59.485 1.00116.96 N
ATOM 7096 CA GLU B 206 16.243 44.312 -60.341 1.00116.96 C
ATOM 7097 C GLU B 206 16.193 43.861 -61.791 1.00116.96 C
ATOM 7098 O GLU B 206 17.176 43.325 -62.313 1.00116.96 O
ATOM 7099 CB GLU B 206 17.308 45.393 -60.154 1.00116.96 C
ATOM 7100 N GLU B 207 15.051 44.076 -62.435 1.00114.01 N
ATOM 7101 CA GLU B 207 14.889 43.793 -63.851 1.00114.01 C
ATOM 7102 C GLU B 207 13.901 44.785 -64.435 1.00114.01 C
ATOM 7103 O GLU B 207 13.045 45.312 -63.720 1.00114.01 O
ATOM 7104 CB GLU B 207 14.431 42.349 -64.089 1.00114.01 C
ATOM 7105 CG GLU B 207 13.079 41.977 -63.527 1.00114.01 C
ATOM 7106 CD GLU B 207 11.981 42.151 -64.538 1.00114.01 C
ATOM 7107 OE1 GLU B 207 12.310 42.256 -65.737 1.00114.01 O
ATOM 7108 OE2 GLU B 207 10.801 42.178 -64.139 1.00114.01 O
ATOM 7109 N ASN B 208 14.012 45.028 -65.735 1.00108.93 N
ATOM 7110 CA ASN B 208 13.354 46.154 -66.377 1.00108.93 C
ATOM 7111 C ASN B 208 12.732 45.747 -67.703 1.00108.93 C
ATOM 7112 O ASN B 208 13.048 44.685 -68.243 1.00108.93 O
ATOM 7113 CB ASN B 208 14.355 47.284 -66.581 1.00108.93 C
ATOM 7114 CG ASN B 208 15.650 46.796 -67.190 1.00108.93 C
ATOM 7115 OD1 ASN B 208 15.802 45.609 -67.473 1.00108.93 O
ATOM 7116 ND2 ASN B 208 16.590 47.708 -67.391 1.00108.93 N
ATOM 7117 N VAL B 209 11.848 46.598 -68.213 1.00106.98 N
ATOM 7118 CA VAL B 209 11.152 46.384 -69.476 1.00106.98 C
ATOM 7119 C VAL B 209 10.980 47.735 -70.163 1.00106.98 C
ATOM 7120 O VAL B 209 10.448 48.691 -69.587 1.00106.98 O
ATOM 7121 CB VAL B 209 9.817 45.654 -69.279 1.00106.98 C
ATOM 7122 N VAL B 210 11.471 47.839 -71.388 1.00106.10 N
ATOM 7123 CA VAL B 210 11.329 49.065 -72.157 1.00106.10 C
ATOM 7124 C VAL B 210 10.202 48.883 -73.162 1.00106.10 C
ATOM 7125 O VAL B 210 10.312 48.080 -74.093 1.00106.10 O
ATOM 7126 CB VAL B 210 12.649 49.418 -72.853 1.00106.10 C
ATOM 7127 CG1 VAL B 210 12.486 50.664 -73.695 1.00106.10 C
ATOM 7128 CG2 VAL B 210 13.741 49.594 -71.823 1.00106.10 C
ATOM 7129 N ALA B 211 9.118 49.633 -72.987 1.00113.62 N
ATOM 7130 CA ALA B 211 7.920 49.485 -73.806 1.00113.62 C
ATOM 7131 C ALA B 211 7.789 50.666 -74.756 1.00113.62 C
ATOM 7132 O ALA B 211 7.195 51.689 -74.402 1.00113.62 O
ATOM 7133 CB ALA B 211 6.673 49.369 -72.932 1.00113.62 C
ATOM 7134 N ILE B 212 8.318 50.514 -75.963 1.00117.96 N
ATOM 7135 CA ILE B 212 8.263 51.564 -76.967 1.00117.96 C
ATOM 7136 C ILE B 212 6.872 51.667 -77.571 1.00117.96 C
ATOM 7137 O ILE B 212 6.372 50.706 -78.149 1.00117.96 O
ATOM 7138 CB ILE B 212 9.314 51.329 -78.055 1.00117.96 C
ATOM 7139 CG1 ILE B 212 10.716 51.486 -77.473 1.00117.96 C
ATOM 7140 CG2 ILE B 212 9.105 52.270 -79.222 1.00117.96 C
ATOM 7141 CD1 ILE B 212 11.812 51.020 -78.398 1.00117.96 C
ATOM 7142 N ARG B 247 4.568 63.817 -78.112 1.00142.24 N
ATOM 7143 CA ARG B 247 4.303 64.072 -79.524 1.00142.24 C
ATOM 7144 C ARG B 247 3.599 62.890 -80.177 1.00142.24 C
ATOM 7145 O ARG B 247 2.840 63.066 -81.138 1.00142.24 O
ATOM 7146 CB ARG B 247 5.606 64.391 -80.256 1.00142.24 C
ATOM 7147 N ASP B 248 3.846 61.685 -79.684 1.00140.63 N
ATOM 7148 CA ASP B 248 3.136 60.525 -80.195 1.00140.63 C
ATOM 7149 C ASP B 248 1.681 60.569 -79.736 1.00140.63 C
ATOM 7150 O ASP B 248 1.414 60.762 -78.543 1.00140.63 O
ATOM 7151 CB ASP B 248 3.802 59.234 -79.714 1.00140.63 C
ATOM 7152 N PRO B 249 0.723 60.415 -80.642 1.00145.90 N
ATOM 7153 CA PRO B 249 -0.685 60.389 -80.228 1.00145.90 C
ATOM 7154 C PRO B 249 -1.054 59.086 -79.537 1.00145.90 C
ATOM 7155 O PRO B 249 -1.679 58.203 -80.133 1.00145.90 O
ATOM 7156 CB PRO B 249 -1.441 60.567 -81.549 1.00145.90 C
ATOM 7157 CG PRO B 249 -0.499 60.055 -82.589 1.00145.90 C
ATOM 7158 CD PRO B 249 0.879 60.388 -82.106 1.00145.90 C
ATOM 7159 N LEU B 250 -0.675 58.964 -78.271 1.00144.67 N
ATOM 7160 CA LEU B 250 -0.855 57.713 -77.555 1.00144.67 C
ATOM 7161 C LEU B 250 -2.270 57.593 -77.009 1.00144.67 C
ATOM 7162 O LEU B 250 -2.987 58.586 -76.862 1.00144.67 O
ATOM 7163 CB LEU B 250 0.152 57.609 -76.412 1.00144.67 C
ATOM 7164 N TYR B 251 -2.663 56.363 -76.703 1.00148.13 N
ATOM 7165 CA TYR B 251 -3.925 56.063 -76.044 1.00148.13 C
ATOM 7166 C TYR B 251 -3.702 56.111 -74.533 1.00148.13 C
ATOM 7167 O TYR B 251 -2.725 56.698 -74.062 1.00148.13 O
ATOM 7168 CB TYR B 251 -4.451 54.709 -76.523 1.00148.13 C
ATOM 7169 CG TYR B 251 -4.741 54.680 -77.999 1.00148.13 C
ATOM 7170 CD1 TYR B 251 -5.894 55.259 -78.509 1.00148.13 C
ATOM 7171 CD2 TYR B 251 -3.860 54.072 -78.884 1.00148.13 C
ATOM 7172 CE1 TYR B 251 -6.164 55.239 -79.864 1.00148.13 C
ATOM 7173 CE2 TYR B 251 -4.120 54.043 -80.240 1.00148.13 C
ATOM 7174 CZ TYR B 251 -5.274 54.628 -80.724 1.00148.13 C
ATOM 7175 OH TYR B 251 -5.540 54.601 -82.074 1.00148.13 O
ATOM 7176 N CYS B 252 -4.624 55.547 -73.755 1.00142.30 N
ATOM 7177 CA CYS B 252 -4.349 55.291 -72.347 1.00142.30 C
ATOM 7178 C CYS B 252 -3.218 54.276 -72.215 1.00142.30 C
ATOM 7179 O CYS B 252 -2.964 53.488 -73.125 1.00142.30 O
ATOM 7180 CB CYS B 252 -5.606 54.786 -71.640 1.00142.30 C
ATOM 7181 SG CYS B 252 -6.244 53.219 -72.272 1.00142.30 S
ATOM 7182 N LEU B 253 -2.520 54.308 -71.088 1.00131.86 N
ATOM 7183 CA LEU B 253 -1.309 53.518 -70.916 1.00131.86 C
ATOM 7184 C LEU B 253 -1.519 52.456 -69.850 1.00131.86 C
ATOM 7185 O LEU B 253 -2.319 52.643 -68.927 1.00131.86 O
ATOM 7186 CB LEU B 253 -0.116 54.396 -70.527 1.00131.86 C
ATOM 7187 CG LEU B 253 0.697 55.138 -71.589 1.00131.86 C
ATOM 7188 CD1 LEU B 253 -0.050 56.321 -72.166 1.00131.86 C
ATOM 7189 CD2 LEU B 253 2.003 55.594 -70.976 1.00131.86 C
ATOM 7190 N ASP B 254 -0.799 51.347 -69.983 1.00125.63 N
ATOM 7191 CA ASP B 254 -0.642 50.394 -68.895 1.00125.63 C
ATOM 7192 C ASP B 254 0.487 50.901 -68.011 1.00125.63 C
ATOM 7193 O ASP B 254 1.661 50.825 -68.389 1.00125.63 O
ATOM 7194 CB ASP B 254 -0.337 48.995 -69.423 1.00125.63 C
ATOM 7195 N ASN B 255 0.133 51.418 -66.840 1.00121.25 N
ATOM 7196 CA ASN B 255 1.088 52.128 -65.991 1.00121.25 C
ATOM 7197 C ASN B 255 1.801 51.155 -65.054 1.00121.25 C
ATOM 7198 O ASN B 255 1.663 51.192 -63.834 1.00121.25 O
ATOM 7199 CB ASN B 255 0.379 53.230 -65.216 1.00121.25 C
ATOM 7200 N ASN B 256 2.579 50.261 -65.662 1.00110.90 N
ATOM 7201 CA ASN B 256 3.293 49.248 -64.908 1.00110.90 C
ATOM 7202 C ASN B 256 4.739 49.068 -65.346 1.00110.90 C
ATOM 7203 O ASN B 256 5.520 48.469 -64.602 1.00110.90 O
ATOM 7204 CB ASN B 256 2.564 47.905 -65.023 1.00110.90 C
ATOM 7205 CG ASN B 256 2.695 47.067 -63.781 1.00110.90 C
ATOM 7206 OD1 ASN B 256 1.960 46.101 -63.601 1.00110.90 O
ATOM 7207 ND2 ASN B 256 3.599 47.454 -62.892 1.00110.90 N
ATOM 7208 N HIS B 257 5.109 49.561 -66.522 1.00109.22 N
ATOM 7209 CA HIS B 257 6.452 49.395 -67.044 1.00109.22 C
ATOM 7210 C HIS B 257 7.437 50.311 -66.320 1.00109.22 C
ATOM 7211 O HIS B 257 7.055 51.224 -65.588 1.00109.22 O
ATOM 7212 CB HIS B 257 6.467 49.674 -68.543 1.00109.22 C
ATOM 7213 CG HIS B 257 5.684 48.683 -69.348 1.00109.22 C
ATOM 7214 ND1 HIS B 257 6.163 47.427 -69.647 1.00109.22 N
ATOM 7215 CD2 HIS B 257 4.456 48.761 -69.910 1.00109.22 C
ATOM 7216 CE1 HIS B 257 5.268 46.776 -70.367 1.00109.22 C
ATOM 7217 NE2 HIS B 257 4.221 47.562 -70.539 1.00109.22 N
ATOM 7218 N THR B 258 8.725 50.045 -66.531 1.00106.75 N
ATOM 7219 CA THR B 258 9.793 50.816 -65.906 1.00106.75 C
ATOM 7220 C THR B 258 10.280 51.952 -66.800 1.00106.75 C
ATOM 7221 O THR B 258 10.575 53.046 -66.311 1.00106.75 O
ATOM 7222 CB THR B 258 10.951 49.884 -65.536 1.00106.75 C
ATOM 7223 OG1 THR B 258 10.465 48.863 -64.660 1.00106.75 O
ATOM 7224 CG2 THR B 258 12.062 50.623 -64.816 1.00106.75 C
ATOM 7225 N HIS B 259 10.343 51.735 -68.109 1.00109.10 N
ATOM 7226 CA HIS B 259 10.718 52.786 -69.049 1.00109.10 C
ATOM 7227 C HIS B 259 9.832 52.643 -70.272 1.00109.10 C
ATOM 7228 O HIS B 259 9.584 51.524 -70.725 1.00109.10 O
ATOM 7229 CB HIS B 259 12.189 52.693 -69.437 1.00109.10 C
ATOM 7230 CG HIS B 259 13.124 52.856 -68.284 1.00109.10 C
ATOM 7231 ND1 HIS B 259 13.400 54.080 -67.719 1.00109.10 N
ATOM 7232 CD2 HIS B 259 13.835 51.945 -67.581 1.00109.10 C
ATOM 7233 CE1 HIS B 259 14.250 53.919 -66.721 1.00109.10 C
ATOM 7234 NE2 HIS B 259 14.529 52.632 -66.615 1.00109.10 N
ATOM 7235 N LEU B 260 9.340 53.758 -70.795 1.00114.81 N
ATOM 7236 CA LEU B 260 8.527 53.745 -72.007 1.00114.81 C
ATOM 7237 C LEU B 260 8.863 54.987 -72.825 1.00114.81 C
ATOM 7238 O LEU B 260 8.873 56.108 -72.315 1.00114.81 O
ATOM 7239 CB LEU B 260 7.042 53.629 -71.649 1.00114.81 C
ATOM 7240 CG LEU B 260 6.350 54.630 -70.728 1.00114.81 C
ATOM 7241 CD1 LEU B 260 5.705 55.757 -71.518 1.00114.81 C
ATOM 7242 CD2 LEU B 260 5.328 53.917 -69.860 1.00114.81 C
ATOM 7243 N LEU B 261 9.187 54.769 -74.095 1.00122.61 N
ATOM 7244 CA LEU B 261 9.683 55.818 -74.984 1.00122.61 C
ATOM 7245 C LEU B 261 8.833 55.807 -76.250 1.00122.61 C
ATOM 7246 O LEU B 261 8.797 54.820 -76.983 1.00122.61 O
ATOM 7247 CB LEU B 261 11.157 55.608 -75.307 1.00122.61 C
ATOM 7248 CG LEU B 261 12.233 56.040 -74.308 1.00122.61 C
ATOM 7249 CD1 LEU B 261 12.369 55.091 -73.122 1.00122.61 C
ATOM 7250 CD2 LEU B 261 13.563 56.186 -75.022 1.00122.61 C
ATOM 7251 N LEU B 262 8.153 56.918 -76.518 1.00129.41 N
ATOM 7252 CA LEU B 262 7.310 57.046 -77.699 1.00129.41 C
ATOM 7253 C LEU B 262 7.800 58.185 -78.578 1.00129.41 C
ATOM 7254 O LEU B 262 8.400 59.146 -78.084 1.00129.41 O
ATOM 7255 CB LEU B 262 5.850 57.259 -77.311 1.00129.41 C
ATOM 7256 CG LEU B 262 5.204 56.016 -76.706 1.00129.41 C
ATOM 7257 CD1 LEU B 262 3.811 56.333 -76.204 1.00129.41 C
ATOM 7258 CD2 LEU B 262 5.166 54.900 -77.741 1.00129.41 C
ATOM 7259 N VAL B 263 7.545 58.067 -79.876 1.00131.01 N
ATOM 7260 CA VAL B 263 8.003 59.047 -80.851 1.00131.01 C
ATOM 7261 C VAL B 263 6.838 59.881 -81.367 1.00131.01 C
ATOM 7262 O VAL B 263 6.560 59.906 -82.567 1.00131.01 O
ATOM 7263 CB VAL B 263 8.731 58.363 -82.018 1.00131.01 C
ATOM 7264 N ILE B 273 2.013 55.105 -87.862 1.00140.28 N
ATOM 7265 CA ILE B 273 2.243 54.001 -86.944 1.00140.28 C
ATOM 7266 C ILE B 273 3.361 53.118 -87.469 1.00140.28 C
ATOM 7267 O ILE B 273 3.180 51.917 -87.652 1.00140.28 O
ATOM 7268 CB ILE B 273 0.963 53.183 -86.720 1.00140.28 C
ATOM 7269 N GLU B 274 4.520 53.721 -87.712 1.00144.47 N
ATOM 7270 CA GLU B 274 5.699 53.007 -88.183 1.00144.47 C
ATOM 7271 C GLU B 274 6.673 52.846 -87.028 1.00144.47 C
ATOM 7272 O GLU B 274 6.904 53.801 -86.278 1.00144.47 O
ATOM 7273 CB GLU B 274 6.367 53.754 -89.339 1.00144.47 C
ATOM 7274 N ALA B 275 7.206 51.628 -86.862 1.00140.89 N
ATOM 7275 CA ALA B 275 8.156 51.377 -85.781 1.00140.89 C
ATOM 7276 C ALA B 275 9.442 52.168 -85.974 1.00140.89 C
ATOM 7277 O ALA B 275 9.739 53.077 -85.189 1.00140.89 O
ATOM 7278 CB ALA B 275 8.455 49.881 -85.692 1.00140.89 C
ATOM 7279 N LYS B 276 10.238 51.810 -86.985 1.00140.90 N
ATOM 7280 CA LYS B 276 11.286 52.630 -87.601 1.00140.90 C
ATOM 7281 C LYS B 276 12.457 53.030 -86.702 1.00140.90 C
ATOM 7282 O LYS B 276 13.416 53.640 -87.182 1.00140.90 O
ATOM 7283 CB LYS B 276 10.666 53.898 -88.199 1.00140.90 C
ATOM 7284 N VAL B 277 12.394 52.718 -85.410 1.00134.46 N
ATOM 7285 CA VAL B 277 13.525 52.839 -84.499 1.00134.46 C
ATOM 7286 C VAL B 277 13.708 51.568 -83.685 1.00134.46 C
ATOM 7287 O VAL B 277 14.790 51.317 -83.153 1.00134.46 O
ATOM 7288 CB VAL B 277 13.370 54.065 -83.572 1.00134.46 C
ATOM 7289 CG1 VAL B 277 13.510 55.367 -84.341 1.00134.46 C
ATOM 7290 CG2 VAL B 277 12.035 54.022 -82.850 1.00134.46 C
ATOM 7291 N ARG B 278 12.637 50.779 -83.583 1.00130.43 N
ATOM 7292 CA ARG B 278 12.583 49.491 -82.907 1.00130.43 C
ATOM 7293 C ARG B 278 13.591 48.552 -83.550 1.00130.43 C
ATOM 7294 O ARG B 278 14.561 48.111 -82.917 1.00130.43 O
ATOM 7295 CB ARG B 278 11.162 48.935 -83.028 1.00130.43 C
ATOM 7296 CG ARG B 278 10.778 47.758 -82.155 1.00130.43 C
ATOM 7297 CD ARG B 278 9.335 47.394 -82.486 1.00130.43 C
ATOM 7298 NE ARG B 278 8.763 46.344 -81.650 1.00130.43 N
ATOM 7299 CZ ARG B 278 8.061 46.584 -80.548 1.00130.43 C
ATOM 7300 NH1 ARG B 278 7.849 47.831 -80.162 1.00130.43 N
ATOM 7301 NH2 ARG B 278 7.557 45.586 -79.839 1.00130.43 N
ATOM 7302 N THR B 279 13.367 48.288 -84.834 1.00131.97 N
ATOM 7303 CA THR B 279 14.250 47.489 -85.668 1.00131.97 C
ATOM 7304 C THR B 279 15.636 48.108 -85.774 1.00131.97 C
ATOM 7305 O THR B 279 16.634 47.384 -85.839 1.00131.97 O
ATOM 7306 CB THR B 279 13.640 47.332 -87.054 1.00131.97 C
ATOM 7307 OG1 THR B 279 13.491 48.624 -87.653 1.00131.97 O
ATOM 7308 CG2 THR B 279 12.279 46.672 -86.952 1.00131.97 C
ATOM 7309 N GLN B 280 15.709 49.441 -85.782 1.00132.45 N
ATOM 7310 CA GLN B 280 17.002 50.110 -85.875 1.00132.45 C
ATOM 7311 C GLN B 280 17.823 49.914 -84.606 1.00132.45 C
ATOM 7312 O GLN B 280 19.031 49.655 -84.675 1.00132.45 O
ATOM 7313 CB GLN B 280 16.803 51.596 -86.165 1.00132.45 C
ATOM 7314 CG GLN B 280 16.164 51.871 -87.511 1.00132.45 C
ATOM 7315 CD GLN B 280 17.054 51.477 -88.666 1.00132.45 C
ATOM 7316 OE1 GLN B 280 18.268 51.664 -88.619 1.00132.45 O
ATOM 7317 NE2 GLN B 280 16.455 50.926 -89.714 1.00132.45 N
ATOM 7318 N LEU B 281 17.179 50.011 -83.441 1.00129.02 N
ATOM 7319 CA LEU B 281 17.853 49.716 -82.181 1.00129.02 C
ATOM 7320 C LEU B 281 18.286 48.259 -82.096 1.00129.02 C
ATOM 7321 O LEU B 281 19.396 47.970 -81.624 1.00129.02 O
ATOM 7322 CB LEU B 281 16.937 50.051 -81.005 1.00129.02 C
ATOM 7323 CG LEU B 281 17.498 49.820 -79.603 1.00129.02 C
ATOM 7324 CD1 LEU B 281 18.680 50.735 -79.349 1.00129.02 C
ATOM 7325 CD2 LEU B 281 16.422 50.018 -78.553 1.00129.02 C
ATOM 7326 N GLU B 282 17.439 47.340 -82.568 1.00131.26 N
ATOM 7327 CA GLU B 282 17.799 45.928 -82.558 1.00131.26 C
ATOM 7328 C GLU B 282 18.964 45.630 -83.497 1.00131.26 C
ATOM 7329 O GLU B 282 19.829 44.809 -83.174 1.00131.26 O
ATOM 7330 CB GLU B 282 16.580 45.090 -82.923 1.00131.26 C
ATOM 7331 CG GLU B 282 15.477 45.190 -81.894 1.00131.26 C
ATOM 7332 CD GLU B 282 15.925 44.767 -80.514 1.00131.26 C
ATOM 7333 OE1 GLU B 282 16.679 43.780 -80.404 1.00131.26 O
ATOM 7334 OE2 GLU B 282 15.512 45.418 -79.536 1.00131.26 O
ATOM 7335 N LYS B 283 19.020 46.305 -84.648 1.00130.27 N
ATOM 7336 CA LYS B 283 20.148 46.118 -85.555 1.00130.27 C
ATOM 7337 C LYS B 283 21.407 46.782 -85.014 1.00130.27 C
ATOM 7338 O LYS B 283 22.524 46.367 -85.344 1.00130.27 O
ATOM 7339 CB LYS B 283 19.806 46.658 -86.942 1.00130.27 C
ATOM 7340 N TYR B 284 21.250 47.821 -84.187 1.00130.94 N
ATOM 7341 CA TYR B 284 22.416 48.411 -83.533 1.00130.94 C
ATOM 7342 C TYR B 284 23.003 47.472 -82.493 1.00130.94 C
ATOM 7343 O TYR B 284 24.223 47.284 -82.436 1.00130.94 O
ATOM 7344 CB TYR B 284 22.063 49.741 -82.877 1.00130.94 C
ATOM 7345 CG TYR B 284 23.224 50.320 -82.096 1.00130.94 C
ATOM 7346 CD1 TYR B 284 24.330 50.845 -82.748 1.00130.94 C
ATOM 7347 CD2 TYR B 284 23.214 50.339 -80.705 1.00130.94 C
ATOM 7348 CE1 TYR B 284 25.396 51.369 -82.041 1.00130.94 C
ATOM 7349 CE2 TYR B 284 24.276 50.862 -79.989 1.00130.94 C
ATOM 7350 CZ TYR B 284 25.361 51.377 -80.663 1.00130.94 C
ATOM 7351 OH TYR B 284 26.415 51.900 -79.953 1.00130.94 O
ATOM 7352 N ILE B 285 22.153 46.882 -81.655 1.00127.42 N
ATOM 7353 CA ILE B 285 22.658 45.992 -80.611 1.00127.42 C
ATOM 7354 C ILE B 285 23.097 44.660 -81.220 1.00127.42 C
ATOM 7355 O ILE B 285 23.898 43.920 -80.635 1.00127.42 O
ATOM 7356 CB ILE B 285 21.595 45.826 -79.509 1.00127.42 C
ATOM 7357 CG1 ILE B 285 21.162 47.200 -79.021 1.00127.42 C
ATOM 7358 CG2 ILE B 285 22.169 45.172 -78.280 1.00127.42 C
ATOM 7359 CD1 ILE B 285 19.937 47.170 -78.157 1.00127.42 C
ATOM 7360 N SER B 286 22.611 44.355 -82.431 1.00131.69 N
ATOM 7361 CA SER B 286 23.174 43.259 -83.216 1.00131.69 C
ATOM 7362 C SER B 286 24.646 43.496 -83.530 1.00131.69 C
ATOM 7363 O SER B 286 25.441 42.550 -83.560 1.00131.69 O
ATOM 7364 CB SER B 286 22.385 43.083 -84.512 1.00131.69 C
ATOM 7365 OG SER B 286 21.043 42.716 -84.257 1.00131.69 O
ATOM 7366 N GLU B 287 25.025 44.748 -83.764 1.00131.07 N
ATOM 7367 CA GLU B 287 26.405 45.106 -84.052 1.00131.07 C
ATOM 7368 C GLU B 287 27.181 45.531 -82.811 1.00131.07 C
ATOM 7369 O GLU B 287 28.269 46.104 -82.941 1.00131.07 O
ATOM 7370 CB GLU B 287 26.447 46.218 -85.102 1.00131.07 C
ATOM 7371 N ARG B 288 26.658 45.270 -81.619 1.00134.98 N
ATOM 7372 CA ARG B 288 27.327 45.684 -80.399 1.00134.98 C
ATOM 7373 C ARG B 288 28.494 44.749 -80.093 1.00134.98 C
ATOM 7374 O ARG B 288 28.438 43.544 -80.346 1.00134.98 O
ATOM 7375 CB ARG B 288 26.328 45.704 -79.240 1.00134.98 C
ATOM 7376 CG ARG B 288 26.864 46.222 -77.915 1.00134.98 C
ATOM 7377 CD ARG B 288 27.205 47.693 -77.998 1.00134.98 C
ATOM 7378 NE ARG B 288 27.676 48.204 -76.716 1.00134.98 N
ATOM 7379 CZ ARG B 288 28.193 49.414 -76.543 1.00134.98 C
ATOM 7380 NH1 ARG B 288 28.305 50.239 -77.575 1.00134.98 N
ATOM 7381 NH2 ARG B 288 28.598 49.800 -75.341 1.00134.98 N
ATOM 7382 N VAL B 289 29.568 45.320 -79.552 1.00138.91 N
ATOM 7383 CA VAL B 289 30.750 44.564 -79.154 1.00138.91 C
ATOM 7384 C VAL B 289 30.856 44.586 -77.630 1.00138.91 C
ATOM 7385 O VAL B 289 30.562 45.603 -76.992 1.00138.91 O
ATOM 7386 CB VAL B 289 32.025 45.105 -79.843 1.00138.91 C
ATOM 7387 CG1 VAL B 289 32.303 46.565 -79.492 1.00138.91 C
ATOM 7388 CG2 VAL B 289 33.237 44.230 -79.538 1.00138.91 C
ATOM 7389 N ILE B 290 31.189 43.433 -77.047 1.00143.82 N
ATOM 7390 CA ILE B 290 31.463 43.313 -75.624 1.00143.82 C
ATOM 7391 C ILE B 290 32.750 42.511 -75.476 1.00143.82 C
ATOM 7392 O ILE B 290 32.892 41.457 -76.102 1.00143.82 O
ATOM 7393 CB ILE B 290 30.317 42.640 -74.847 1.00143.82 C
ATOM 7394 CG1 ILE B 290 29.095 43.553 -74.793 1.00143.82 C
ATOM 7395 CG2 ILE B 290 30.736 42.252 -73.430 1.00143.82 C
ATOM 7396 CD1 ILE B 290 27.908 42.916 -74.146 1.00143.82 C
ATOM 7397 N PRO B 291 33.730 42.978 -74.691 1.00144.90 N
ATOM 7398 CA PRO B 291 34.982 42.215 -74.550 1.00144.90 C
ATOM 7399 C PRO B 291 34.829 40.894 -73.809 1.00144.90 C
ATOM 7400 O PRO B 291 35.272 39.857 -74.318 1.00144.90 O
ATOM 7401 CB PRO B 291 35.896 43.193 -73.799 1.00144.90 C
ATOM 7402 CG PRO B 291 34.964 44.120 -73.085 1.00144.90 C
ATOM 7403 CD PRO B 291 33.772 44.264 -73.972 1.00144.90 C
ATOM 7404 N GLU B 292 34.216 40.889 -72.626 1.00141.32 N
ATOM 7405 CA GLU B 292 34.039 39.652 -71.866 1.00141.32 C
ATOM 7406 C GLU B 292 32.642 39.087 -72.126 1.00141.32 C
ATOM 7407 O GLU B 292 31.774 39.037 -71.253 1.00141.32 O
ATOM 7408 CB GLU B 292 34.281 39.899 -70.383 1.00141.32 C
ATOM 7409 N SER B 293 32.443 38.643 -73.364 1.00137.20 N
ATOM 7410 CA SER B 293 31.166 38.102 -73.810 1.00137.20 C
ATOM 7411 C SER B 293 31.314 36.617 -74.099 1.00137.20 C
ATOM 7412 O SER B 293 32.162 36.218 -74.904 1.00137.20 O
ATOM 7413 CB SER B 293 30.665 38.835 -75.058 1.00137.20 C
ATOM 7414 N ASN B 294 30.486 35.805 -73.448 1.00128.99 N
ATOM 7415 CA ASN B 294 30.474 34.366 -73.667 1.00128.99 C
ATOM 7416 C ASN B 294 29.798 33.982 -74.970 1.00128.99 C
ATOM 7417 O ASN B 294 29.967 32.850 -75.432 1.00128.99 O
ATOM 7418 CB ASN B 294 29.774 33.660 -72.501 1.00128.99 C
ATOM 7419 N TYR B 295 29.049 34.897 -75.577 1.00126.32 N
ATOM 7420 CA TYR B 295 28.350 34.648 -76.825 1.00126.32 C
ATOM 7421 C TYR B 295 29.249 34.867 -78.035 1.00126.32 C
ATOM 7422 O TYR B 295 28.920 34.416 -79.136 1.00126.32 O
ATOM 7423 CB TYR B 295 27.111 35.544 -76.895 1.00126.32 C
ATOM 7424 CG TYR B 295 26.235 35.315 -78.094 1.00126.32 C
ATOM 7425 CD1 TYR B 295 25.435 34.191 -78.180 1.00126.32 C
ATOM 7426 CD2 TYR B 295 26.216 36.221 -79.141 1.00126.32 C
ATOM 7427 CE1 TYR B 295 24.637 33.973 -79.275 1.00126.32 C
ATOM 7428 CE2 TYR B 295 25.418 36.016 -80.244 1.00126.32 C
ATOM 7429 CZ TYR B 295 24.628 34.889 -80.305 1.00126.32 C
ATOM 7430 OH TYR B 295 23.826 34.673 -81.400 1.00126.32 O
ATOM 7431 N GLY B 296 30.397 35.506 -77.845 1.00132.07 N
ATOM 7432 CA GLY B 296 31.319 35.740 -78.932 1.00132.07 C
ATOM 7433 C GLY B 296 31.548 37.190 -79.280 1.00132.07 C
ATOM 7434 O GLY B 296 31.983 37.477 -80.401 1.00132.07 O
ATOM 7435 N GLY B 297 31.260 38.115 -78.370 1.00132.29 N
ATOM 7436 CA GLY B 297 31.470 39.519 -78.651 1.00132.29 C
ATOM 7437 C GLY B 297 30.199 40.190 -79.119 1.00132.29 C
ATOM 7438 O GLY B 297 30.231 41.285 -79.686 1.00132.29 O
ATOM 7439 N LYS B 298 29.069 39.525 -78.903 1.00126.85 N
ATOM 7440 CA LYS B 298 27.764 40.040 -79.283 1.00126.85 C
ATOM 7441 C LYS B 298 26.789 39.815 -78.138 1.00126.85 C
ATOM 7442 O LYS B 298 27.165 39.366 -77.053 1.00126.85 O
ATOM 7443 CB LYS B 298 27.244 39.371 -80.560 1.00126.85 C
ATOM 7444 CG LYS B 298 28.031 39.718 -81.807 1.00126.85 C
ATOM 7445 CD LYS B 298 27.449 39.038 -83.030 1.00126.85 C
ATOM 7446 CE LYS B 298 28.246 39.387 -84.278 1.00126.85 C
ATOM 7447 NZ LYS B 298 27.679 38.765 -85.506 1.00126.85 N
ATOM 7448 N ILE B 299 25.531 40.160 -78.379 1.00117.09 N
ATOM 7449 CA ILE B 299 24.453 39.955 -77.416 1.00117.09 C
ATOM 7450 C ILE B 299 23.365 39.131 -78.095 1.00117.09 C
ATOM 7451 O ILE B 299 22.990 39.447 -79.234 1.00117.09 O
ATOM 7452 CB ILE B 299 23.897 41.289 -76.903 1.00117.09 C
ATOM 7453 CG1 ILE B 299 24.963 42.027 -76.110 1.00117.09 C
ATOM 7454 CG2 ILE B 299 22.689 41.078 -76.022 1.00117.09 C
ATOM 7455 CD1 ILE B 299 24.588 43.433 -75.763 1.00117.09 C
ATOM 7456 N PRO B 300 22.859 38.075 -77.461 1.00115.62 N
ATOM 7457 CA PRO B 300 21.736 37.326 -78.029 1.00115.62 C
ATOM 7458 C PRO B 300 20.458 38.150 -78.103 1.00115.62 C
ATOM 7459 O PRO B 300 20.133 38.917 -77.197 1.00115.62 O
ATOM 7460 CB PRO B 300 21.582 36.150 -77.063 1.00115.62 C
ATOM 7461 CG PRO B 300 22.238 36.593 -75.803 1.00115.62 C
ATOM 7462 CD PRO B 300 23.376 37.448 -76.238 1.00115.62 C
ATOM 7463 N ILE B 301 19.735 37.981 -79.208 1.00117.59 N
ATOM 7464 CA ILE B 301 18.508 38.715 -79.493 1.00117.59 C
ATOM 7465 C ILE B 301 17.465 37.714 -79.968 1.00117.59 C
ATOM 7466 O ILE B 301 17.679 37.022 -80.968 1.00117.59 O
ATOM 7467 CB ILE B 301 18.723 39.795 -80.570 1.00117.59 C
ATOM 7468 CG1 ILE B 301 19.744 40.840 -80.117 1.00117.59 C
ATOM 7469 CG2 ILE B 301 17.411 40.452 -80.924 1.00117.59 C
ATOM 7470 CD1 ILE B 301 20.210 41.748 -81.215 1.00117.59 C
ATOM 7471 N VAL B 302 16.337 37.640 -79.268 1.00111.91 N
ATOM 7472 CA VAL B 302 15.305 36.655 -79.563 1.00111.91 C
ATOM 7473 C VAL B 302 13.994 37.367 -79.860 1.00111.91 C
ATOM 7474 O VAL B 302 13.438 38.048 -78.992 1.00111.91 O
ATOM 7475 CB VAL B 302 15.117 35.663 -78.400 1.00111.91 C
ATOM 7476 CG1 VAL B 302 13.971 34.724 -78.702 1.00111.91 C
ATOM 7477 CG2 VAL B 302 16.388 34.887 -78.151 1.00111.91 C
ATOM 7478 N CYS B 303 13.490 37.189 -81.080 1.00115.18 N
ATOM 7479 CA CYS B 303 12.194 37.717 -81.491 1.00115.18 C
ATOM 7480 C CYS B 303 11.122 36.689 -81.177 1.00115.18 C
ATOM 7481 O CYS B 303 11.354 35.486 -81.313 1.00115.18 O
ATOM 7482 CB CYS B 303 12.172 38.047 -82.980 1.00115.18 C
ATOM 7483 SG CYS B 303 13.282 39.378 -83.438 1.00115.18 S
ATOM 7484 N PHE B 304 9.953 37.162 -80.769 1.00110.01 N
ATOM 7485 CA PHE B 304 8.919 36.304 -80.218 1.00110.01 C
ATOM 7486 C PHE B 304 7.605 36.596 -80.931 1.00110.01 C
ATOM 7487 O PHE B 304 7.298 37.758 -81.214 1.00110.01 O
ATOM 7488 CB PHE B 304 8.790 36.556 -78.721 1.00110.01 C
ATOM 7489 CG PHE B 304 8.125 35.458 -77.974 1.00110.01 C
ATOM 7490 CD1 PHE B 304 8.857 34.363 -77.554 1.00110.01 C
ATOM 7491 CD2 PHE B 304 6.773 35.507 -77.695 1.00110.01 C
ATOM 7492 CE1 PHE B 304 8.261 33.342 -76.856 1.00110.01 C
ATOM 7493 CE2 PHE B 304 6.163 34.483 -76.999 1.00110.01 C
ATOM 7494 CZ PHE B 304 6.910 33.399 -76.577 1.00110.01 C
ATOM 7495 N ALA B 305 6.830 35.548 -81.232 1.00116.52 N
ATOM 7496 CA ALA B 305 5.579 35.700 -81.973 1.00116.52 C
ATOM 7497 C ALA B 305 4.469 34.928 -81.260 1.00116.52 C
ATOM 7498 O ALA B 305 4.467 33.697 -81.218 1.00116.52 O
ATOM 7499 CB ALA B 305 5.738 35.239 -83.419 1.00116.52 C
ATOM 7500 N GLN B 306 3.515 35.666 -80.705 1.00118.98 N
ATOM 7501 CA GLN B 306 2.357 35.064 -80.061 1.00118.98 C
ATOM 7502 C GLN B 306 1.136 35.970 -80.168 1.00118.98 C
ATOM 7503 O GLN B 306 0.018 35.501 -80.376 1.00118.98 O
ATOM 7504 CB GLN B 306 2.658 34.758 -78.595 1.00118.98 C
ATOM 7505 N GLY B 309 -0.038 39.546 -87.284 1.00154.32 N
ATOM 7506 CA GLY B 309 -0.409 40.826 -87.855 1.00154.32 C
ATOM 7507 C GLY B 309 0.453 41.240 -89.030 1.00154.32 C
ATOM 7508 O GLY B 309 1.470 40.609 -89.324 1.00154.32 O
ATOM 7509 N LYS B 310 0.028 42.307 -89.709 1.00157.96 N
ATOM 7510 CA LYS B 310 0.781 42.818 -90.850 1.00157.96 C
ATOM 7511 C LYS B 310 2.085 43.463 -90.405 1.00157.96 C
ATOM 7512 O LYS B 310 3.147 43.199 -90.982 1.00157.96 O
ATOM 7513 CB LYS B 310 -0.076 43.816 -91.627 1.00157.96 C
ATOM 7514 CG LYS B 310 0.603 44.430 -92.832 1.00157.96 C
ATOM 7515 CD LYS B 310 -0.368 45.308 -93.590 1.00157.96 C
ATOM 7516 CE LYS B 310 -0.665 46.576 -92.815 1.00157.96 C
ATOM 7517 NZ LYS B 310 -1.536 47.501 -93.582 1.00157.96 N
ATOM 7518 N GLU B 311 2.024 44.307 -89.372 1.00156.81 N
ATOM 7519 CA GLU B 311 3.241 44.879 -88.807 1.00156.81 C
ATOM 7520 C GLU B 311 4.072 43.808 -88.115 1.00156.81 C
ATOM 7521 O GLU B 311 5.303 43.913 -88.054 1.00156.81 O
ATOM 7522 CB GLU B 311 2.894 46.003 -87.832 1.00156.81 C
ATOM 7523 N THR B 312 3.415 42.762 -87.601 1.00154.00 N
ATOM 7524 CA THR B 312 4.132 41.621 -87.043 1.00154.00 C
ATOM 7525 C THR B 312 4.948 40.910 -88.111 1.00154.00 C
ATOM 7526 O THR B 312 6.126 40.604 -87.899 1.00154.00 O
ATOM 7527 CB THR B 312 3.150 40.645 -86.392 1.00154.00 C
ATOM 7528 N LEU B 313 4.347 40.666 -89.277 1.00153.14 N
ATOM 7529 CA LEU B 313 5.080 40.036 -90.369 1.00153.14 C
ATOM 7530 C LEU B 313 6.156 40.961 -90.925 1.00153.14 C
ATOM 7531 O LEU B 313 7.211 40.495 -91.372 1.00153.14 O
ATOM 7532 CB LEU B 313 4.102 39.596 -91.462 1.00153.14 C
ATOM 7533 CG LEU B 313 4.635 38.827 -92.675 1.00153.14 C
ATOM 7534 CD1 LEU B 313 3.670 37.739 -93.059 1.00153.14 C
ATOM 7535 CD2 LEU B 313 4.810 39.755 -93.863 1.00153.14 C
ATOM 7536 N LYS B 314 5.905 42.275 -90.906 1.00151.42 N
ATOM 7537 CA LYS B 314 6.925 43.233 -91.325 1.00151.42 C
ATOM 7538 C LYS B 314 8.132 43.191 -90.396 1.00151.42 C
ATOM 7539 O LYS B 314 9.283 43.185 -90.856 1.00151.42 O
ATOM 7540 CB LYS B 314 6.329 44.639 -91.373 1.00151.42 C
ATOM 7541 N SER B 315 7.883 43.120 -89.086 1.00148.54 N
ATOM 7542 CA SER B 315 8.969 43.007 -88.118 1.00148.54 C
ATOM 7543 C SER B 315 9.687 41.670 -88.244 1.00148.54 C
ATOM 7544 O SER B 315 10.903 41.597 -88.048 1.00148.54 O
ATOM 7545 CB SER B 315 8.426 43.196 -86.704 1.00148.54 C
ATOM 7546 OG SER B 315 9.452 43.055 -85.740 1.00148.54 O
ATOM 7547 N ILE B 316 8.950 40.607 -88.590 1.00142.81 N
ATOM 7548 CA ILE B 316 9.557 39.296 -88.837 1.00142.81 C
ATOM 7549 C ILE B 316 10.516 39.362 -90.021 1.00142.81 C
ATOM 7550 O ILE B 316 11.657 38.888 -89.945 1.00142.81 O
ATOM 7551 CB ILE B 316 8.462 38.232 -89.043 1.00142.81 C
ATOM 7552 CG1 ILE B 316 7.829 37.856 -87.701 1.00142.81 C
ATOM 7553 CG2 ILE B 316 8.986 37.006 -89.777 1.00142.81 C
ATOM 7554 CD1 ILE B 316 6.584 37.020 -87.828 1.00142.81 C
ATOM 7555 N ASN B 317 10.069 39.981 -91.120 1.00139.11 N
ATOM 7556 CA ASN B 317 10.901 40.096 -92.315 1.00139.11 C
ATOM 7557 C ASN B 317 12.136 40.953 -92.066 1.00139.11 C
ATOM 7558 O ASN B 317 13.237 40.609 -92.513 1.00139.11 O
ATOM 7559 CB ASN B 317 10.082 40.674 -93.469 1.00139.11 C
ATOM 7560 N VAL B 318 11.982 42.048 -91.316 1.00138.64 N
ATOM 7561 CA VAL B 318 13.123 42.921 -91.044 1.00138.64 C
ATOM 7562 C VAL B 318 14.095 42.255 -90.072 1.00138.64 C
ATOM 7563 O VAL B 318 15.320 42.358 -90.225 1.00138.64 O
ATOM 7564 CB VAL B 318 12.629 44.290 -90.535 1.00138.64 C
ATOM 7565 CG1 VAL B 318 13.782 45.167 -90.090 1.00138.64 C
ATOM 7566 CG2 VAL B 318 11.869 45.002 -91.638 1.00138.64 C
ATOM 7567 N ALA B 319 13.571 41.521 -89.087 1.00136.17 N
ATOM 7568 CA ALA B 319 14.429 40.900 -88.086 1.00136.17 C
ATOM 7569 C ALA B 319 15.222 39.738 -88.668 1.00136.17 C
ATOM 7570 O ALA B 319 16.422 39.605 -88.403 1.00136.17 O
ATOM 7571 CB ALA B 319 13.584 40.432 -86.906 1.00136.17 C
ATOM 7572 N ILE B 320 14.572 38.889 -89.469 1.00134.82 N
ATOM 7573 CA ILE B 320 15.294 37.802 -90.124 1.00134.82 C
ATOM 7574 C ILE B 320 16.221 38.365 -91.196 1.00134.82 C
ATOM 7575 O ILE B 320 17.293 37.809 -91.471 1.00134.82 O
ATOM 7576 CB ILE B 320 14.291 36.771 -90.676 1.00134.82 C
ATOM 7577 CG1 ILE B 320 13.478 36.192 -89.523 1.00134.82 C
ATOM 7578 CG2 ILE B 320 14.977 35.611 -91.372 1.00134.82 C
ATOM 7579 CD1 ILE B 320 12.330 35.338 -89.965 1.00134.82 C
ATOM 7580 N LYS B 321 15.852 39.517 -91.770 1.00135.88 N
ATOM 7581 CA LYS B 321 16.733 40.223 -92.693 1.00135.88 C
ATOM 7582 C LYS B 321 18.011 40.685 -92.003 1.00135.88 C
ATOM 7583 O LYS B 321 19.080 40.733 -92.623 1.00135.88 O
ATOM 7584 CB LYS B 321 15.982 41.409 -93.302 1.00135.88 C
ATOM 7585 CG LYS B 321 16.729 42.184 -94.367 1.00135.88 C
ATOM 7586 CD LYS B 321 15.844 43.270 -94.940 1.00135.88 C
ATOM 7587 CE LYS B 321 16.567 44.078 -95.995 1.00135.88 C
ATOM 7588 NZ LYS B 321 15.689 45.137 -96.562 1.00135.88 N
ATOM 7589 N SER B 322 17.933 41.000 -90.714 1.00134.09 N
ATOM 7590 CA SER B 322 19.119 41.384 -89.964 1.00134.09 C
ATOM 7591 C SER B 322 19.757 40.216 -89.213 1.00134.09 C
ATOM 7592 O SER B 322 20.537 40.470 -88.286 1.00134.09 O
ATOM 7593 CB SER B 322 18.782 42.516 -88.991 1.00134.09 C
ATOM 7594 OG SER B 322 19.931 42.919 -88.265 1.00134.09 O
ATOM 7595 N LYS B 323 19.437 38.978 -89.605 1.00131.83 N
ATOM 7596 CA LYS B 323 20.024 37.738 -89.078 1.00131.83 C
ATOM 7597 C LYS B 323 19.814 37.606 -87.565 1.00131.83 C
ATOM 7598 O LYS B 323 20.748 37.609 -86.765 1.00131.83 O
ATOM 7599 CB LYS B 323 21.509 37.629 -89.445 1.00131.83 C
ATOM 7600 N ILE B 324 18.541 37.503 -87.197 1.00129.27 N
ATOM 7601 CA ILE B 324 18.132 37.308 -85.809 1.00129.27 C
ATOM 7602 C ILE B 324 17.189 36.110 -85.752 1.00129.27 C
ATOM 7603 O ILE B 324 16.261 36.022 -86.568 1.00129.27 O
ATOM 7604 CB ILE B 324 17.480 38.582 -85.244 1.00129.27 C
ATOM 7605 CG1 ILE B 324 18.522 39.687 -85.066 1.00129.27 C
ATOM 7606 CG2 ILE B 324 16.768 38.319 -83.934 1.00129.27 C
ATOM 7607 CD1 ILE B 324 17.930 41.027 -84.704 1.00129.27 C
ATOM 7608 N PRO B 325 17.397 35.162 -84.838 1.00124.94 N
ATOM 7609 CA PRO B 325 16.480 34.020 -84.732 1.00124.94 C
ATOM 7610 C PRO B 325 15.116 34.439 -84.204 1.00124.94 C
ATOM 7611 O PRO B 325 14.966 35.487 -83.576 1.00124.94 O
ATOM 7612 CB PRO B 325 17.198 33.087 -83.754 1.00124.94 C
ATOM 7613 CG PRO B 325 18.057 33.991 -82.942 1.00124.94 C
ATOM 7614 CD PRO B 325 18.505 35.070 -83.874 1.00124.94 C
ATOM 7615 N CYS B 326 14.111 33.608 -84.462 1.00124.15 N
ATOM 7616 CA CYS B 326 12.745 33.910 -84.073 1.00124.15 C
ATOM 7617 C CYS B 326 12.086 32.673 -83.488 1.00124.15 C
ATOM 7618 O CYS B 326 12.425 31.544 -83.847 1.00124.15 O
ATOM 7619 CB CYS B 326 11.929 34.408 -85.259 1.00124.15 C
ATOM 7620 SG CYS B 326 12.534 35.941 -85.984 1.00124.15 S
ATOM 7621 N VAL B 327 11.137 32.900 -82.585 1.00120.59 N
ATOM 7622 CA VAL B 327 10.388 31.840 -81.924 1.00120.59 C
ATOM 7623 C VAL B 327 8.908 32.089 -82.170 1.00120.59 C
ATOM 7624 O VAL B 327 8.419 33.203 -81.953 1.00120.59 O
ATOM 7625 CB VAL B 327 10.688 31.786 -80.413 1.00120.59 C
ATOM 7626 CG1 VAL B 327 9.790 30.789 -79.717 1.00120.59 C
ATOM 7627 CG2 VAL B 327 12.132 31.419 -80.180 1.00120.59 C
ATOM 7628 N VAL B 328 8.207 31.064 -82.646 1.00124.25 N
ATOM 7629 CA VAL B 328 6.789 31.148 -82.976 1.00124.25 C
ATOM 7630 C VAL B 328 6.053 30.043 -82.232 1.00124.25 C
ATOM 7631 O VAL B 328 6.453 28.874 -82.292 1.00124.25 O
ATOM 7632 CB VAL B 328 6.562 31.033 -84.495 1.00124.25 C
ATOM 7633 CG1 VAL B 328 5.084 30.961 -84.820 1.00124.25 C
ATOM 7634 CG2 VAL B 328 7.199 32.206 -85.219 1.00124.25 C
ATOM 7635 N VAL B 329 4.978 30.408 -81.539 1.00126.99 N
ATOM 7636 CA VAL B 329 4.158 29.460 -80.796 1.00126.99 C
ATOM 7637 C VAL B 329 3.066 28.944 -81.723 1.00126.99 C
ATOM 7638 O VAL B 329 2.347 29.733 -82.349 1.00126.99 O
ATOM 7639 CB VAL B 329 3.549 30.113 -79.544 1.00126.99 C
ATOM 7640 CG1 VAL B 329 2.679 29.120 -78.785 1.00126.99 C
ATOM 7641 CG2 VAL B 329 4.642 30.659 -78.661 1.00126.99 C
ATOM 7642 N GLU B 330 2.941 27.623 -81.819 1.00134.66 N
ATOM 7643 CA GLU B 330 1.879 27.029 -82.617 1.00134.66 C
ATOM 7644 C GLU B 330 0.541 27.123 -81.893 1.00134.66 C
ATOM 7645 O GLU B 330 0.450 26.928 -80.678 1.00134.66 O
ATOM 7646 CB GLU B 330 2.194 25.566 -82.930 1.00134.66 C
ATOM 7647 N GLY B 331 -0.506 27.419 -82.657 1.00144.13 N
ATOM 7648 CA GLY B 331 -1.847 27.472 -82.117 1.00144.13 C
ATOM 7649 C GLY B 331 -2.285 28.818 -81.585 1.00144.13 C
ATOM 7650 O GLY B 331 -3.179 28.865 -80.729 1.00144.13 O
ATOM 7651 N SER B 332 -1.688 29.914 -82.055 1.00148.30 N
ATOM 7652 CA SER B 332 -2.079 31.232 -81.565 1.00148.30 C
ATOM 7653 C SER B 332 -3.398 31.685 -82.178 1.00148.30 C
ATOM 7654 O SER B 332 -4.033 32.621 -81.680 1.00148.30 O
ATOM 7655 CB SER B 332 -0.972 32.246 -81.856 1.00148.30 C
ATOM 7656 OG SER B 332 -1.327 33.538 -81.395 1.00148.30 O
ATOM 7657 N GLY B 333 -3.827 31.040 -83.261 1.00151.53 N
ATOM 7658 CA GLY B 333 -5.014 31.469 -83.970 1.00151.53 C
ATOM 7659 C GLY B 333 -4.785 32.611 -84.929 1.00151.53 C
ATOM 7660 O GLY B 333 -5.753 33.240 -85.368 1.00151.53 O
ATOM 7661 N ARG B 334 -3.532 32.892 -85.272 1.00154.58 N
ATOM 7662 CA ARG B 334 -3.185 34.051 -86.080 1.00154.58 C
ATOM 7663 C ARG B 334 -2.361 33.629 -87.286 1.00154.58 C
ATOM 7664 O ARG B 334 -2.292 32.442 -87.617 1.00154.58 O
ATOM 7665 CB ARG B 334 -2.420 35.078 -85.244 1.00154.58 C
ATOM 7666 N ILE B 335 -1.746 34.611 -87.951 1.00156.76 N
ATOM 7667 CA ILE B 335 -0.874 34.352 -89.096 1.00156.76 C
ATOM 7668 C ILE B 335 0.348 33.531 -88.681 1.00156.76 C
ATOM 7669 O ILE B 335 0.946 32.819 -89.501 1.00156.76 O
ATOM 7670 CB ILE B 335 -0.491 35.692 -89.759 1.00156.76 C
ATOM 7671 CG1 ILE B 335 0.202 35.493 -91.103 1.00156.76 C
ATOM 7672 CG2 ILE B 335 0.368 36.552 -88.847 1.00156.76 C
ATOM 7673 CD1 ILE B 335 0.299 36.763 -91.887 1.00156.76 C
ATOM 7674 N ALA B 336 0.718 33.591 -87.395 1.00154.19 N
ATOM 7675 CA ALA B 336 1.826 32.794 -86.881 1.00154.19 C
ATOM 7676 C ALA B 336 1.525 31.302 -86.956 1.00154.19 C
ATOM 7677 O ALA B 336 2.434 30.489 -87.160 1.00154.19 O
ATOM 7678 CB ALA B 336 2.138 33.208 -85.445 1.00154.19 C
ATOM 7679 N ASP B 337 0.250 30.925 -86.816 1.00152.33 N
ATOM 7680 CA ASP B 337 -0.140 29.533 -87.015 1.00152.33 C
ATOM 7681 C ASP B 337 0.069 29.117 -88.467 1.00152.33 C
ATOM 7682 O ASP B 337 0.464 27.979 -88.746 1.00152.33 O
ATOM 7683 CB ASP B 337 -1.600 29.341 -86.604 1.00152.33 C
ATOM 7684 CG ASP B 337 -1.986 27.880 -86.442 1.00152.33 C
ATOM 7685 OD1 ASP B 337 -1.121 26.992 -86.577 1.00152.33 O
ATOM 7686 OD2 ASP B 337 -3.177 27.619 -86.181 1.00152.33 O
ATOM 7687 N VAL B 338 -0.162 30.038 -89.404 1.00156.91 N
ATOM 7688 CA VAL B 338 0.057 29.737 -90.814 1.00156.91 C
ATOM 7689 C VAL B 338 1.544 29.598 -91.106 1.00156.91 C
ATOM 7690 O VAL B 338 1.955 28.760 -91.920 1.00156.91 O
ATOM 7691 CB VAL B 338 -0.595 30.815 -91.699 1.00156.91 C
ATOM 7692 N ILE B 339 2.373 30.406 -90.439 1.00157.72 N
ATOM 7693 CA ILE B 339 3.821 30.282 -90.609 1.00157.72 C
ATOM 7694 C ILE B 339 4.314 28.979 -89.987 1.00157.72 C
ATOM 7695 O ILE B 339 5.241 28.339 -90.499 1.00157.72 O
ATOM 7696 CB ILE B 339 4.535 31.514 -90.019 1.00157.72 C
ATOM 7697 CG1 ILE B 339 4.000 32.794 -90.660 1.00157.72 C
ATOM 7698 CG2 ILE B 339 6.039 31.456 -90.250 1.00157.72 C
ATOM 7699 CD1 ILE B 339 4.189 32.855 -92.159 1.00157.72 C
ATOM 7700 N ALA B 340 3.667 28.543 -88.903 1.00155.41 N
ATOM 7701 CA ALA B 340 4.035 27.278 -88.273 1.00155.41 C
ATOM 7702 C ALA B 340 3.638 26.087 -89.136 1.00155.41 C
ATOM 7703 O ALA B 340 4.378 25.099 -89.222 1.00155.41 O
ATOM 7704 CB ALA B 340 3.388 27.175 -86.893 1.00155.41 C
ATOM 7705 N SER B 341 2.471 26.158 -89.777 1.00157.72 N
ATOM 7706 CA SER B 341 2.029 25.059 -90.629 1.00157.72 C
ATOM 7707 C SER B 341 2.829 25.005 -91.925 1.00157.72 C
ATOM 7708 O SER B 341 3.125 23.918 -92.434 1.00157.72 O
ATOM 7709 CB SER B 341 0.536 25.191 -90.926 1.00157.72 C
ATOM 7710 N LEU B 342 3.191 26.169 -92.473 1.00161.90 N
ATOM 7711 CA LEU B 342 3.957 26.197 -93.716 1.00161.90 C
ATOM 7712 C LEU B 342 5.401 25.762 -93.494 1.00161.90 C
ATOM 7713 O LEU B 342 6.082 25.347 -94.438 1.00161.90 O
ATOM 7714 CB LEU B 342 3.913 27.596 -94.330 1.00161.90 C
ATOM 7715 N VAL B 343 5.888 25.860 -92.260 1.00157.20 N
ATOM 7716 CA VAL B 343 7.260 25.480 -91.944 1.00157.20 C
ATOM 7717 C VAL B 343 7.424 23.966 -91.967 1.00157.20 C
ATOM 7718 O VAL B 343 8.457 23.452 -92.397 1.00157.20 O
ATOM 7719 CB VAL B 343 7.693 26.045 -90.584 1.00157.20 C
ATOM 7720 N SER B 351 3.631 30.558-102.173 1.00244.11 N
ATOM 7721 CA SER B 351 3.776 30.218-103.583 1.00244.11 C
ATOM 7722 C SER B 351 2.516 29.538-104.102 1.00244.11 C
ATOM 7723 O SER B 351 2.592 28.490-104.747 1.00244.11 O
ATOM 7724 CB SER B 351 4.992 29.315-103.794 1.00244.11 C
ATOM 7725 N SER B 352 1.365 30.120-103.733 1.00249.84 N
ATOM 7726 CA SER B 352 -0.010 29.789-104.133 1.00249.84 C
ATOM 7727 C SER B 352 -0.520 28.479-103.529 1.00249.84 C
ATOM 7728 O SER B 352 -1.711 28.171-103.636 1.00249.84 O
ATOM 7729 CB SER B 352 -0.173 29.759-105.662 1.00249.84 C
ATOM 7730 OG SER B 352 0.485 28.648-106.245 1.00249.84 O
ATOM 7731 N CYS B 353 0.359 27.708-102.888 1.00245.00 N
ATOM 7732 CA CYS B 353 -0.093 26.734-101.905 1.00245.00 C
ATOM 7733 C CYS B 353 -0.054 27.351-100.519 1.00245.00 C
ATOM 7734 O CYS B 353 -0.851 26.998 -99.641 1.00245.00 O
ATOM 7735 CB CYS B 353 0.770 25.476-101.966 1.00245.00 C
ATOM 7736 SG CYS B 353 0.619 24.549-103.506 1.00245.00 S
ATOM 7737 N VAL B 354 0.876 28.287-100.316 1.00247.09 N
ATOM 7738 CA VAL B 354 0.888 29.113 -99.116 1.00247.09 C
ATOM 7739 C VAL B 354 -0.361 29.984 -99.068 1.00247.09 C
ATOM 7740 O VAL B 354 -1.001 30.121 -98.019 1.00247.09 O
ATOM 7741 CB VAL B 354 2.177 29.956 -99.077 1.00247.09 C
ATOM 7742 CG1 VAL B 354 2.191 30.877 -97.870 1.00247.09 C
ATOM 7743 CG2 VAL B 354 3.404 29.054 -99.083 1.00247.09 C
ATOM 7744 N LYS B 355 -0.736 30.568-100.211 1.00247.50 N
ATOM 7745 CA LYS B 355 -1.943 31.386-100.276 1.00247.50 C
ATOM 7746 C LYS B 355 -3.198 30.540-100.101 1.00247.50 C
ATOM 7747 O LYS B 355 -4.216 31.026 -99.594 1.00247.50 O
ATOM 7748 CB LYS B 355 -1.993 32.144-101.601 1.00247.50 C
ATOM 7749 N GLU B 356 -3.146 29.275-100.520 1.00247.92 N
ATOM 7750 CA GLU B 356 -4.246 28.361-100.235 1.00247.92 C
ATOM 7751 C GLU B 356 -4.286 28.002 -98.755 1.00247.92 C
ATOM 7752 O GLU B 356 -5.362 27.778 -98.189 1.00247.92 O
ATOM 7753 CB GLU B 356 -4.117 27.101-101.088 1.00247.92 C
ATOM 7754 N SER B 357 -3.118 27.947 -98.111 1.00243.04 N
ATOM 7755 CA SER B 357 -3.066 27.623 -96.690 1.00243.04 C
ATOM 7756 C SER B 357 -3.482 28.813 -95.832 1.00243.04 C
ATOM 7757 O SER B 357 -3.844 28.643 -94.662 1.00243.04 O
ATOM 7758 CB SER B 357 -1.662 27.156 -96.319 1.00243.04 C
ATOM 7759 OG SER B 357 -1.577 26.869 -94.937 1.00243.04 O
ATOM 7760 N LEU B 358 -3.393 30.025 -96.390 1.00249.57 N
ATOM 7761 CA LEU B 358 -3.795 31.239 -95.678 1.00249.57 C
ATOM 7762 C LEU B 358 -5.275 31.218 -95.308 1.00249.57 C
ATOM 7763 O LEU B 358 -5.665 31.675 -94.228 1.00249.57 O
ATOM 7764 CB LEU B 358 -3.491 32.481 -96.525 1.00249.57 C
ATOM 7765 CG LEU B 358 -2.049 32.944 -96.741 1.00249.57 C
ATOM 7766 CD1 LEU B 358 -2.001 34.118 -97.705 1.00249.57 C
ATOM 7767 CD2 LEU B 358 -1.406 33.315 -95.419 1.00249.57 C
ATOM 7768 N LEU B 359 -6.113 30.707 -96.211 1.00250.62 N
ATOM 7769 CA LEU B 359 -7.559 30.661 -96.016 1.00250.62 C
ATOM 7770 C LEU B 359 -7.956 29.752 -94.861 1.00250.62 C
ATOM 7771 O LEU B 359 -8.968 29.995 -94.193 1.00250.62 O
ATOM 7772 CB LEU B 359 -8.249 30.206 -97.302 1.00250.62 C
ATOM 7773 N ARG B 360 -7.173 28.695 -94.627 1.00248.23 N
ATOM 7774 CA ARG B 360 -7.448 27.798 -93.510 1.00248.23 C
ATOM 7775 C ARG B 360 -7.180 28.480 -92.174 1.00248.23 C
ATOM 7776 O ARG B 360 -7.851 28.194 -91.175 1.00248.23 O
ATOM 7777 CB ARG B 360 -6.611 26.525 -93.641 1.00248.23 C
ATOM 7778 N PHE B 361 -6.202 29.387 -92.136 1.00249.72 N
ATOM 7779 CA PHE B 361 -5.859 30.051 -90.883 1.00249.72 C
ATOM 7780 C PHE B 361 -6.845 31.165 -90.553 1.00249.72 C
ATOM 7781 O PHE B 361 -7.508 31.128 -89.510 1.00249.72 O
ATOM 7782 CB PHE B 361 -4.434 30.598 -90.959 1.00249.72 C
ATOM 7783 N LEU B 362 -6.959 32.164 -91.430 1.00260.28 N
ATOM 7784 CA LEU B 362 -7.825 33.308 -91.168 1.00260.28 C
ATOM 7785 C LEU B 362 -8.417 33.843 -92.467 1.00260.28 C
ATOM 7786 O LEU B 362 -7.724 34.524 -93.234 1.00260.28 O
ATOM 7787 CB LEU B 362 -7.052 34.410 -90.441 1.00260.28 C
ATOM 7788 N PRO B 363 -9.689 33.559 -92.747 1.00260.46 N
ATOM 7789 CA PRO B 363 -10.302 34.055 -93.985 1.00260.46 C
ATOM 7790 C PRO B 363 -10.746 35.507 -93.886 1.00260.46 C
ATOM 7791 O PRO B 363 -11.020 36.145 -94.906 1.00260.46 O
ATOM 7792 CB PRO B 363 -11.497 33.116 -94.179 1.00260.46 C
ATOM 7793 CG PRO B 363 -11.864 32.710 -92.796 1.00260.46 C
ATOM 7794 CD PRO B 363 -10.576 32.631 -92.023 1.00260.46 C
ATOM 7795 N ARG B 364 -10.833 36.032 -92.661 1.00260.49 N
ATOM 7796 CA ARG B 364 -11.326 37.394 -92.473 1.00260.49 C
ATOM 7797 C ARG B 364 -10.299 38.424 -92.923 1.00260.49 C
ATOM 7798 O ARG B 364 -10.659 39.474 -93.467 1.00260.49 O
ATOM 7799 CB ARG B 364 -11.701 37.618 -91.008 1.00260.49 C
ATOM 7800 N THR B 365 -9.014 38.141 -92.705 1.00259.44 N
ATOM 7801 CA THR B 365 -7.975 39.101 -93.061 1.00259.44 C
ATOM 7802 C THR B 365 -7.732 39.128 -94.565 1.00259.44 C
ATOM 7803 O THR B 365 -7.449 40.187 -95.137 1.00259.44 O
ATOM 7804 CB THR B 365 -6.681 38.773 -92.319 1.00259.44 C
ATOM 7805 N ILE B 366 -7.839 37.973 -95.224 1.00258.74 N
ATOM 7806 CA ILE B 366 -7.588 37.913 -96.662 1.00258.74 C
ATOM 7807 C ILE B 366 -8.801 38.406 -97.441 1.00258.74 C
ATOM 7808 O ILE B 366 -8.728 38.621 -98.658 1.00258.74 O
ATOM 7809 CB ILE B 366 -7.193 36.486 -97.080 1.00258.74 C
ATOM 7810 CG1 ILE B 366 -8.358 35.522 -96.867 1.00258.74 C
ATOM 7811 CG2 ILE B 366 -5.985 36.022 -96.288 1.00258.74 C
ATOM 7812 CD1 ILE B 366 -8.135 34.153 -97.470 1.00258.74 C
ATOM 7813 N SER B 367 -9.937 38.580 -96.758 1.00258.60 N
ATOM 7814 CA SER B 367 -11.164 38.986 -97.436 1.00258.60 C
ATOM 7815 C SER B 367 -11.105 40.442 -97.882 1.00258.60 C
ATOM 7816 O SER B 367 -11.232 40.740 -99.075 1.00258.60 O
ATOM 7817 CB SER B 367 -12.365 38.756 -96.518 1.00258.60 C
ATOM 7818 OG SER B 367 -12.302 39.600 -95.381 1.00258.60 O
ATOM 7819 N ARG B 368 -10.893 41.363 -96.939 1.00253.10 N
ATOM 7820 CA ARG B 368 -10.883 42.782 -97.283 1.00253.10 C
ATOM 7821 C ARG B 368 -9.576 43.185 -97.954 1.00253.10 C
ATOM 7822 O ARG B 368 -9.471 44.284 -98.509 1.00253.10 O
ATOM 7823 CB ARG B 368 -11.124 43.625 -96.033 1.00253.10 C
ATOM 7824 N LEU B 369 -8.564 42.318 -97.894 1.00249.95 N
ATOM 7825 CA LEU B 369 -7.274 42.617 -98.497 1.00249.95 C
ATOM 7826 C LEU B 369 -7.374 42.620-100.017 1.00249.95 C
ATOM 7827 O LEU B 369 -8.263 41.994-100.600 1.00249.95 O
ATOM 7828 CB LEU B 369 -6.230 41.596 -98.041 1.00249.95 C
ATOM 7829 N SER B 370 -6.459 43.343-100.656 1.00240.71 N
ATOM 7830 CA SER B 370 -6.426 43.444-102.105 1.00240.71 C
ATOM 7831 C SER B 370 -5.545 42.333-102.679 1.00240.71 C
ATOM 7832 O SER B 370 -4.988 41.507-101.950 1.00240.71 O
ATOM 7833 CB SER B 370 -5.945 44.832-102.524 1.00240.71 C
ATOM 7834 N GLU B 371 -5.416 42.304-104.007 1.00238.12 N
ATOM 7835 CA GLU B 371 -4.592 41.287-104.649 1.00238.12 C
ATOM 7836 C GLU B 371 -3.112 41.642-104.565 1.00238.12 C
ATOM 7837 O GLU B 371 -2.261 40.751-104.451 1.00238.12 O
ATOM 7838 CB GLU B 371 -5.022 41.107-106.104 1.00238.12 C
ATOM 7839 N GLU B 372 -2.785 42.937-104.629 1.00233.16 N
ATOM 7840 CA GLU B 372 -1.398 43.362-104.474 1.00233.16 C
ATOM 7841 C GLU B 372 -0.907 43.123-103.052 1.00233.16 C
ATOM 7842 O GLU B 372 0.272 42.819-102.836 1.00233.16 O
ATOM 7843 CB GLU B 372 -1.253 44.834-104.854 1.00233.16 C
ATOM 7844 N GLU B 373 -1.808 43.228-102.069 1.00235.51 N
ATOM 7845 CA GLU B 373 -1.452 42.900-100.692 1.00235.51 C
ATOM 7846 C GLU B 373 -1.203 41.406-100.532 1.00235.51 C
ATOM 7847 O GLU B 373 -0.305 40.994 -99.788 1.00235.51 O
ATOM 7848 CB GLU B 373 -2.551 43.366 -99.737 1.00235.51 C
ATOM 7849 N THR B 374 -1.984 40.579-101.236 1.00232.66 N
ATOM 7850 CA THR B 374 -1.746 39.138-101.223 1.00232.66 C
ATOM 7851 C THR B 374 -0.423 38.794-101.898 1.00232.66 C
ATOM 7852 O THR B 374 0.301 37.903-101.439 1.00232.66 O
ATOM 7853 CB THR B 374 -2.902 38.407-101.904 1.00232.66 C
ATOM 7854 N GLU B 375 -0.081 39.511-102.974 1.00229.64 N
ATOM 7855 CA GLU B 375 1.202 39.296-103.641 1.00229.64 C
ATOM 7856 C GLU B 375 2.366 39.723-102.755 1.00229.64 C
ATOM 7857 O GLU B 375 3.409 39.055-102.722 1.00229.64 O
ATOM 7858 CB GLU B 375 1.239 40.050-104.970 1.00229.64 C
ATOM 7859 N SER B 376 2.197 40.822-102.015 1.00226.41 N
ATOM 7860 CA SER B 376 3.229 41.256-101.080 1.00226.41 C
ATOM 7861 C SER B 376 3.386 40.270 -99.928 1.00226.41 C
ATOM 7862 O SER B 376 4.509 40.012 -99.478 1.00226.41 O
ATOM 7863 CB SER B 376 2.905 42.651-100.551 1.00226.41 C
ATOM 7864 OG SER B 376 3.881 43.078 -99.617 1.00226.41 O
ATOM 7865 N TRP B 377 2.273 39.695 -99.452 1.00225.01 N
ATOM 7866 CA TRP B 377 2.348 38.673 -98.408 1.00225.01 C
ATOM 7867 C TRP B 377 3.056 37.420 -98.900 1.00225.01 C
ATOM 7868 O TRP B 377 3.868 36.839 -98.172 1.00225.01 O
ATOM 7869 CB TRP B 377 0.958 38.297 -97.903 1.00225.01 C
ATOM 7870 CG TRP B 377 0.308 39.299 -97.032 1.00225.01 C
ATOM 7871 CD1 TRP B 377 0.810 40.503 -96.643 1.00225.01 C
ATOM 7872 CD2 TRP B 377 -0.953 39.156 -96.379 1.00225.01 C
ATOM 7873 NE1 TRP B 377 -0.081 41.138 -95.814 1.00225.01 N
ATOM 7874 CE2 TRP B 377 -1.172 40.327 -95.632 1.00225.01 C
ATOM 7875 CE3 TRP B 377 -1.929 38.154 -96.364 1.00225.01 C
ATOM 7876 CZ2 TRP B 377 -2.329 40.526 -94.875 1.00225.01 C
ATOM 7877 CZ3 TRP B 377 -3.074 38.350 -95.616 1.00225.01 C
ATOM 7878 CH2 TRP B 377 -3.265 39.527 -94.881 1.00225.01 C
ATOM 7879 N ILE B 378 2.749 36.980-100.123 1.00219.14 N
ATOM 7880 CA ILE B 378 3.418 35.812-100.689 1.00219.14 C
ATOM 7881 C ILE B 378 4.909 36.070-100.880 1.00219.14 C
ATOM 7882 O ILE B 378 5.734 35.214-100.532 1.00219.14 O
ATOM 7883 CB ILE B 378 2.731 35.399-102.004 1.00219.14 C
ATOM 7884 CG1 ILE B 378 1.337 34.841-101.721 1.00219.14 C
ATOM 7885 CG2 ILE B 378 3.550 34.367-102.770 1.00219.14 C
ATOM 7886 CD1 ILE B 378 0.500 34.657-102.964 1.00219.14 C
ATOM 7887 N LYS B 379 5.277 37.267-101.353 1.00210.68 N
ATOM 7888 CA LYS B 379 6.687 37.614-101.518 1.00210.68 C
ATOM 7889 C LYS B 379 7.413 37.680-100.178 1.00210.68 C
ATOM 7890 O LYS B 379 8.538 37.180-100.050 1.00210.68 O
ATOM 7891 CB LYS B 379 6.812 38.944-102.260 1.00210.68 C
ATOM 7892 N TRP B 380 6.769 38.243 -99.153 1.00203.85 N
ATOM 7893 CA TRP B 380 7.431 38.391 -97.862 1.00203.85 C
ATOM 7894 C TRP B 380 7.533 37.061 -97.125 1.00203.85 C
ATOM 7895 O TRP B 380 8.515 36.816 -96.418 1.00203.85 O
ATOM 7896 CB TRP B 380 6.695 39.424 -97.012 1.00203.85 C
ATOM 7897 N ILE B 381 6.536 36.186 -97.275 1.00196.74 N
ATOM 7898 CA ILE B 381 6.608 34.870 -96.645 1.00196.74 C
ATOM 7899 C ILE B 381 7.629 33.991 -97.362 1.00196.74 C
ATOM 7900 O ILE B 381 8.364 33.225 -96.724 1.00196.74 O
ATOM 7901 CB ILE B 381 5.202 34.236 -96.586 1.00196.74 C
ATOM 7902 CG1 ILE B 381 4.346 34.964 -95.549 1.00196.74 C
ATOM 7903 CG2 ILE B 381 5.238 32.752 -96.259 1.00196.74 C
ATOM 7904 CD1 ILE B 381 2.897 34.564 -95.568 1.00196.74 C
ATOM 7905 N LYS B 382 7.736 34.131 -98.689 1.00199.14 N
ATOM 7906 CA LYS B 382 8.769 33.404 -99.425 1.00199.14 C
ATOM 7907 C LYS B 382 10.162 33.922 -99.081 1.00199.14 C
ATOM 7908 O LYS B 382 11.138 33.163 -99.103 1.00199.14 O
ATOM 7909 CB LYS B 382 8.511 33.508-100.928 1.00199.14 C
ATOM 7910 N GLU B 383 10.271 35.211 -98.758 1.00191.88 N
ATOM 7911 CA GLU B 383 11.528 35.728 -98.234 1.00191.88 C
ATOM 7912 C GLU B 383 11.762 35.256 -96.800 1.00191.88 C
ATOM 7913 O GLU B 383 12.908 35.135 -96.356 1.00191.88 O
ATOM 7914 CB GLU B 383 11.536 37.254 -98.310 1.00191.88 C
ATOM 7915 N VAL B 384 10.683 34.982 -96.066 1.00185.99 N
ATOM 7916 CA VAL B 384 10.760 34.585 -94.664 1.00185.99 C
ATOM 7917 C VAL B 384 11.199 33.133 -94.550 1.00185.99 C
ATOM 7918 O VAL B 384 12.098 32.804 -93.768 1.00185.99 O
ATOM 7919 CB VAL B 384 9.413 34.797 -93.950 1.00185.99 C
ATOM 7920 N LEU B 385 10.574 32.254 -95.335 1.00177.88 N
ATOM 7921 CA LEU B 385 10.822 30.819 -95.235 1.00177.88 C
ATOM 7922 C LEU B 385 11.988 30.416 -96.141 1.00177.88 C
ATOM 7923 O LEU B 385 12.173 29.236 -96.456 1.00177.88 O
ATOM 7924 CB LEU B 385 9.529 30.055 -95.562 1.00177.88 C
ATOM 7925 CG LEU B 385 9.316 28.587 -95.171 1.00177.88 C
ATOM 7926 CD1 LEU B 385 9.371 28.438 -93.665 1.00177.88 C
ATOM 7927 CD2 LEU B 385 7.998 28.060 -95.707 1.00177.88 C
ATOM 7928 N GLU B 386 12.786 31.401 -96.568 1.00175.89 N
ATOM 7929 CA GLU B 386 14.003 31.107 -97.316 1.00175.89 C
ATOM 7930 C GLU B 386 15.018 30.369 -96.452 1.00175.89 C
ATOM 7931 O GLU B 386 15.758 29.510 -96.945 1.00175.89 O
ATOM 7932 CB GLU B 386 14.604 32.402 -97.865 1.00175.89 C
ATOM 7933 N SER B 387 15.066 30.689 -95.163 1.00164.25 N
ATOM 7934 CA SER B 387 15.972 30.034 -94.227 1.00164.25 C
ATOM 7935 C SER B 387 15.165 29.341 -93.137 1.00164.25 C
ATOM 7936 O SER B 387 14.680 30.017 -92.213 1.00164.25 O
ATOM 7937 CB SER B 387 16.933 31.052 -93.615 1.00164.25 C
ATOM 7938 OG SER B 387 16.223 31.996 -92.835 1.00164.25 O
ATOM 7939 N PRO B 388 14.986 28.017 -93.195 1.00155.59 N
ATOM 7940 CA PRO B 388 14.204 27.348 -92.142 1.00155.59 C
ATOM 7941 C PRO B 388 14.936 27.266 -90.821 1.00155.59 C
ATOM 7942 O PRO B 388 14.293 27.192 -89.766 1.00155.59 O
ATOM 7943 CB PRO B 388 13.950 25.952 -92.729 1.00155.59 C
ATOM 7944 CG PRO B 388 14.166 26.101 -94.191 1.00155.59 C
ATOM 7945 CD PRO B 388 15.249 27.122 -94.331 1.00155.59 C
ATOM 7946 N HIS B 389 16.271 27.279 -90.851 1.00143.01 N
ATOM 7947 CA HIS B 389 17.052 27.030 -89.643 1.00143.01 C
ATOM 7948 C HIS B 389 16.971 28.195 -88.667 1.00143.01 C
ATOM 7949 O HIS B 389 17.149 28.010 -87.458 1.00143.01 O
ATOM 7950 CB HIS B 389 18.505 26.751 -90.016 1.00143.01 C
ATOM 7951 CG HIS B 389 19.195 27.917 -90.643 1.00143.01 C
ATOM 7952 ND1 HIS B 389 19.043 28.242 -91.972 1.00143.01 N
ATOM 7953 CD2 HIS B 389 20.030 28.844 -90.120 1.00143.01 C
ATOM 7954 CE1 HIS B 389 19.762 29.317 -92.243 1.00143.01 C
ATOM 7955 NE2 HIS B 389 20.372 29.700 -91.137 1.00143.01 N
ATOM 7956 N LEU B 390 16.704 29.403 -89.166 1.00138.91 N
ATOM 7957 CA LEU B 390 16.708 30.567 -88.288 1.00138.91 C
ATOM 7958 C LEU B 390 15.447 30.631 -87.435 1.00138.91 C
ATOM 7959 O LEU B 390 15.492 31.091 -86.289 1.00138.91 O
ATOM 7960 CB LEU B 390 16.878 31.846 -89.102 1.00138.91 C
ATOM 7961 CG LEU B 390 18.252 32.007 -89.753 1.00138.91 C
ATOM 7962 CD1 LEU B 390 18.307 33.261 -90.598 1.00138.91 C
ATOM 7963 CD2 LEU B 390 19.337 32.034 -88.698 1.00138.91 C
ATOM 7964 N LEU B 391 14.317 30.188 -87.966 1.00134.92 N
ATOM 7965 CA LEU B 391 13.101 30.200 -87.174 1.00134.92 C
ATOM 7966 C LEU B 391 12.995 28.926 -86.349 1.00134.92 C
ATOM 7967 O LEU B 391 13.577 27.893 -86.685 1.00134.92 O
ATOM 7968 CB LEU B 391 11.874 30.376 -88.069 1.00134.92 C
ATOM 7969 CG LEU B 391 11.453 29.332 -89.106 1.00134.92 C
ATOM 7970 CD1 LEU B 391 10.412 28.343 -88.568 1.00134.92 C
ATOM 7971 CD2 LEU B 391 10.938 30.030 -90.351 1.00134.92 C
ATOM 7972 N THR B 392 12.223 29.006 -85.271 1.00128.06 N
ATOM 7973 CA THR B 392 11.999 27.872 -84.386 1.00128.06 C
ATOM 7974 C THR B 392 10.567 27.920 -83.873 1.00128.06 C
ATOM 7975 O THR B 392 10.085 28.975 -83.462 1.00128.06 O
ATOM 7976 CB THR B 392 12.960 27.888 -83.186 1.00128.06 C
ATOM 7977 OG1 THR B 392 14.313 27.867 -83.654 1.00128.06 O
ATOM 7978 CG2 THR B 392 12.717 26.682 -82.295 1.00128.06 C
ATOM 7979 N VAL B 393 9.884 26.782 -83.899 1.00126.95 N
ATOM 7980 CA VAL B 393 8.502 26.733 -83.439 1.00126.95 C
ATOM 7981 C VAL B 393 8.317 25.815 -82.238 1.00126.95 C
ATOM 7982 O VAL B 393 8.748 24.663 -82.249 1.00126.95 O
ATOM 7983 CB VAL B 393 7.553 26.286 -84.563 1.00126.95 C
ATOM 7984 CG1 VAL B 393 6.118 26.255 -84.060 1.00126.95 C
ATOM 7985 CG2 VAL B 393 7.685 27.213 -85.761 1.00126.95 C
ATOM 7986 N ILE B 394 7.672 26.339 -81.202 1.00124.36 N
ATOM 7987 CA ILE B 394 7.413 25.577 -79.991 1.00124.36 C
ATOM 7988 C ILE B 394 6.425 24.450 -80.269 1.00124.36 C
ATOM 7989 O ILE B 394 5.458 24.631 -81.006 1.00124.36 O
ATOM 7990 CB ILE B 394 6.845 26.480 -78.881 1.00124.36 C
ATOM 7991 CG1 ILE B 394 7.668 27.765 -78.772 1.00124.36 C
ATOM 7992 CG2 ILE B 394 6.814 25.743 -77.550 1.00124.36 C
ATOM 7993 CD1 ILE B 394 7.177 28.715 -77.701 1.00124.36 C
ATOM 7994 N LYS B 395 6.671 23.289 -79.673 1.00124.52 N
ATOM 7995 CA LYS B 395 5.795 22.138 -79.849 1.00124.52 C
ATOM 7996 C LYS B 395 4.440 22.395 -79.201 1.00124.52 C
ATOM 7997 O LYS B 395 4.353 23.047 -78.162 1.00124.52 O
ATOM 7998 CB LYS B 395 6.432 20.881 -79.258 1.00124.52 C
ATOM 7999 N ILE B 396 3.384 21.880 -79.821 1.00130.70 N
ATOM 8000 CA ILE B 396 2.035 22.054 -79.300 1.00130.70 C
ATOM 8001 C ILE B 396 1.890 21.401 -77.929 1.00130.70 C
ATOM 8002 O ILE B 396 1.248 21.950 -77.034 1.00130.70 O
ATOM 8003 CB ILE B 396 0.978 21.468 -80.256 1.00130.70 C
ATOM 8004 N GLU B 397 2.489 20.226 -77.771 1.00138.92 N
ATOM 8005 CA GLU B 397 2.430 19.499 -76.509 1.00138.92 C
ATOM 8006 C GLU B 397 3.372 20.110 -75.479 1.00138.92 C
ATOM 8007 O GLU B 397 4.232 19.424 -74.928 1.00138.92 O
ATOM 8008 CB GLU B 397 2.777 18.025 -76.722 1.00138.92 C
ATOM 8009 N GLU B 402 9.899 23.213 -68.551 1.00127.89 N
ATOM 8010 CA GLU B 402 11.060 23.935 -69.050 1.00127.89 C
ATOM 8011 C GLU B 402 11.118 23.996 -70.569 1.00127.89 C
ATOM 8012 O GLU B 402 12.216 23.978 -71.132 1.00127.89 O
ATOM 8013 CB GLU B 402 12.342 23.300 -68.506 1.00127.89 C
ATOM 8014 N ILE B 403 9.969 24.056 -71.244 1.00121.98 N
ATOM 8015 CA ILE B 403 9.977 24.101 -72.703 1.00121.98 C
ATOM 8016 C ILE B 403 10.459 25.457 -73.203 1.00121.98 C
ATOM 8017 O ILE B 403 11.008 25.562 -74.307 1.00121.98 O
ATOM 8018 CB ILE B 403 8.585 23.753 -73.260 1.00121.98 C
ATOM 8019 CG1 ILE B 403 7.520 24.694 -72.692 1.00121.98 C
ATOM 8020 CG2 ILE B 403 8.251 22.302 -72.976 1.00121.98 C
ATOM 8021 CD1 ILE B 403 6.182 24.575 -73.371 1.00121.98 C
ATOM 8022 N VAL B 404 10.281 26.509 -72.401 1.00117.38 N
ATOM 8023 CA VAL B 404 10.598 27.860 -72.859 1.00117.38 C
ATOM 8024 C VAL B 404 12.104 28.057 -72.931 1.00117.38 C
ATOM 8025 O VAL B 404 12.639 28.517 -73.949 1.00117.38 O
ATOM 8026 CB VAL B 404 9.939 28.906 -71.944 1.00117.38 C
ATOM 8027 CG1 VAL B 404 10.342 30.304 -72.369 1.00117.38 C
ATOM 8028 CG2 VAL B 404 8.436 28.754 -71.976 1.00117.38 C
ATOM 8029 N SER B 405 12.806 27.707 -71.847 1.00114.77 N
ATOM 8030 CA SER B 405 14.261 27.810 -71.827 1.00114.77 C
ATOM 8031 C SER B 405 14.889 26.874 -72.842 1.00114.77 C
ATOM 8032 O SER B 405 15.880 27.228 -73.492 1.00114.77 O
ATOM 8033 CB SER B 405 14.793 27.495 -70.432 1.00114.77 C
ATOM 8034 OG SER B 405 14.581 26.132 -70.124 1.00114.77 O
ATOM 8035 N ASN B 406 14.295 25.690 -73.012 1.00113.60 N
ATOM 8036 CA ASN B 406 14.776 24.738 -74.005 1.00113.60 C
ATOM 8037 C ASN B 406 14.642 25.301 -75.414 1.00113.60 C
ATOM 8038 O ASN B 406 15.582 25.219 -76.212 1.00113.60 O
ATOM 8039 CB ASN B 406 14.005 23.425 -73.878 1.00113.60 C
ATOM 8040 CG ASN B 406 14.663 22.282 -74.627 1.00113.60 C
ATOM 8041 OD1 ASN B 406 15.727 22.439 -75.225 1.00113.60 O
ATOM 8042 ND2 ASN B 406 14.027 21.118 -74.597 1.00113.60 N
ATOM 8043 N ALA B 407 13.500 25.925 -75.713 1.00112.88 N
ATOM 8044 CA ALA B 407 13.271 26.462 -77.049 1.00112.88 C
ATOM 8045 C ALA B 407 14.180 27.650 -77.335 1.00112.88 C
ATOM 8046 O ALA B 407 14.760 27.743 -78.425 1.00112.88 O
ATOM 8047 CB ALA B 407 11.806 26.859 -77.205 1.00112.88 C
ATOM 8048 N ILE B 408 14.337 28.546 -76.354 1.00109.06 N
ATOM 8049 CA ILE B 408 15.179 29.726 -76.542 1.00109.06 C
ATOM 8050 C ILE B 408 16.635 29.325 -76.721 1.00109.06 C
ATOM 8051 O ILE B 408 17.312 29.793 -77.648 1.00109.06 O
ATOM 8052 CB ILE B 408 14.998 30.705 -75.368 1.00109.06 C
ATOM 8053 CG1 ILE B 408 13.586 31.282 -75.373 1.00109.06 C
ATOM 8054 CG2 ILE B 408 16.000 31.836 -75.447 1.00109.06 C
ATOM 8055 CD1 ILE B 408 13.236 32.062 -74.133 1.00109.06 C
ATOM 8056 N SER B 409 17.123 28.417 -75.872 1.00107.06 N
ATOM 8057 CA SER B 409 18.513 27.996 -75.953 1.00107.06 C
ATOM 8058 C SER B 409 18.779 27.193 -77.214 1.00107.06 C
ATOM 8059 O SER B 409 19.849 27.320 -77.815 1.00107.06 O
ATOM 8060 CB SER B 409 18.874 27.176 -74.724 1.00107.06 C
ATOM 8061 OG SER B 409 18.113 25.988 -74.688 1.00107.06 O
ATOM 8062 N PHE B 410 17.807 26.392 -77.653 1.00109.65 N
ATOM 8063 CA PHE B 410 17.999 25.612 -78.867 1.00109.65 C
ATOM 8064 C PHE B 410 18.017 26.502 -80.100 1.00109.65 C
ATOM 8065 O PHE B 410 18.835 26.296 -81.007 1.00109.65 O
ATOM 8066 CB PHE B 410 16.911 24.552 -78.978 1.00109.65 C
ATOM 8067 CG PHE B 410 17.020 23.713 -80.204 1.00109.65 C
ATOM 8068 CD1 PHE B 410 18.042 22.789 -80.332 1.00109.65 C
ATOM 8069 CD2 PHE B 410 16.094 23.833 -81.223 1.00109.65 C
ATOM 8070 CE1 PHE B 410 18.146 22.008 -81.463 1.00109.65 C
ATOM 8071 CE2 PHE B 410 16.187 23.053 -82.356 1.00109.65 C
ATOM 8072 CZ PHE B 410 17.217 22.140 -82.477 1.00109.65 C
ATOM 8073 N ALA B 411 17.152 27.522 -80.133 1.00109.54 N
ATOM 8074 CA ALA B 411 17.164 28.466 -81.245 1.00109.54 C
ATOM 8075 C ALA B 411 18.450 29.278 -81.263 1.00109.54 C
ATOM 8076 O ALA B 411 19.022 29.527 -82.334 1.00109.54 O
ATOM 8077 CB ALA B 411 15.951 29.386 -81.161 1.00109.54 C
ATOM 8078 N LEU B 412 18.939 29.668 -80.085 1.00105.13 N
ATOM 8079 CA LEU B 412 20.156 30.464 -80.026 1.00105.13 C
ATOM 8080 C LEU B 412 21.377 29.638 -80.410 1.00105.13 C
ATOM 8081 O LEU B 412 22.291 30.138 -81.079 1.00105.13 O
ATOM 8082 CB LEU B 412 20.314 31.052 -78.631 1.00105.13 C
ATOM 8083 CG LEU B 412 21.442 32.062 -78.495 1.00105.13 C
ATOM 8084 CD1 LEU B 412 21.130 33.244 -79.376 1.00105.13 C
ATOM 8085 CD2 LEU B 412 21.582 32.478 -77.052 1.00105.13 C
ATOM 8086 N TYR B 413 21.396 28.360 -80.023 1.00108.06 N
ATOM 8087 CA TYR B 413 22.489 27.488 -80.434 1.00108.06 C
ATOM 8088 C TYR B 413 22.441 27.214 -81.926 1.00108.06 C
ATOM 8089 O TYR B 413 23.490 27.122 -82.573 1.00108.06 O
ATOM 8090 CB TYR B 413 22.455 26.178 -79.657 1.00108.06 C
ATOM 8091 CG TYR B 413 23.517 25.221 -80.118 1.00108.06 C
ATOM 8092 CD1 TYR B 413 24.854 25.483 -79.876 1.00108.06 C
ATOM 8093 CD2 TYR B 413 23.185 24.057 -80.793 1.00108.06 C
ATOM 8094 CE1 TYR B 413 25.837 24.619 -80.297 1.00108.06 C
ATOM 8095 CE2 TYR B 413 24.163 23.181 -81.219 1.00108.06 C
ATOM 8096 CZ TYR B 413 25.490 23.469 -80.967 1.00108.06 C
ATOM 8097 OH TYR B 413 26.479 22.606 -81.384 1.00108.06 O
ATOM 8098 N LYS B 414 21.233 27.089 -82.488 1.00110.58 N
ATOM 8099 CA LYS B 414 21.086 26.942 -83.933 1.00110.58 C
ATOM 8100 C LYS B 414 21.634 28.155 -84.671 1.00110.58 C
ATOM 8101 O LYS B 414 22.346 28.010 -85.670 1.00110.58 O
ATOM 8102 CB LYS B 414 19.618 26.728 -84.294 1.00110.58 C
ATOM 8103 CG LYS B 414 19.159 25.290 -84.203 1.00110.58 C
ATOM 8104 CD LYS B 414 17.780 25.130 -84.811 1.00110.58 C
ATOM 8105 N ALA B 415 21.336 29.353 -84.170 1.00112.16 N
ATOM 8106 CA ALA B 415 21.833 30.588 -84.765 1.00112.16 C
ATOM 8107 C ALA B 415 23.351 30.692 -84.686 1.00112.16 C
ATOM 8108 O ALA B 415 24.008 31.032 -85.679 1.00112.16 O
ATOM 8109 CB ALA B 415 21.194 31.796 -84.088 1.00112.16 C
ATOM 8110 N PHE B 416 23.918 30.390 -83.519 1.00112.60 N
ATOM 8111 CA PHE B 416 25.361 30.515 -83.360 1.00112.60 C
ATOM 8112 C PHE B 416 26.114 29.424 -84.110 1.00112.60 C
ATOM 8113 O PHE B 416 27.262 29.616 -84.522 1.00112.60 O
ATOM 8114 CB PHE B 416 25.730 30.512 -81.878 1.00112.60 C
ATOM 8115 CG PHE B 416 27.191 30.713 -81.626 1.00112.60 C
ATOM 8116 CD1 PHE B 416 27.787 31.929 -81.909 1.00112.60 C
ATOM 8117 CD2 PHE B 416 27.964 29.698 -81.095 1.00112.60 C
ATOM 8118 CE1 PHE B 416 29.133 32.124 -81.683 1.00112.60 C
ATOM 8119 CE2 PHE B 416 29.309 29.889 -80.860 1.00112.60 C
ATOM 8120 CZ PHE B 416 29.893 31.105 -81.155 1.00112.60 C
ATOM 8121 N SER B 417 25.476 28.272 -84.314 1.00118.39 N
ATOM 8122 CA SER B 417 26.108 27.228 -85.111 1.00118.39 C
ATOM 8123 C SER B 417 26.035 27.553 -86.596 1.00118.39 C
ATOM 8124 O SER B 417 26.985 27.289 -87.342 1.00118.39 O
ATOM 8125 CB SER B 417 25.455 25.882 -84.817 1.00118.39 C
ATOM 8126 OG SER B 417 25.666 25.507 -83.468 1.00118.39 O
ATOM 8127 N THR B 418 24.917 28.131 -87.044 1.00128.95 N
ATOM 8128 CA THR B 418 24.785 28.495 -88.451 1.00128.95 C
ATOM 8129 C THR B 418 25.632 29.713 -88.795 1.00128.95 C
ATOM 8130 O THR B 418 25.896 29.973 -89.974 1.00128.95 O
ATOM 8131 CB THR B 418 23.319 28.755 -88.793 1.00128.95 C
ATOM 8132 N ASN B 419 26.024 30.496 -87.784 1.00131.70 N
ATOM 8133 CA ASN B 419 27.001 31.560 -88.002 1.00131.70 C
ATOM 8134 C ASN B 419 28.329 30.994 -88.490 1.00131.70 C
ATOM 8135 O ASN B 419 28.922 31.511 -89.444 1.00131.70 O
ATOM 8136 CB ASN B 419 27.201 32.366 -86.719 1.00131.70 C
ATOM 8137 CG ASN B 419 26.062 33.323 -86.451 1.00131.70 C
ATOM 8138 OD1 ASN B 419 25.600 34.016 -87.355 1.00131.70 O
ATOM 8139 ND2 ASN B 419 25.595 33.359 -85.211 1.00131.70 N
ATOM 8140 N GLU B 420 28.823 29.948 -87.822 1.00135.64 N
ATOM 8141 CA GLU B 420 29.983 29.131 -88.190 1.00135.64 C
ATOM 8142 C GLU B 420 31.297 29.899 -88.274 1.00135.64 C
ATOM 8143 O GLU B 420 32.289 29.351 -88.773 1.00135.64 O
ATOM 8144 CB GLU B 420 29.756 28.386 -89.511 1.00135.64 C
ATOM 8145 N HIS B 421 31.343 31.153 -87.813 1.00140.99 N
ATOM 8146 CA HIS B 421 32.621 31.846 -87.702 1.00140.99 C
ATOM 8147 C HIS B 421 33.445 31.260 -86.566 1.00140.99 C
ATOM 8148 O HIS B 421 34.680 31.234 -86.624 1.00140.99 O
ATOM 8149 CB HIS B 421 32.390 33.343 -87.493 1.00140.99 C
ATOM 8150 N ASP B 422 32.772 30.784 -85.524 1.00140.01 N
ATOM 8151 CA ASP B 422 33.390 30.016 -84.457 1.00140.01 C
ATOM 8152 C ASP B 422 33.120 28.523 -84.585 1.00140.01 C
ATOM 8153 O ASP B 422 32.858 27.868 -83.571 1.00140.01 O
ATOM 8154 CB ASP B 422 32.897 30.519 -83.096 1.00140.01 C
ATOM 8155 N ARG B 423 33.141 27.982 -85.806 1.00140.28 N
ATOM 8156 CA ARG B 423 32.913 26.553 -85.998 1.00140.28 C
ATOM 8157 C ARG B 423 34.057 25.728 -85.415 1.00140.28 C
ATOM 8158 O ARG B 423 33.829 24.702 -84.762 1.00140.28 O
ATOM 8159 CB ARG B 423 32.729 26.249 -87.485 1.00140.28 C
ATOM 8160 N ASP B 424 35.299 26.163 -85.641 1.00130.40 N
ATOM 8161 CA ASP B 424 36.433 25.509 -84.993 1.00130.40 C
ATOM 8162 C ASP B 424 36.465 25.827 -83.504 1.00130.40 C
ATOM 8163 O ASP B 424 36.938 25.016 -82.700 1.00130.40 O
ATOM 8164 CB ASP B 424 37.738 25.934 -85.663 1.00130.40 C
ATOM 8165 N ASN B 425 35.958 26.999 -83.121 1.00122.84 N
ATOM 8166 CA ASN B 425 35.894 27.407 -81.719 1.00122.84 C
ATOM 8167 C ASN B 425 34.663 26.773 -81.081 1.00122.84 C
ATOM 8168 O ASN B 425 33.636 27.411 -80.838 1.00122.84 O
ATOM 8169 CB ASN B 425 35.873 28.924 -81.598 1.00122.84 C
ATOM 8170 N TRP B 426 34.795 25.486 -80.766 1.00117.08 N
ATOM 8171 CA TRP B 426 33.762 24.726 -80.076 1.00117.08 C
ATOM 8172 C TRP B 426 33.659 25.143 -78.617 1.00117.08 C
ATOM 8173 O TRP B 426 32.678 24.828 -77.940 1.00117.08 O
ATOM 8174 CB TRP B 426 34.069 23.232 -80.174 1.00117.08 C
ATOM 8175 CG TRP B 426 35.414 22.876 -79.608 1.00117.08 C
ATOM 8176 CD1 TRP B 426 36.606 22.885 -80.270 1.00117.08 C
ATOM 8177 CD2 TRP B 426 35.705 22.457 -78.270 1.00117.08 C
ATOM 8178 NE1 TRP B 426 37.619 22.503 -79.429 1.00117.08 N
ATOM 8179 CE2 TRP B 426 37.092 22.232 -78.194 1.00117.08 C
ATOM 8180 CE3 TRP B 426 34.927 22.250 -77.128 1.00117.08 C
ATOM 8181 CZ2 TRP B 426 37.717 21.810 -77.023 1.00117.08 C
ATOM 8182 CZ3 TRP B 426 35.549 21.832 -75.968 1.00117.08 C
ATOM 8183 CH2 TRP B 426 36.930 21.616 -75.925 1.00117.08 C
ATOM 8184 N ASN B 427 34.676 25.856 -78.140 1.00106.48 N
ATOM 8185 CA ASN B 427 34.770 26.353 -76.780 1.00106.48 C
ATOM 8186 C ASN B 427 33.633 27.294 -76.414 1.00106.48 C
ATOM 8187 O ASN B 427 33.178 27.285 -75.267 1.00106.48 O
ATOM 8188 CB ASN B 427 36.110 27.078 -76.608 1.00106.48 C
ATOM 8189 CG ASN B 427 36.499 27.268 -75.164 1.00106.48 C
ATOM 8190 OD1 ASN B 427 35.814 26.815 -74.251 1.00106.48 O
ATOM 8191 ND2 ASN B 427 37.611 27.953 -74.947 1.00106.48 N
ATOM 8192 N GLY B 428 33.140 28.082 -77.367 1.00103.21 N
ATOM 8193 CA GLY B 428 32.037 28.979 -77.067 1.00103.21 C
ATOM 8194 C GLY B 428 30.710 28.256 -76.954 1.00103.21 C
ATOM 8195 O GLY B 428 29.840 28.660 -76.175 1.00103.21 O
ATOM 8196 N GLN B 429 30.533 27.179 -77.728 1.00104.18 N
ATOM 8197 CA GLN B 429 29.283 26.428 -77.684 1.00104.18 C
ATOM 8198 C GLN B 429 29.118 25.716 -76.351 1.00104.18 C
ATOM 8199 O GLN B 429 27.994 25.528 -75.872 1.00104.18 O
ATOM 8200 CB GLN B 429 29.228 25.417 -78.827 1.00104.18 C
ATOM 8201 CG GLN B 429 29.215 26.032 -80.209 1.00104.18 C
ATOM 8202 CD GLN B 429 29.094 24.989 -81.305 1.00104.18 C
ATOM 8203 OE1 GLN B 429 29.020 23.795 -81.033 1.00104.18 O
ATOM 8204 NE2 GLN B 429 29.080 25.439 -82.552 1.00104.18 N
ATOM 8205 N LEU B 430 30.232 25.339 -75.722 1.00 98.26 N
ATOM 8206 CA LEU B 430 30.151 24.678 -74.428 1.00 98.26 C
ATOM 8207 C LEU B 430 29.736 25.658 -73.344 1.00 98.26 C
ATOM 8208 O LEU B 430 28.920 25.326 -72.480 1.00 98.26 O
ATOM 8209 CB LEU B 430 31.485 24.026 -74.086 1.00 98.26 C
ATOM 8210 CG LEU B 430 31.431 23.090 -72.889 1.00 98.26 C
ATOM 8211 CD1 LEU B 430 30.491 21.952 -73.204 1.00 98.26 C
ATOM 8212 CD2 LEU B 430 32.810 22.564 -72.608 1.00 98.26 C
ATOM 8213 N LYS B 431 30.254 26.887 -73.395 1.00 93.07 N
ATOM 8214 CA LYS B 431 29.801 27.911 -72.459 1.00 93.07 C
ATOM 8215 C LYS B 431 28.354 28.300 -72.730 1.00 93.07 C
ATOM 8216 O LYS B 431 27.604 28.624 -71.801 1.00 93.07 O
ATOM 8217 CB LYS B 431 30.707 29.135 -72.539 1.00 93.07 C
ATOM 8218 CG LYS B 431 32.101 28.894 -72.008 1.00 93.07 C
ATOM 8219 CD LYS B 431 32.921 30.162 -72.048 1.00 93.07 C
ATOM 8220 CE LYS B 431 34.325 29.928 -71.542 1.00 93.07 C
ATOM 8221 NZ LYS B 431 35.124 31.177 -71.608 1.00 93.07 N
ATOM 8222 N LEU B 432 27.945 28.254 -74.000 1.00 92.87 N
ATOM 8223 CA LEU B 432 26.564 28.557 -74.351 1.00 92.87 C
ATOM 8224 C LEU B 432 25.608 27.510 -73.795 1.00 92.87 C
ATOM 8225 O LEU B 432 24.553 27.850 -73.251 1.00 92.87 O
ATOM 8226 CB LEU B 432 26.430 28.656 -75.864 1.00 92.87 C
ATOM 8227 CG LEU B 432 25.047 29.078 -76.332 1.00 92.87 C
ATOM 8228 CD1 LEU B 432 24.740 30.457 -75.806 1.00 92.87 C
ATOM 8229 CD2 LEU B 432 24.995 29.057 -77.840 1.00 92.87 C
ATOM 8230 N LEU B 433 25.975 26.231 -73.895 1.00 91.27 N
ATOM 8231 CA LEU B 433 25.160 25.173 -73.305 1.00 91.27 C
ATOM 8232 C LEU B 433 25.429 25.031 -71.813 1.00 91.27 C
ATOM 8233 O LEU B 433 24.838 24.175 -71.147 1.00 91.27 O
ATOM 8234 CB LEU B 433 25.419 23.855 -74.024 1.00 91.27 C
ATOM 8235 CG LEU B 433 24.876 23.814 -75.443 1.00 91.27 C
ATOM 8236 CD1 LEU B 433 25.396 22.607 -76.184 1.00 91.27 C
ATOM 8237 CD2 LEU B 433 23.366 23.788 -75.376 1.00 91.27 C
ATOM 8238 N LEU B 434 26.361 25.818 -71.285 1.00 84.15 N
ATOM 8239 CA LEU B 434 26.528 25.891 -69.841 1.00 84.15 C
ATOM 8240 C LEU B 434 25.621 26.951 -69.230 1.00 84.15 C
ATOM 8241 O LEU B 434 25.108 26.767 -68.119 1.00 84.15 O
ATOM 8242 CB LEU B 434 27.989 26.164 -69.510 1.00 84.15 C
ATOM 8243 CG LEU B 434 28.346 26.401 -68.046 1.00 84.15 C
ATOM 8244 CD1 LEU B 434 27.977 25.216 -67.192 1.00 84.15 C
ATOM 8245 CD2 LEU B 434 29.824 26.686 -67.927 1.00 84.15 C
ATOM 8246 N GLU B 435 25.406 28.064 -69.938 1.00 95.18 N
ATOM 8247 CA GLU B 435 24.578 29.138 -69.392 1.00 95.18 C
ATOM 8248 C GLU B 435 23.125 28.712 -69.261 1.00 95.18 C
ATOM 8249 O GLU B 435 22.515 28.883 -68.201 1.00 95.18 O
ATOM 8250 CB GLU B 435 24.686 30.390 -70.257 1.00 95.18 C
ATOM 8251 CG GLU B 435 26.016 31.091 -70.141 1.00 95.18 C
ATOM 8252 CD GLU B 435 26.211 31.708 -68.777 1.00 95.18 C
ATOM 8253 OE1 GLU B 435 25.207 32.149 -68.176 1.00 95.18 O
ATOM 8254 OE2 GLU B 435 27.364 31.746 -68.301 1.00 95.18 O
ATOM 8255 N TRP B 436 22.560 28.146 -70.314 1.00 88.30 N
ATOM 8256 CA TRP B 436 21.270 27.484 -70.236 1.00 88.30 C
ATOM 8257 C TRP B 436 21.512 26.002 -70.017 1.00 88.30 C
ATOM 8258 O TRP B 436 22.295 25.388 -70.744 1.00 88.30 O
ATOM 8259 CB TRP B 436 20.460 27.717 -71.505 1.00 88.30 C
ATOM 8260 CG TRP B 436 20.011 29.121 -71.662 1.00 88.30 C
ATOM 8261 CD1 TRP B 436 18.818 29.647 -71.276 1.00 88.30 C
ATOM 8262 CD2 TRP B 436 20.762 30.192 -72.217 1.00 88.30 C
ATOM 8263 NE1 TRP B 436 18.773 30.984 -71.572 1.00 88.30 N
ATOM 8264 CE2 TRP B 436 19.959 31.341 -72.151 1.00 88.30 C
ATOM 8265 CE3 TRP B 436 22.036 30.292 -72.770 1.00 88.30 C
ATOM 8266 CZ2 TRP B 436 20.388 32.571 -72.616 1.00 88.30 C
ATOM 8267 CZ3 TRP B 436 22.460 31.513 -73.229 1.00 88.30 C
ATOM 8268 CH2 TRP B 436 21.641 32.637 -73.152 1.00 88.30 C
ATOM 8269 N ASN B 437 20.850 25.433 -69.019 1.00 89.08 N
ATOM 8270 CA ASN B 437 21.115 24.056 -68.611 1.00 89.08 C
ATOM 8271 C ASN B 437 20.505 23.114 -69.640 1.00 89.08 C
ATOM 8272 O ASN B 437 19.292 22.906 -69.668 1.00 89.08 O
ATOM 8273 CB ASN B 437 20.553 23.802 -67.218 1.00 89.08 C
ATOM 8274 CG ASN B 437 21.044 22.502 -66.609 1.00 89.08 C
ATOM 8275 OD1 ASN B 437 21.806 21.758 -67.220 1.00 89.08 O
ATOM 8276 ND2 ASN B 437 20.604 22.228 -65.389 1.00 89.08 N
ATOM 8277 N GLN B 438 21.350 22.546 -70.501 1.00 99.66 N
ATOM 8278 CA GLN B 438 20.959 21.470 -71.412 1.00 99.66 C
ATOM 8279 C GLN B 438 22.056 20.407 -71.411 1.00 99.66 C
ATOM 8280 O GLN B 438 23.131 20.596 -71.980 1.00 99.66 O
ATOM 8281 CB GLN B 438 20.694 21.979 -72.818 1.00 99.66 C
ATOM 8282 CG GLN B 438 19.414 22.736 -72.976 1.00 99.66 C
ATOM 8283 CD GLN B 438 19.153 23.060 -74.416 1.00 99.66 C
ATOM 8284 OE1 GLN B 438 19.989 22.804 -75.276 1.00 99.66 O
ATOM 8285 NE2 GLN B 438 17.979 23.603 -74.697 1.00 99.66 N
ATOM 8286 N LEU B 439 21.777 19.282 -70.757 1.00100.24 N
ATOM 8287 CA LEU B 439 22.767 18.216 -70.692 1.00100.24 C
ATOM 8288 C LEU B 439 22.820 17.421 -71.987 1.00100.24 C
ATOM 8289 O LEU B 439 23.901 17.223 -72.554 1.00100.24 O
ATOM 8290 CB LEU B 439 22.468 17.286 -69.522 1.00100.24 C
ATOM 8291 CG LEU B 439 23.464 16.137 -69.403 1.00100.24 C
ATOM 8292 CD1 LEU B 439 24.849 16.667 -69.098 1.00100.24 C
ATOM 8293 CD2 LEU B 439 23.019 15.135 -68.356 1.00100.24 C
ATOM 8294 N ASP B 440 21.659 16.958 -72.466 1.00101.82 N
ATOM 8295 CA ASP B 440 21.619 15.909 -73.483 1.00101.82 C
ATOM 8296 C ASP B 440 22.106 16.409 -74.834 1.00101.82 C
ATOM 8297 O ASP B 440 22.845 15.705 -75.534 1.00101.82 O
ATOM 8298 CB ASP B 440 20.203 15.351 -73.602 1.00101.82 C
ATOM 8299 N LEU B 441 21.708 17.624 -75.214 1.00100.13 N
ATOM 8300 CA LEU B 441 22.182 18.201 -76.465 1.00100.13 C
ATOM 8301 C LEU B 441 23.678 18.479 -76.415 1.00100.13 C
ATOM 8302 O LEU B 441 24.371 18.325 -77.428 1.00100.13 O
ATOM 8303 CB LEU B 441 21.397 19.473 -76.774 1.00100.13 C
ATOM 8304 CG LEU B 441 21.695 20.181 -78.092 1.00100.13 C
ATOM 8305 CD1 LEU B 441 21.431 19.252 -79.252 1.00100.13 C
ATOM 8306 CD2 LEU B 441 20.840 21.423 -78.216 1.00100.13 C
ATOM 8307 N ALA B 442 24.196 18.836 -75.239 1.00 99.43 N
ATOM 8308 CA ALA B 442 25.628 19.049 -75.083 1.00 99.43 C
ATOM 8309 C ALA B 442 26.412 17.751 -75.167 1.00 99.43 C
ATOM 8310 O ALA B 442 27.515 17.734 -75.723 1.00 99.43 O
ATOM 8311 CB ALA B 442 25.914 19.737 -73.752 1.00 99.43 C
ATOM 8312 N SER B 443 25.868 16.662 -74.626 1.00107.58 N
ATOM 8313 CA SER B 443 26.563 15.384 -74.708 1.00107.58 C
ATOM 8314 C SER B 443 26.498 14.805 -76.112 1.00107.58 C
ATOM 8315 O SER B 443 27.456 14.165 -76.559 1.00107.58 O
ATOM 8316 CB SER B 443 25.973 14.393 -73.709 1.00107.58 C
ATOM 8317 OG SER B 443 24.645 14.053 -74.065 1.00107.58 O
ATOM 8318 N ASP B 444 25.392 15.022 -76.820 1.00106.63 N
ATOM 8319 CA ASP B 444 25.255 14.478 -78.164 1.00106.63 C
ATOM 8320 C ASP B 444 26.040 15.274 -79.198 1.00106.63 C
ATOM 8321 O ASP B 444 26.681 14.682 -80.073 1.00106.63 O
ATOM 8322 CB ASP B 444 23.778 14.420 -78.559 1.00106.63 C
ATOM 8323 N GLU B 445 26.019 16.604 -79.119 1.00102.00 N
ATOM 8324 CA GLU B 445 26.631 17.415 -80.162 1.00102.00 C
ATOM 8325 C GLU B 445 28.148 17.489 -80.041 1.00102.00 C
ATOM 8326 O GLU B 445 28.866 17.075 -80.956 1.00102.00 O
ATOM 8327 CB GLU B 445 26.039 18.825 -80.145 1.00102.00 C
ATOM 8328 N ILE B 446 28.648 18.008 -78.919 1.00101.59 N
ATOM 8329 CA ILE B 446 30.058 18.383 -78.842 1.00101.59 C
ATOM 8330 C ILE B 446 30.938 17.163 -78.606 1.00101.59 C
ATOM 8331 O ILE B 446 31.981 16.998 -79.250 1.00101.59 O
ATOM 8332 CB ILE B 446 30.268 19.440 -77.746 1.00101.59 C
ATOM 8333 CG1 ILE B 446 29.412 20.668 -78.017 1.00101.59 C
ATOM 8334 CG2 ILE B 446 31.713 19.865 -77.687 1.00101.59 C
ATOM 8335 CD1 ILE B 446 29.412 21.654 -76.872 1.00101.59 C
ATOM 8336 N PHE B 447 30.533 16.319 -77.665 1.00103.32 N
ATOM 8337 CA PHE B 447 31.332 15.153 -77.303 1.00103.32 C
ATOM 8338 C PHE B 447 31.225 13.917 -78.196 1.00103.32 C
ATOM 8339 O PHE B 447 30.883 12.831 -77.730 1.00103.32 O
ATOM 8340 CB PHE B 447 31.112 14.788 -75.833 1.00103.32 C
ATOM 8341 CG PHE B 447 31.652 15.810 -74.876 1.00103.32 C
ATOM 8342 CD1 PHE B 447 33.014 15.923 -74.661 1.00103.32 C
ATOM 8343 CD2 PHE B 447 30.802 16.666 -74.200 1.00103.32 C
ATOM 8344 CE1 PHE B 447 33.521 16.865 -73.790 1.00103.32 C
ATOM 8345 CE2 PHE B 447 31.300 17.611 -73.324 1.00103.32 C
ATOM 8346 CZ PHE B 447 32.662 17.711 -73.119 1.00103.32 C
ATOM 8347 N THR B 448 31.523 14.092 -79.480 1.00113.84 N
ATOM 8348 CA THR B 448 31.530 12.979 -80.419 1.00113.84 C
ATOM 8349 C THR B 448 32.933 12.402 -80.306 1.00113.84 C
ATOM 8350 O THR B 448 33.896 13.156 -80.144 1.00113.84 O
ATOM 8351 CB THR B 448 31.283 13.444 -81.861 1.00113.84 C
ATOM 8352 OG1 THR B 448 32.434 14.148 -82.342 1.00113.84 O
ATOM 8353 CG2 THR B 448 30.066 14.356 -81.923 1.00113.84 C
ATOM 8354 N ASN B 449 33.077 11.083 -80.393 1.00113.05 N
ATOM 8355 CA ASN B 449 34.412 10.509 -80.229 1.00113.05 C
ATOM 8356 C ASN B 449 35.411 11.032 -81.259 1.00113.05 C
ATOM 8357 O ASN B 449 36.582 10.634 -81.238 1.00113.05 O
ATOM 8358 CB ASN B 449 34.334 8.984 -80.302 1.00113.05 C
ATOM 8359 N ASP B 450 34.978 11.913 -82.164 1.00121.84 N
ATOM 8360 CA ASP B 450 35.884 12.443 -83.175 1.00121.84 C
ATOM 8361 C ASP B 450 36.907 13.398 -82.571 1.00121.84 C
ATOM 8362 O ASP B 450 38.111 13.123 -82.599 1.00121.84 O
ATOM 8363 CB ASP B 450 35.082 13.140 -84.274 1.00121.84 C
ATOM 8364 N ARG B 451 36.427 14.501 -82.002 1.00126.81 N
ATOM 8365 CA ARG B 451 37.295 15.521 -81.407 1.00126.81 C
ATOM 8366 C ARG B 451 38.167 15.038 -80.243 1.00126.81 C
ATOM 8367 O ARG B 451 37.848 14.061 -79.567 1.00126.81 O
ATOM 8368 CB ARG B 451 36.465 16.730 -80.968 1.00126.81 C
ATOM 8369 N ASN B 452 39.269 15.752 -80.019 1.00125.66 N
ATOM 8370 CA ASN B 452 40.210 15.435 -78.947 1.00125.66 C
ATOM 8371 C ASN B 452 40.314 16.568 -77.931 1.00125.66 C
ATOM 8372 O ASN B 452 40.453 17.734 -78.301 1.00125.66 O
ATOM 8373 CB ASN B 452 41.590 15.112 -79.521 1.00125.66 C
ATOM 8374 CG ASN B 452 41.600 13.829 -80.326 1.00125.66 C
ATOM 8375 OD1 ASN B 452 40.676 13.021 -80.239 1.00125.66 O
ATOM 8376 ND2 ASN B 452 42.650 13.634 -81.114 1.00125.66 N
ATOM 8377 N TRP B 453 40.243 16.219 -76.651 1.00122.59 N
ATOM 8378 CA TRP B 453 40.301 17.209 -75.577 1.00122.59 C
ATOM 8379 C TRP B 453 41.256 16.832 -74.443 1.00122.59 C
ATOM 8380 O TRP B 453 41.442 15.656 -74.138 1.00122.59 O
ATOM 8381 CB TRP B 453 38.894 17.442 -75.020 1.00122.59 C
ATOM 8382 CG TRP B 453 37.950 16.330 -75.358 1.00122.59 C
ATOM 8383 CD1 TRP B 453 37.988 15.053 -74.882 1.00122.59 C
ATOM 8384 CD2 TRP B 453 36.846 16.387 -76.266 1.00122.59 C
ATOM 8385 NE1 TRP B 453 36.969 14.313 -75.432 1.00122.59 N
ATOM 8386 CE2 TRP B 453 36.252 15.111 -76.284 1.00122.59 C
ATOM 8387 CE3 TRP B 453 36.296 17.397 -77.063 1.00122.59 C
ATOM 8388 CZ2 TRP B 453 35.139 14.815 -77.068 1.00122.59 C
ATOM 8389 CZ3 TRP B 453 35.190 17.102 -77.839 1.00122.59 C
ATOM 8390 CH2 TRP B 453 34.623 15.823 -77.835 1.00122.59 C
ATOM 8391 N GLU B 454 41.855 17.847 -73.825 1.00113.33 N
ATOM 8392 CA GLU B 454 42.777 17.648 -72.710 1.00113.33 C
ATOM 8393 C GLU B 454 42.155 18.223 -71.441 1.00113.33 C
ATOM 8394 O GLU B 454 41.002 18.650 -71.459 1.00113.33 O
ATOM 8395 CB GLU B 454 44.120 18.320 -72.994 1.00113.33 C
ATOM 8396 N SER B 455 42.905 18.241 -70.343 1.00107.50 N
ATOM 8397 CA SER B 455 42.360 18.775 -69.098 1.00107.50 C
ATOM 8398 C SER B 455 42.416 20.298 -69.078 1.00107.50 C
ATOM 8399 O SER B 455 41.460 20.955 -68.640 1.00107.50 O
ATOM 8400 CB SER B 455 43.122 18.200 -67.906 1.00107.50 C
ATOM 8401 N ALA B 456 43.518 20.871 -69.577 1.00104.56 N
ATOM 8402 CA ALA B 456 43.700 22.321 -69.581 1.00104.56 C
ATOM 8403 C ALA B 456 42.708 23.008 -70.508 1.00104.56 C
ATOM 8404 O ALA B 456 42.426 24.202 -70.355 1.00104.56 O
ATOM 8405 CB ALA B 456 45.132 22.665 -69.986 1.00104.56 C
ATOM 8406 N ASP B 457 42.187 22.276 -71.491 1.00104.56 N
ATOM 8407 CA ASP B 457 41.055 22.773 -72.255 1.00104.56 C
ATOM 8408 C ASP B 457 39.816 22.901 -71.378 1.00104.56 C
ATOM 8409 O ASP B 457 39.030 23.840 -71.536 1.00104.56 O
ATOM 8410 CB ASP B 457 40.782 21.848 -73.439 1.00104.56 C
ATOM 8411 N LEU B 458 39.559 21.933 -70.506 1.00 95.90 N
ATOM 8412 CA LEU B 458 38.313 21.962 -69.724 1.00 95.90 C
ATOM 8413 C LEU B 458 38.312 22.679 -68.379 1.00 95.90 C
ATOM 8414 O LEU B 458 37.257 22.914 -67.798 1.00 95.90 O
ATOM 8415 CB LEU B 458 37.792 20.536 -69.525 1.00 95.90 C
ATOM 8416 CG LEU B 458 37.321 19.825 -70.791 1.00 95.90 C
ATOM 8417 CD1 LEU B 458 36.824 18.427 -70.463 1.00 95.90 C
ATOM 8418 CD2 LEU B 458 36.231 20.635 -71.472 1.00 95.90 C
ATOM 8419 N GLN B 459 39.487 23.043 -67.900 1.00 90.48 N
ATOM 8420 CA GLN B 459 39.635 23.688 -66.587 1.00 90.48 C
ATOM 8421 C GLN B 459 38.758 24.913 -66.323 1.00 90.48 C
ATOM 8422 O GLN B 459 38.036 24.970 -65.315 1.00 90.48 O
ATOM 8423 CB GLN B 459 41.100 24.082 -66.388 1.00 30.00 C
ATOM 8424 CG GLN B 459 42.057 22.905 -66.319 1.00 30.00 C
ATOM 8425 CD GLN B 459 43.504 23.334 -66.195 1.00 30.00 C
ATOM 8426 OE1 GLN B 459 43.868 24.438 -66.603 1.00 30.00 O
ATOM 8427 NE2 GLN B 459 44.335 22.464 -65.629 1.00 30.00 N
ATOM 8428 N ASP B 460 38.819 25.892 -67.224 1.00 81.09 N
ATOM 8429 CA ASP B 460 38.107 27.147 -67.014 1.00 81.09 C
ATOM 8430 C ASP B 460 36.602 26.961 -67.126 1.00 81.09 C
ATOM 8431 O ASP B 460 35.838 27.631 -66.426 1.00 81.09 O
ATOM 8432 CB ASP B 460 38.594 28.198 -68.009 1.00 81.09 C
ATOM 8433 N VAL B 461 36.164 26.049 -67.993 1.00 78.89 N
ATOM 8434 CA VAL B 461 34.746 25.730 -68.079 1.00 78.89 C
ATOM 8435 C VAL B 461 34.304 24.959 -66.843 1.00 78.89 C
ATOM 8436 O VAL B 461 33.180 25.120 -66.355 1.00 78.89 O
ATOM 8437 CB VAL B 461 34.481 24.941 -69.370 1.00 78.89 C
ATOM 8438 CG1 VAL B 461 33.013 24.646 -69.531 1.00 78.89 C
ATOM 8439 CG2 VAL B 461 35.011 25.708 -70.557 1.00 78.89 C
ATOM 8440 N MET B 462 35.196 24.125 -66.308 1.00 79.10 N
ATOM 8441 CA MET B 462 34.887 23.323 -65.131 1.00 79.10 C
ATOM 8442 C MET B 462 34.675 24.198 -63.909 1.00 79.10 C
ATOM 8443 O MET B 462 33.801 23.918 -63.077 1.00 79.10 O
ATOM 8444 CB MET B 462 36.024 22.343 -64.881 1.00 79.10 C
ATOM 8445 CG MET B 462 35.773 21.322 -63.810 1.00 79.10 C
ATOM 8446 SD MET B 462 34.529 20.138 -64.317 1.00 79.10 S
ATOM 8447 CE MET B 462 34.121 19.426 -62.737 1.00 79.10 C
ATOM 8448 N PHE B 463 35.470 25.263 -63.791 1.00 68.01 N
ATOM 8449 CA PHE B 463 35.371 26.140 -62.626 1.00 68.01 C
ATOM 8450 C PHE B 463 34.023 26.847 -62.560 1.00 68.01 C
ATOM 8451 O PHE B 463 33.392 26.900 -61.497 1.00 68.01 O
ATOM 8452 CB PHE B 463 36.498 27.166 -62.638 1.00 68.01 C
ATOM 8453 CG PHE B 463 36.440 28.115 -61.490 1.00 68.01 C
ATOM 8454 CD1 PHE B 463 36.788 27.700 -60.224 1.00 68.01 C
ATOM 8455 CD2 PHE B 463 36.035 29.422 -61.676 1.00 68.01 C
ATOM 8456 CE1 PHE B 463 36.732 28.572 -59.160 1.00 68.01 C
ATOM 8457 CE2 PHE B 463 35.975 30.297 -60.617 1.00 68.01 C
ATOM 8458 CZ PHE B 463 36.325 29.873 -59.359 1.00 68.01 C
ATOM 8459 N THR B 464 33.555 27.376 -63.689 1.00 68.50 N
ATOM 8460 CA THR B 464 32.283 28.088 -63.689 1.00 68.50 C
ATOM 8461 C THR B 464 31.116 27.132 -63.495 1.00 68.50 C
ATOM 8462 O THR B 464 30.071 27.521 -62.966 1.00 68.50 O
ATOM 8463 CB THR B 464 32.122 28.875 -64.982 1.00 68.50 C
ATOM 8464 OG1 THR B 464 32.190 27.977 -66.091 1.00 68.50 O
ATOM 8465 CG2 THR B 464 33.223 29.907 -65.112 1.00 68.50 C
ATOM 8466 N ALA B 465 31.277 25.874 -63.903 1.00 64.74 N
ATOM 8467 CA ALA B 465 30.237 24.888 -63.636 1.00 64.74 C
ATOM 8468 C ALA B 465 30.232 24.492 -62.169 1.00 64.74 C
ATOM 8469 O ALA B 465 29.206 24.067 -61.631 1.00 64.74 O
ATOM 8470 CB ALA B 465 30.429 23.664 -64.524 1.00 64.74 C
ATOM 8471 N LEU B 466 31.388 24.598 -61.513 1.00 61.78 N
ATOM 8472 CA LEU B 466 31.413 24.469 -60.060 1.00 61.78 C
ATOM 8473 C LEU B 466 30.782 25.672 -59.378 1.00 61.78 C
ATOM 8474 O LEU B 466 30.315 25.564 -58.239 1.00 61.78 O
ATOM 8475 CB LEU B 466 32.840 24.281 -59.553 1.00 61.78 C
ATOM 8476 CG LEU B 466 33.281 22.880 -59.164 1.00 61.78 C
ATOM 8477 CD1 LEU B 466 32.538 22.498 -57.915 1.00 61.78 C
ATOM 8478 CD2 LEU B 466 32.975 21.907 -60.256 1.00 61.78 C
ATOM 8479 N VAL B 467 30.797 26.836 -60.036 1.00 66.75 N
ATOM 8480 CA VAL B 467 30.305 28.053 -59.390 1.00 66.75 C
ATOM 8481 C VAL B 467 28.800 27.997 -59.173 1.00 66.75 C
ATOM 8482 O VAL B 467 28.322 28.145 -58.043 1.00 66.75 O
ATOM 8483 CB VAL B 467 30.708 29.301 -60.193 1.00 66.75 C
ATOM 8484 CG1 VAL B 467 29.956 30.511 -59.692 1.00 66.75 C
ATOM 8485 CG2 VAL B 467 32.186 29.556 -60.039 1.00 66.75 C
ATOM 8486 N LYS B 468 28.027 27.761 -60.226 1.00 68.74 N
ATOM 8487 CA LYS B 468 26.579 27.896 -60.133 1.00 68.74 C
ATOM 8488 C LYS B 468 25.861 26.589 -60.514 1.00 68.74 C
ATOM 8489 O LYS B 468 25.258 26.486 -61.582 1.00 68.74 O
ATOM 8490 CB LYS B 468 26.135 29.086 -60.990 1.00 68.74 C
ATOM 8491 CG LYS B 468 26.774 29.123 -62.380 1.00 68.74 C
ATOM 8492 CD LYS B 468 26.279 30.286 -63.196 1.00 68.74 C
ATOM 8493 CE LYS B 468 26.908 30.283 -64.576 1.00 68.74 C
ATOM 8494 NZ LYS B 468 26.421 31.420 -65.406 1.00 68.74 N
ATOM 8495 N ASP B 469 25.885 25.639 -59.563 1.00 66.85 N
ATOM 8496 CA ASP B 469 24.955 24.502 -59.399 1.00 66.85 C
ATOM 8497 C ASP B 469 24.567 23.783 -60.694 1.00 66.85 C
ATOM 8498 O ASP B 469 23.398 23.736 -61.071 1.00 66.85 O
ATOM 8499 CB ASP B 469 23.703 24.957 -58.651 1.00 66.85 C
ATOM 8500 N ARG B 470 25.546 23.218 -61.388 1.00 66.29 N
ATOM 8501 CA ARG B 470 25.286 22.464 -62.615 1.00 66.29 C
ATOM 8502 C ARG B 470 25.787 21.035 -62.454 1.00 66.29 C
ATOM 8503 O ARG B 470 26.800 20.651 -63.047 1.00 66.29 O
ATOM 8504 CB ARG B 470 25.932 23.147 -63.819 1.00 66.29 C
ATOM 8505 CG ARG B 470 25.311 24.481 -64.150 1.00 66.29 C
ATOM 8506 CD ARG B 470 23.908 24.307 -64.693 1.00 66.29 C
ATOM 8507 NE ARG B 470 23.324 25.576 -65.111 1.00 66.29 N
ATOM 8508 CZ ARG B 470 22.579 26.344 -64.327 1.00 66.29 C
ATOM 8509 NH1 ARG B 470 22.322 25.971 -63.083 1.00 66.29 N
ATOM 8510 NH2 ARG B 470 22.086 27.482 -64.786 1.00 66.29 N
ATOM 8511 N PRO B 471 25.070 20.208 -61.688 1.00 59.39 N
ATOM 8512 CA PRO B 471 25.648 18.923 -61.260 1.00 59.39 C
ATOM 8513 C PRO B 471 25.745 17.875 -62.358 1.00 59.39 C
ATOM 8514 O PRO B 471 26.750 17.152 -62.428 1.00 59.39 O
ATOM 8515 CB PRO B 471 24.699 18.489 -60.139 1.00 59.39 C
ATOM 8516 CG PRO B 471 23.405 19.116 -60.495 1.00 59.39 C
ATOM 8517 CD PRO B 471 23.718 20.417 -61.144 1.00 59.39 C
ATOM 8518 N LYS B 472 24.722 17.766 -63.212 1.00 64.17 N
ATOM 8519 CA LYS B 472 24.805 16.896 -64.379 1.00 64.17 C
ATOM 8520 C LYS B 472 25.926 17.342 -65.295 1.00 64.17 C
ATOM 8521 O LYS B 472 26.648 16.523 -65.885 1.00 64.17 O
ATOM 8522 CB LYS B 472 23.482 16.922 -65.132 1.00 64.17 C
ATOM 8523 CG LYS B 472 22.328 16.336 -64.373 1.00 64.17 C
ATOM 8524 CD LYS B 472 21.067 16.422 -65.198 1.00 64.17 C
ATOM 8525 CE LYS B 472 19.874 15.913 -64.421 1.00 64.17 C
ATOM 8526 NZ LYS B 472 18.612 16.028 -65.193 1.00 64.17 N
ATOM 8527 N PHE B 473 26.132 18.646 -65.361 1.00 70.36 N
ATOM 8528 CA PHE B 473 27.191 19.187 -66.174 1.00 70.36 C
ATOM 8529 C PHE B 473 28.533 19.106 -65.461 1.00 70.36 C
ATOM 8530 O PHE B 473 29.533 19.548 -66.014 1.00 70.36 O
ATOM 8531 CB PHE B 473 26.844 20.624 -66.537 1.00 70.36 C
ATOM 8532 CG PHE B 473 27.363 21.052 -67.866 1.00 70.36 C
ATOM 8533 CD1 PHE B 473 26.679 20.703 -69.017 1.00 70.36 C
ATOM 8534 CD2 PHE B 473 28.521 21.796 -67.976 1.00 70.36 C
ATOM 8535 CE1 PHE B 473 27.138 21.090 -70.245 1.00 70.36 C
ATOM 8536 CE2 PHE B 473 28.984 22.191 -69.211 1.00 70.36 C
ATOM 8537 CZ PHE B 473 28.294 21.834 -70.344 1.00 70.36 C
ATOM 8538 N VAL B 474 28.570 18.571 -64.238 1.00 62.84 N
ATOM 8539 CA VAL B 474 29.826 18.128 -63.648 1.00 62.84 C
ATOM 8540 C VAL B 474 30.063 16.649 -63.928 1.00 62.84 C
ATOM 8541 O VAL B 474 31.206 16.257 -64.201 1.00 62.84 O
ATOM 8542 CB VAL B 474 29.834 18.437 -62.141 1.00 62.84 C
ATOM 8543 CG1 VAL B 474 31.035 17.847 -61.442 1.00 62.84 C
ATOM 8544 CG2 VAL B 474 29.839 19.919 -61.928 1.00 62.84 C
ATOM 8545 N ARG B 475 28.998 15.826 -63.898 1.00 66.40 N
ATOM 8546 CA ARG B 475 29.100 14.410 -64.276 1.00 66.40 C
ATOM 8547 C ARG B 475 29.624 14.236 -65.692 1.00 66.40 C
ATOM 8548 O ARG B 475 30.363 13.281 -65.970 1.00 66.40 O
ATOM 8549 CB ARG B 475 27.740 13.724 -64.171 1.00 66.40 C
ATOM 8550 CG ARG B 475 27.246 13.543 -62.776 1.00 66.40 C
ATOM 8551 CD ARG B 475 27.951 12.406 -62.077 1.00 66.40 C
ATOM 8552 NE ARG B 475 27.500 11.117 -62.576 1.00 66.40 N
ATOM 8553 CZ ARG B 475 26.475 10.451 -62.060 1.00 66.40 C
ATOM 8554 NH1 ARG B 475 25.816 10.956 -61.028 1.00 66.40 N
ATOM 8555 NH2 ARG B 475 26.114 9.280 -62.563 1.00 66.40 N
ATOM 8556 N LEU B 476 29.244 15.152 -66.590 1.00 79.48 N
ATOM 8557 CA LEU B 476 29.679 15.061 -67.981 1.00 79.48 C
ATOM 8558 C LEU B 476 31.195 15.163 -68.117 1.00 79.48 C
ATOM 8559 O LEU B 476 31.807 14.387 -68.859 1.00 79.48 O
ATOM 8560 CB LEU B 476 29.011 16.142 -68.819 1.00 79.48 C
ATOM 8561 CG LEU B 476 29.341 16.027 -70.300 1.00 79.48 C
ATOM 8562 CD1 LEU B 476 28.798 14.717 -70.818 1.00 79.48 C
ATOM 8563 CD2 LEU B 476 28.782 17.187 -71.082 1.00 79.48 C
ATOM 8564 N PHE B 477 31.829 16.076 -67.379 1.00 82.08 N
ATOM 8565 CA PHE B 477 33.273 16.215 -67.535 1.00 82.08 C
ATOM 8566 C PHE B 477 34.039 15.085 -66.866 1.00 82.08 C
ATOM 8567 O PHE B 477 35.118 14.713 -67.341 1.00 82.08 O
ATOM 8568 CB PHE B 477 33.760 17.548 -66.994 1.00 82.08 C
ATOM 8569 CG PHE B 477 33.280 18.720 -67.771 1.00 82.08 C
ATOM 8570 CD1 PHE B 477 33.800 19.000 -69.021 1.00 82.08 C
ATOM 8571 CD2 PHE B 477 32.345 19.568 -67.239 1.00 82.08 C
ATOM 8572 CE1 PHE B 477 33.357 20.094 -69.738 1.00 82.08 C
ATOM 8573 CE2 PHE B 477 31.896 20.659 -67.945 1.00 82.08 C
ATOM 8574 CZ PHE B 477 32.401 20.926 -69.192 1.00 82.08 C
ATOM 8575 N LEU B 478 33.515 14.526 -65.776 1.00 77.73 N
ATOM 8576 CA LEU B 478 34.187 13.381 -65.170 1.00 77.73 C
ATOM 8577 C LEU B 478 34.073 12.145 -66.048 1.00 77.73 C
ATOM 8578 O LEU B 478 35.005 11.337 -66.107 1.00 77.73 O
ATOM 8579 CB LEU B 478 33.635 13.104 -63.780 1.00 77.73 C
ATOM 8580 CG LEU B 478 34.031 14.156 -62.753 1.00 77.73 C
ATOM 8581 CD1 LEU B 478 33.412 13.842 -61.410 1.00 77.73 C
ATOM 8582 CD2 LEU B 478 35.538 14.229 -62.646 1.00 77.73 C
ATOM 8583 N GLU B 479 32.951 11.983 -66.755 1.00 88.95 N
ATOM 8584 CA GLU B 479 32.863 10.866 -67.688 1.00 88.95 C
ATOM 8585 C GLU B 479 33.676 11.123 -68.951 1.00 88.95 C
ATOM 8586 O GLU B 479 34.110 10.178 -69.616 1.00 88.95 O
ATOM 8587 CB GLU B 479 31.408 10.565 -68.031 1.00 88.95 C
ATOM 8588 CG GLU B 479 30.653 9.961 -66.872 1.00 88.95 C
ATOM 8589 CD GLU B 479 29.245 9.578 -67.234 1.00 88.95 C
ATOM 8590 OE1 GLU B 479 28.822 9.893 -68.362 1.00 88.95 O
ATOM 8591 OE2 GLU B 479 28.563 8.952 -66.395 1.00 88.95 O
ATOM 8592 N ASN B 480 33.906 12.392 -69.264 1.00 91.42 N
ATOM 8593 CA ASN B 480 34.689 12.741 -70.440 1.00 91.42 C
ATOM 8594 C ASN B 480 36.175 12.800 -70.125 1.00 91.42 C
ATOM 8595 O ASN B 480 36.998 13.059 -71.000 1.00 91.42 O
ATOM 8596 CB ASN B 480 34.198 14.048 -71.053 1.00 91.42 C
ATOM 8597 CG ASN B 480 32.916 13.869 -71.837 1.00 91.42 C
ATOM 8598 OD1 ASN B 480 32.735 12.861 -72.520 1.00 91.42 O
ATOM 8599 ND2 ASN B 480 32.018 14.840 -71.740 1.00 91.42 N
ATOM 8600 N GLY B 481 36.511 12.563 -68.862 1.00 86.81 N
ATOM 8601 CA GLY B 481 37.895 12.545 -68.433 1.00 86.81 C
ATOM 8602 C GLY B 481 38.496 13.832 -67.906 1.00 86.81 C
ATOM 8603 O GLY B 481 38.684 14.795 -68.645 1.00 86.81 O
ATOM 8604 N LEU B 482 38.805 13.834 -66.613 1.00 83.42 N
ATOM 8605 CA LEU B 482 39.430 14.966 -65.955 1.00 83.42 C
ATOM 8606 C LEU B 482 40.043 14.494 -64.649 1.00 83.42 C
ATOM 8607 O LEU B 482 39.412 13.752 -63.892 1.00 83.42 O
ATOM 8608 CB LEU B 482 38.416 16.084 -65.707 1.00 83.42 C
ATOM 8609 CG LEU B 482 38.895 17.330 -64.978 1.00 83.42 C
ATOM 8610 CD1 LEU B 482 40.053 17.960 -65.708 1.00 83.42 C
ATOM 8611 CD2 LEU B 482 37.744 18.299 -64.888 1.00 83.42 C
ATOM 8612 N ASN B 483 41.271 14.923 -64.390 1.00 78.64 N
ATOM 8613 CA ASN B 483 42.004 14.516 -63.201 1.00 78.64 C
ATOM 8614 C ASN B 483 41.664 15.477 -62.073 1.00 78.64 C
ATOM 8615 O ASN B 483 42.236 16.567 -61.989 1.00 78.64 O
ATOM 8616 CB ASN B 483 43.504 14.500 -63.474 1.00 78.64 C
ATOM 8617 CG ASN B 483 43.903 13.421 -64.454 1.00 78.64 C
ATOM 8618 OD1 ASN B 483 43.411 12.295 -64.388 1.00 78.64 O
ATOM 8619 ND2 ASN B 483 44.796 13.760 -65.376 1.00 78.64 N
ATOM 8620 N LEU B 484 40.739 15.062 -61.207 1.00 68.25 N
ATOM 8621 CA LEU B 484 40.119 15.999 -60.279 1.00 68.25 C
ATOM 8622 C LEU B 484 41.070 16.384 -59.156 1.00 68.25 C
ATOM 8623 O LEU B 484 41.024 17.513 -58.657 1.00 68.25 O
ATOM 8624 CB LEU B 484 38.829 15.399 -59.728 1.00 68.25 C
ATOM 8625 CG LEU B 484 37.957 16.326 -58.888 1.00 68.25 C
ATOM 8626 CD1 LEU B 484 37.568 17.520 -59.711 1.00 68.25 C
ATOM 8627 CD2 LEU B 484 36.722 15.602 -58.446 1.00 68.25 C
ATOM 8628 N ARG B 485 41.953 15.471 -58.757 1.00 72.37 N
ATOM 8629 CA ARG B 485 42.958 15.817 -57.759 1.00 72.37 C
ATOM 8630 C ARG B 485 44.020 16.730 -58.361 1.00 72.37 C
ATOM 8631 O ARG B 485 44.606 17.566 -57.665 1.00 72.37 O
ATOM 8632 CB ARG B 485 43.582 14.546 -57.187 1.00 72.37 C
ATOM 8633 CG ARG B 485 44.494 14.773 -56.004 1.00 72.37 C
ATOM 8634 CD ARG B 485 45.025 13.464 -55.466 1.00 72.37 C
ATOM 8635 NE ARG B 485 45.983 13.682 -54.389 1.00 72.37 N
ATOM 8636 CZ ARG B 485 45.649 13.801 -53.110 1.00 72.37 C
ATOM 8637 NH1 ARG B 485 44.379 13.713 -52.748 1.00 72.37 N
ATOM 8638 NH2 ARG B 485 46.584 14.000 -52.191 1.00 72.37 N
ATOM 8639 N LYS B 486 44.265 16.596 -59.665 1.00 73.93 N
ATOM 8640 CA LYS B 486 45.217 17.475 -60.335 1.00 73.93 C
ATOM 8641 C LYS B 486 44.617 18.859 -60.553 1.00 73.93 C
ATOM 8642 O LYS B 486 45.341 19.851 -60.689 1.00 73.93 O
ATOM 8643 CB LYS B 486 45.642 16.839 -61.659 1.00 73.93 C
ATOM 8644 CG LYS B 486 46.784 17.514 -62.393 1.00 73.93 C
ATOM 8645 CD LYS B 486 47.153 16.732 -63.640 1.00 73.93 C
ATOM 8646 CE LYS B 486 48.280 17.402 -64.398 1.00 73.93 C
ATOM 8647 NZ LYS B 486 48.632 16.641 -65.626 1.00 73.93 N
ATOM 8648 N PHE B 487 43.288 18.945 -60.562 1.00 71.78 N
ATOM 8649 CA PHE B 487 42.619 20.218 -60.802 1.00 71.78 C
ATOM 8650 C PHE B 487 42.714 21.141 -59.595 1.00 71.78 C
ATOM 8651 O PHE B 487 43.109 22.304 -59.727 1.00 71.78 O
ATOM 8652 CB PHE B 487 41.161 19.957 -61.162 1.00 71.78 C
ATOM 8653 CG PHE B 487 40.360 21.195 -61.391 1.00 71.78 C
ATOM 8654 CD1 PHE B 487 40.511 21.920 -62.555 1.00 71.78 C
ATOM 8655 CD2 PHE B 487 39.436 21.616 -60.453 1.00 71.78 C
ATOM 8656 CE1 PHE B 487 39.766 23.052 -62.770 1.00 71.78 C
ATOM 8657 CE2 PHE B 487 38.691 22.744 -60.661 1.00 71.78 C
ATOM 8658 CZ PHE B 487 38.854 23.464 -61.820 1.00 71.78 C
ATOM 8659 N LEU B 488 42.350 20.644 -58.417 1.00 62.95 N
ATOM 8660 CA LEU B 488 42.196 21.498 -57.246 1.00 62.95 C
ATOM 8661 C LEU B 488 43.546 21.957 -56.710 1.00 62.95 C
ATOM 8662 O LEU B 488 44.329 21.158 -56.193 1.00 62.95 O
ATOM 8663 CB LEU B 488 41.438 20.752 -56.156 1.00 62.95 C
ATOM 8664 CG LEU B 488 40.020 20.336 -56.520 1.00 62.95 C
ATOM 8665 CD1 LEU B 488 39.418 19.536 -55.395 1.00 62.95 C
ATOM 8666 CD2 LEU B 488 39.181 21.543 -56.825 1.00 62.95 C
ATOM 8667 N THR B 489 43.809 23.252 -56.823 1.00 66.09 N
ATOM 8668 CA THR B 489 44.996 23.869 -56.252 1.00 66.09 C
ATOM 8669 C THR B 489 44.538 24.868 -55.207 1.00 66.09 C
ATOM 8670 O THR B 489 43.383 25.303 -55.234 1.00 66.09 O
ATOM 8671 CB THR B 489 45.824 24.580 -57.313 1.00 66.09 C
ATOM 8672 OG1 THR B 489 45.069 25.678 -57.836 1.00 66.09 O
ATOM 8673 CG2 THR B 489 46.150 23.631 -58.443 1.00 66.09 C
ATOM 8674 N THR B 490 45.443 25.243 -54.301 1.00 66.36 N
ATOM 8675 CA THR B 490 45.117 26.140 -53.196 1.00 66.36 C
ATOM 8676 C THR B 490 44.718 27.540 -53.649 1.00 66.36 C
ATOM 8677 O THR B 490 44.059 28.269 -52.903 1.00 66.36 O
ATOM 8678 CB THR B 490 46.292 26.233 -52.232 1.00 66.36 C
ATOM 8679 OG1 THR B 490 47.433 26.738 -52.929 1.00 66.36 O
ATOM 8680 CG2 THR B 490 46.606 24.869 -51.674 1.00 66.36 C
ATOM 8681 N GLU B 491 45.125 27.933 -54.858 1.00 67.43 N
ATOM 8682 CA GLU B 491 44.608 29.163 -55.447 1.00 67.43 C
ATOM 8683 C GLU B 491 43.119 29.041 -55.744 1.00 67.43 C
ATOM 8684 O GLU B 491 42.342 29.961 -55.459 1.00 67.43 O
ATOM 8685 CB GLU B 491 45.380 29.500 -56.722 1.00 67.43 C
ATOM 8686 N VAL B 492 42.707 27.897 -56.294 1.00 61.52 N
ATOM 8687 CA VAL B 492 41.314 27.692 -56.677 1.00 61.52 C
ATOM 8688 C VAL B 492 40.425 27.611 -55.446 1.00 61.52 C
ATOM 8689 O VAL B 492 39.310 28.144 -55.434 1.00 61.52 O
ATOM 8690 CB VAL B 492 41.197 26.435 -57.553 1.00 61.52 C
ATOM 8691 CG1 VAL B 492 39.758 26.141 -57.919 1.00 61.52 C
ATOM 8692 CG2 VAL B 492 42.021 26.617 -58.797 1.00 61.52 C
ATOM 8693 N LEU B 493 40.918 27.001 -54.370 1.00 61.18 N
ATOM 8694 CA LEU B 493 40.093 26.886 -53.174 1.00 61.18 C
ATOM 8695 C LEU B 493 39.980 28.214 -52.439 1.00 61.18 C
ATOM 8696 O LEU B 493 38.951 28.494 -51.814 1.00 61.18 O
ATOM 8697 CB LEU B 493 40.645 25.809 -52.256 1.00 61.18 C
ATOM 8698 CG LEU B 493 40.521 24.413 -52.837 1.00 61.18 C
ATOM 8699 CD1 LEU B 493 41.158 23.435 -51.894 1.00 61.18 C
ATOM 8700 CD2 LEU B 493 39.070 24.077 -53.070 1.00 61.18 C
ATOM 8701 N ARG B 494 41.014 29.054 -52.509 1.00 67.49 N
ATOM 8702 CA ARG B 494 40.870 30.409 -51.991 1.00 67.49 C
ATOM 8703 C ARG B 494 39.881 31.213 -52.824 1.00 67.49 C
ATOM 8704 O ARG B 494 39.027 31.919 -52.271 1.00 67.49 O
ATOM 8705 CB ARG B 494 42.227 31.105 -51.935 1.00 67.49 C
ATOM 8706 CG ARG B 494 43.096 30.627 -50.796 1.00 67.49 C
ATOM 8707 CD ARG B 494 44.439 31.318 -50.798 1.00 67.49 C
ATOM 8708 NE ARG B 494 45.251 30.883 -49.668 1.00 67.49 N
ATOM 8709 CZ ARG B 494 46.514 31.238 -49.473 1.00 67.49 C
ATOM 8710 NH1 ARG B 494 47.123 32.029 -50.343 1.00 67.49 N
ATOM 8711 NH2 ARG B 494 47.172 30.791 -48.414 1.00 67.49 N
ATOM 8712 N GLU B 495 39.942 31.069 -54.152 1.00 58.70 N
ATOM 8713 CA GLU B 495 38.994 31.760 -55.017 1.00 58.70 C
ATOM 8714 C GLU B 495 37.580 31.226 -54.837 1.00 58.70 C
ATOM 8715 O GLU B 495 36.604 31.908 -55.165 1.00 58.70 O
ATOM 8716 CB GLU B 495 39.427 31.633 -56.476 1.00 58.70 C
ATOM 8717 N LEU B 496 37.449 30.005 -54.325 1.00 55.20 N
ATOM 8718 CA LEU B 496 36.127 29.433 -54.123 1.00 55.20 C
ATOM 8719 C LEU B 496 35.549 29.827 -52.769 1.00 55.20 C
ATOM 8720 O LEU B 496 34.378 30.212 -52.678 1.00 55.20 O
ATOM 8721 CB LEU B 496 36.192 27.917 -54.253 1.00 55.20 C
ATOM 8722 CG LEU B 496 34.824 27.250 -54.248 1.00 55.20 C
ATOM 8723 CD1 LEU B 496 34.058 27.690 -55.462 1.00 55.20 C
ATOM 8724 CD2 LEU B 496 34.970 25.765 -54.241 1.00 55.20 C
ATOM 8725 N TYR B 497 36.351 29.743 -51.706 1.00 59.15 N
ATOM 8726 CA TYR B 497 35.842 30.049 -50.370 1.00 59.15 C
ATOM 8727 C TYR B 497 35.674 31.546 -50.138 1.00 59.15 C
ATOM 8728 O TYR B 497 34.753 31.958 -49.426 1.00 59.15 O
ATOM 8729 CB TYR B 497 36.756 29.460 -49.299 1.00 59.15 C
ATOM 8730 CG TYR B 497 36.448 28.038 -48.917 1.00 59.15 C
ATOM 8731 CD1 TYR B 497 35.487 27.766 -47.962 1.00 59.15 C
ATOM 8732 CD2 TYR B 497 37.112 26.975 -49.495 1.00 59.15 C
ATOM 8733 CE1 TYR B 497 35.197 26.478 -47.592 1.00 59.15 C
ATOM 8734 CE2 TYR B 497 36.823 25.677 -49.127 1.00 59.15 C
ATOM 8735 CZ TYR B 497 35.861 25.442 -48.178 1.00 59.15 C
ATOM 8736 OH TYR B 497 35.561 24.159 -47.804 1.00 59.15 O
ATOM 8737 N THR B 498 36.557 32.381 -50.689 1.00 60.49 N
ATOM 8738 CA THR B 498 36.442 33.805 -50.387 1.00 60.49 C
ATOM 8739 C THR B 498 35.329 34.464 -51.189 1.00 60.49 C
ATOM 8740 O THR B 498 34.667 35.383 -50.699 1.00 60.49 O
ATOM 8741 CB THR B 498 37.763 34.515 -50.642 1.00 60.49 C
ATOM 8742 OG1 THR B 498 38.154 34.312 -52.005 1.00 60.49 O
ATOM 8743 CG2 THR B 498 38.831 33.986 -49.712 1.00 60.49 C
ATOM 8744 N ASN B 499 35.101 34.009 -52.416 1.00 60.84 N
ATOM 8745 CA ASN B 499 34.100 34.620 -53.275 1.00 60.84 C
ATOM 8746 C ASN B 499 32.746 33.935 -53.214 1.00 60.84 C
ATOM 8747 O ASN B 499 31.748 34.576 -52.879 1.00 60.84 O
ATOM 8748 CB ASN B 499 34.596 34.641 -54.721 1.00 60.84 C
ATOM 8749 CG ASN B 499 35.721 35.617 -54.924 1.00 60.84 C
ATOM 8750 OD1 ASN B 499 35.713 36.707 -54.359 1.00 60.84 O
ATOM 8751 ND2 ASN B 499 36.694 35.240 -55.738 1.00 60.84 N
ATOM 8752 N ASN B 500 32.681 32.641 -53.523 1.00 57.11 N
ATOM 8753 CA ASN B 500 31.417 31.975 -53.801 1.00 57.11 C
ATOM 8754 C ASN B 500 30.804 31.309 -52.581 1.00 57.11 C
ATOM 8755 O ASN B 500 30.044 30.347 -52.724 1.00 57.11 O
ATOM 8756 CB ASN B 500 31.608 30.956 -54.918 1.00 57.11 C
ATOM 8757 CG ASN B 500 31.938 31.604 -56.226 1.00 57.11 C
ATOM 8758 OD1 ASN B 500 31.374 32.635 -56.571 1.00 57.11 O
ATOM 8759 ND2 ASN B 500 32.859 31.013 -56.966 1.00 57.11 N
ATOM 8760 N PHE B 501 31.101 31.791 -51.386 1.00 49.60 N
ATOM 8761 CA PHE B 501 30.545 31.234 -50.164 1.00 49.60 C
ATOM 8762 C PHE B 501 29.665 32.306 -49.540 1.00 49.60 C
ATOM 8763 O PHE B 501 30.163 33.364 -49.145 1.00 49.60 O
ATOM 8764 CB PHE B 501 31.672 30.803 -49.231 1.00 49.60 C
ATOM 8765 CG PHE B 501 31.230 30.005 -48.050 1.00 49.60 C
ATOM 8766 CD1 PHE B 501 30.835 28.695 -48.202 1.00 49.60 C
ATOM 8767 CD2 PHE B 501 31.265 30.543 -46.781 1.00 49.60 C
ATOM 8768 CE1 PHE B 501 30.445 27.950 -47.115 1.00 49.60 C
ATOM 8769 CE2 PHE B 501 30.880 29.800 -45.690 1.00 49.60 C
ATOM 8770 CZ PHE B 501 30.470 28.502 -45.860 1.00 49.60 C
ATOM 8771 N SER B 502 28.360 32.040 -49.476 1.00 54.36 N
ATOM 8772 CA SER B 502 27.390 33.061 -49.095 1.00 54.36 C
ATOM 8773 C SER B 502 27.501 33.400 -47.617 1.00 54.36 C
ATOM 8774 O SER B 502 27.562 32.514 -46.764 1.00 54.36 O
ATOM 8775 CB SER B 502 25.979 32.583 -49.403 1.00 54.36 C
ATOM 8776 OG SER B 502 25.644 31.498 -48.567 1.00 54.36 O
ATOM 8777 N SER B 503 27.483 34.702 -47.321 1.00 55.77 N
ATOM 8778 CA SER B 503 27.850 35.178 -45.990 1.00 55.77 C
ATOM 8779 C SER B 503 26.786 34.852 -44.953 1.00 55.77 C
ATOM 8780 O SER B 503 27.058 34.888 -43.747 1.00 55.77 O
ATOM 8781 CB SER B 503 28.109 36.679 -46.025 1.00 55.77 C
ATOM 8782 OG SER B 503 29.224 36.968 -46.842 1.00 55.77 O
ATOM 8783 N LEU B 504 25.567 34.545 -45.401 1.00 54.28 N
ATOM 8784 CA LEU B 504 24.534 34.080 -44.482 1.00 54.28 C
ATOM 8785 C LEU B 504 24.910 32.742 -43.857 1.00 54.28 C
ATOM 8786 O LEU B 504 24.779 32.556 -42.640 1.00 54.28 O
ATOM 8787 CB LEU B 504 23.204 33.971 -45.216 1.00 54.28 C
ATOM 8788 CG LEU B 504 22.053 33.485 -44.351 1.00 54.28 C
ATOM 8789 CD1 LEU B 504 21.819 34.456 -43.214 1.00 54.28 C
ATOM 8790 CD2 LEU B 504 20.813 33.335 -45.198 1.00 54.28 C
ATOM 8791 N VAL B 505 25.406 31.811 -44.676 1.00 52.09 N
ATOM 8792 CA VAL B 505 25.829 30.509 -44.177 1.00 52.09 C
ATOM 8793 C VAL B 505 27.046 30.660 -43.275 1.00 52.09 C
ATOM 8794 O VAL B 505 27.184 29.958 -42.268 1.00 52.09 O
ATOM 8795 CB VAL B 505 26.090 29.560 -45.362 1.00 52.09 C
ATOM 8796 CG1 VAL B 505 26.571 28.212 -44.895 1.00 52.09 C
ATOM 8797 CG2 VAL B 505 24.832 29.392 -46.173 1.00 52.09 C
ATOM 8798 N PHE B 506 27.911 31.630 -43.584 1.00 54.21 N
ATOM 8799 CA PHE B 506 29.075 31.876 -42.741 1.00 54.21 C
ATOM 8800 C PHE B 506 28.679 32.442 -41.387 1.00 54.21 C
ATOM 8801 O PHE B 506 29.244 32.048 -40.363 1.00 54.21 O
ATOM 8802 CB PHE B 506 30.049 32.819 -43.437 1.00 54.21 C
ATOM 8803 CG PHE B 506 31.224 33.184 -42.591 1.00 54.21 C
ATOM 8804 CD1 PHE B 506 32.201 32.251 -42.313 1.00 54.21 C
ATOM 8805 CD2 PHE B 506 31.353 34.459 -42.076 1.00 54.21 C
ATOM 8806 CE1 PHE B 506 33.285 32.577 -41.529 1.00 54.21 C
ATOM 8807 CE2 PHE B 506 32.436 34.793 -41.295 1.00 54.21 C
ATOM 8808 CZ PHE B 506 33.405 33.850 -41.023 1.00 54.21 C
ATOM 8809 N LYS B 507 27.709 33.357 -41.358 1.00 57.06 N
ATOM 8810 CA LYS B 507 27.226 33.871 -40.080 1.00 57.06 C
ATOM 8811 C LYS B 507 26.524 32.780 -39.284 1.00 57.06 C
ATOM 8812 O LYS B 507 26.639 32.718 -38.052 1.00 57.06 O
ATOM 8813 CB LYS B 507 26.290 35.056 -40.306 1.00 57.06 C
ATOM 8814 N ASN B 508 25.836 31.879 -39.983 1.00 52.59 N
ATOM 8815 CA ASN B 508 25.140 30.797 -39.302 1.00 52.59 C
ATOM 8816 C ASN B 508 26.130 29.803 -38.704 1.00 52.59 C
ATOM 8817 O ASN B 508 25.947 29.333 -37.574 1.00 52.59 O
ATOM 8818 CB ASN B 508 24.197 30.115 -40.286 1.00 52.59 C
ATOM 8819 CG ASN B 508 23.141 29.316 -39.600 1.00 52.59 C
ATOM 8820 OD1 ASN B 508 23.110 29.249 -38.381 1.00 52.59 O
ATOM 8821 ND2 ASN B 508 22.248 28.723 -40.376 1.00 52.59 N
ATOM 8822 N LEU B 509 27.200 29.500 -39.438 1.00 53.44 N
ATOM 8823 CA LEU B 509 28.256 28.643 -38.914 1.00 53.44 C
ATOM 8824 C LEU B 509 28.984 29.317 -37.760 1.00 53.44 C
ATOM 8825 O LEU B 509 29.385 28.652 -36.796 1.00 53.44 O
ATOM 8826 CB LEU B 509 29.231 28.288 -40.031 1.00 53.44 C
ATOM 8827 CG LEU B 509 30.392 27.390 -39.634 1.00 53.44 C
ATOM 8828 CD1 LEU B 509 29.868 26.064 -39.169 1.00 53.44 C
ATOM 8829 CD2 LEU B 509 31.345 27.213 -40.783 1.00 53.44 C
ATOM 8830 N GLN B 510 29.152 30.639 -37.842 1.00 57.21 N
ATOM 8831 CA GLN B 510 29.743 31.411 -36.755 1.00 57.21 C
ATOM 8832 C GLN B 510 28.925 31.296 -35.480 1.00 57.21 C
ATOM 8833 O GLN B 510 29.484 31.190 -34.382 1.00 57.21 O
ATOM 8834 CB GLN B 510 29.864 32.872 -37.182 1.00 57.21 C
ATOM 8835 CG GLN B 510 30.406 33.796 -36.124 1.00 57.21 C
ATOM 8836 CD GLN B 510 31.793 33.416 -35.697 1.00 57.21 C
ATOM 8837 OE1 GLN B 510 31.992 32.856 -34.620 1.00 57.21 O
ATOM 8838 NE2 GLN B 510 32.770 33.713 -36.539 1.00 57.21 N
ATOM 8839 N ILE B 511 27.600 31.299 -35.608 1.00 55.78 N
ATOM 8840 CA ILE B 511 26.748 31.079 -34.441 1.00 55.78 C
ATOM 8841 C ILE B 511 26.879 29.645 -33.935 1.00 55.78 C
ATOM 8842 O ILE B 511 27.012 29.408 -32.725 1.00 55.78 O
ATOM 8843 CB ILE B 511 25.289 31.429 -34.779 1.00 55.78 C
ATOM 8844 CG1 ILE B 511 25.164 32.914 -35.100 1.00 55.78 C
ATOM 8845 CG2 ILE B 511 24.371 31.093 -33.631 1.00 55.78 C
ATOM 8846 CD1 ILE B 511 23.829 33.296 -35.686 1.00 55.78 C
ATOM 8847 N ALA B 512 26.879 28.678 -34.858 1.00 55.29 N
ATOM 8848 CA ALA B 512 26.835 27.269 -34.473 1.00 55.29 C
ATOM 8849 C ALA B 512 28.141 26.812 -33.844 1.00 55.29 C
ATOM 8850 O ALA B 512 28.168 25.819 -33.111 1.00 55.29 O
ATOM 8851 CB ALA B 512 26.510 26.404 -35.685 1.00 55.29 C
ATOM 8852 N LYS B 513 29.238 27.507 -34.137 1.00 59.27 N
ATOM 8853 CA LYS B 513 30.507 27.158 -33.517 1.00 59.27 C
ATOM 8854 C LYS B 513 30.519 27.553 -32.048 1.00 59.27 C
ATOM 8855 O LYS B 513 30.934 26.769 -31.188 1.00 59.27 O
ATOM 8856 CB LYS B 513 31.650 27.837 -34.268 1.00 59.27 C
ATOM 8857 CG LYS B 513 33.073 27.418 -33.887 1.00 59.27 C
ATOM 8858 CD LYS B 513 33.705 28.351 -32.864 1.00 59.27 C
ATOM 8859 CE LYS B 513 33.698 29.762 -33.378 1.00 59.27 C
ATOM 8860 NZ LYS B 513 34.361 30.720 -32.448 1.00 59.27 N
ATOM 8861 N ASN B 514 30.097 28.781 -31.747 1.00 60.39 N
ATOM 8862 CA ASN B 514 30.170 29.277 -30.378 1.00 60.39 C
ATOM 8863 C ASN B 514 29.101 28.646 -29.503 1.00 60.39 C
ATOM 8864 O ASN B 514 29.350 28.334 -28.335 1.00 60.39 O
ATOM 8865 CB ASN B 514 30.039 30.796 -30.364 1.00 60.39 C
ATOM 8866 CG ASN B 514 31.262 31.485 -30.905 1.00 60.39 C
ATOM 8867 OD1 ASN B 514 32.386 31.099 -30.602 1.00 60.39 O
ATOM 8868 ND2 ASN B 514 31.053 32.506 -31.722 1.00 60.39 N
ATOM 8869 N SER B 515 27.905 28.448 -30.046 1.00 64.03 N
ATOM 8870 CA SER B 515 26.822 27.976 -29.194 1.00 64.03 C
ATOM 8871 C SER B 515 26.890 26.472 -28.948 1.00 64.03 C
ATOM 8872 O SER B 515 26.774 26.029 -27.803 1.00 64.03 O
ATOM 8873 CB SER B 515 25.483 28.354 -29.811 1.00 64.03 C
ATOM 8874 OG SER B 515 25.328 27.700 -31.054 1.00 64.03 O
ATOM 8875 N TYR B 516 27.083 25.671 -29.995 1.00 61.76 N
ATOM 8876 CA TYR B 516 27.057 24.212 -29.885 1.00 61.76 C
ATOM 8877 C TYR B 516 28.400 23.662 -30.369 1.00 61.76 C
ATOM 8878 O TYR B 516 28.581 23.368 -31.550 1.00 61.76 O
ATOM 8879 CB TYR B 516 25.905 23.621 -30.684 1.00 61.76 C
ATOM 8880 CG TYR B 516 24.551 24.111 -30.257 1.00 61.76 C
ATOM 8881 CD1 TYR B 516 24.001 23.713 -29.050 1.00 61.76 C
ATOM 8882 CD2 TYR B 516 23.799 24.931 -31.082 1.00 61.76 C
ATOM 8883 CE1 TYR B 516 22.756 24.150 -28.658 1.00 61.76 C
ATOM 8884 CE2 TYR B 516 22.553 25.372 -30.703 1.00 61.76 C
ATOM 8885 CZ TYR B 516 22.037 24.976 -29.490 1.00 61.76 C
ATOM 8886 OH TYR B 516 20.792 25.407 -29.099 1.00 61.76 O
ATOM 8887 N ASN B 517 29.337 23.497 -29.446 1.00 61.48 N
ATOM 8888 CA ASN B 517 30.708 23.214 -29.839 1.00 61.48 C
ATOM 8889 C ASN B 517 31.015 21.726 -29.728 1.00 61.48 C
ATOM 8890 O ASN B 517 30.502 21.031 -28.850 1.00 61.48 O
ATOM 8891 CB ASN B 517 31.665 24.028 -28.977 1.00 61.48 C
ATOM 8892 CG ASN B 517 33.051 24.122 -29.567 1.00 61.48 C
ATOM 8893 OD1 ASN B 517 33.338 23.544 -30.611 1.00 61.48 O
ATOM 8894 ND2 ASN B 517 33.918 24.877 -28.909 1.00 61.48 N
ATOM 8895 N ASP B 518 31.858 21.240 -30.639 1.00 56.04 N
ATOM 8896 CA ASP B 518 32.306 19.854 -30.667 1.00 56.04 C
ATOM 8897 C ASP B 518 33.680 19.799 -31.319 1.00 56.04 C
ATOM 8898 O ASP B 518 34.277 20.829 -31.632 1.00 56.04 O
ATOM 8899 CB ASP B 518 31.324 18.951 -31.420 1.00 56.04 C
ATOM 8900 N ALA B 519 34.186 18.582 -31.520 1.00 54.90 N
ATOM 8901 CA ALA B 519 35.534 18.427 -32.057 1.00 54.90 C
ATOM 8902 C ALA B 519 35.569 18.696 -33.555 1.00 54.90 C
ATOM 8903 O ALA B 519 36.374 19.508 -34.042 1.00 54.90 O
ATOM 8904 CB ALA B 519 36.058 17.026 -31.751 1.00 54.90 C
ATOM 8905 N LEU B 520 34.701 18.001 -34.299 1.00 46.52 N
ATOM 8906 CA LEU B 520 34.676 18.106 -35.757 1.00 46.52 C
ATOM 8907 C LEU B 520 34.349 19.514 -36.209 1.00 46.52 C
ATOM 8908 O LEU B 520 34.975 20.032 -37.139 1.00 46.52 O
ATOM 8909 CB LEU B 520 33.656 17.131 -36.333 1.00 46.52 C
ATOM 8910 CG LEU B 520 33.512 17.226 -37.846 1.00 46.52 C
ATOM 8911 CD1 LEU B 520 34.815 16.875 -38.503 1.00 46.52 C
ATOM 8912 CD2 LEU B 520 32.433 16.315 -38.331 1.00 46.52 C
ATOM 8913 N LEU B 521 33.395 20.158 -35.540 1.00 49.90 N
ATOM 8914 CA LEU B 521 32.985 21.493 -35.947 1.00 49.90 C
ATOM 8915 C LEU B 521 34.093 22.505 -35.690 1.00 49.90 C
ATOM 8916 O LEU B 521 34.296 23.430 -36.487 1.00 49.90 O
ATOM 8917 CB LEU B 521 31.712 21.886 -35.211 1.00 49.90 C
ATOM 8918 CG LEU B 521 31.080 23.126 -35.812 1.00 49.90 C
ATOM 8919 CD1 LEU B 521 30.601 22.796 -37.202 1.00 49.90 C
ATOM 8920 CD2 LEU B 521 29.946 23.610 -34.953 1.00 49.90 C
ATOM 8921 N THR B 522 34.855 22.303 -34.613 1.00 52.24 N
ATOM 8922 CA THR B 522 36.013 23.146 -34.340 1.00 52.24 C
ATOM 8923 C THR B 522 37.071 22.986 -35.415 1.00 52.24 C
ATOM 8924 O THR B 522 37.623 23.982 -35.905 1.00 52.24 O
ATOM 8925 CB THR B 522 36.596 22.804 -32.973 1.00 52.24 C
ATOM 8926 OG1 THR B 522 35.598 23.004 -31.968 1.00 52.24 O
ATOM 8927 CG2 THR B 522 37.783 23.687 -32.663 1.00 52.24 C
ATOM 8928 N PHE B 523 37.340 21.743 -35.825 1.00 51.62 N
ATOM 8929 CA PHE B 523 38.340 21.522 -36.865 1.00 51.62 C
ATOM 8930 C PHE B 523 37.895 22.093 -38.206 1.00 51.62 C
ATOM 8931 O PHE B 523 38.713 22.631 -38.964 1.00 51.62 O
ATOM 8932 CB PHE B 523 38.637 20.037 -36.997 1.00 51.62 C
ATOM 8933 CG PHE B 523 39.675 19.733 -38.014 1.00 51.62 C
ATOM 8934 CD1 PHE B 523 41.006 19.967 -37.739 1.00 51.62 C
ATOM 8935 CD2 PHE B 523 39.323 19.231 -39.251 1.00 51.62 C
ATOM 8936 CE1 PHE B 523 41.973 19.695 -38.675 1.00 51.62 C
ATOM 8937 CE2 PHE B 523 40.281 18.960 -40.192 1.00 51.62 C
ATOM 8938 CZ PHE B 523 41.611 19.192 -39.905 1.00 51.62 C
ATOM 8939 N VAL B 524 36.598 22.013 -38.504 1.00 51.15 N
ATOM 8940 CA VAL B 524 36.096 22.561 -39.760 1.00 51.15 C
ATOM 8941 C VAL B 524 36.175 24.081 -39.748 1.00 51.15 C
ATOM 8942 O VAL B 524 36.556 24.699 -40.750 1.00 51.15 O
ATOM 8943 CB VAL B 524 34.673 22.048 -40.037 1.00 51.15 C
ATOM 8944 CG1 VAL B 524 34.055 22.760 -41.208 1.00 51.15 C
ATOM 8945 CG2 VAL B 524 34.733 20.582 -40.351 1.00 51.15 C
ATOM 8946 N TRP B 525 35.885 24.704 -38.602 1.00 58.40 N
ATOM 8947 CA TRP B 525 35.988 26.157 -38.524 1.00 58.40 C
ATOM 8948 C TRP B 525 37.432 26.623 -38.635 1.00 58.40 C
ATOM 8949 O TRP B 525 37.703 27.659 -39.258 1.00 58.40 O
ATOM 8950 CB TRP B 525 35.358 26.660 -37.228 1.00 58.40 C
ATOM 8951 CG TRP B 525 35.347 28.141 -37.096 1.00 58.40 C
ATOM 8952 CD1 TRP B 525 34.719 29.031 -37.906 1.00 58.40 C
ATOM 8953 CD2 TRP B 525 35.959 28.901 -36.063 1.00 58.40 C
ATOM 8954 NE1 TRP B 525 34.924 30.308 -37.457 1.00 58.40 N
ATOM 8955 CE2 TRP B 525 35.686 30.252 -36.321 1.00 58.40 C
ATOM 8956 CE3 TRP B 525 36.733 28.571 -34.950 1.00 58.40 C
ATOM 8957 CZ2 TRP B 525 36.154 31.273 -35.504 1.00 58.40 C
ATOM 8958 CZ3 TRP B 525 37.195 29.579 -34.140 1.00 58.40 C
ATOM 8959 CH2 TRP B 525 36.904 30.919 -34.420 1.00 58.40 C
ATOM 8960 N LYS B 526 38.374 25.847 -38.093 1.00 59.36 N
ATOM 8961 CA LYS B 526 39.778 26.211 -38.251 1.00 59.36 C
ATOM 8962 C LYS B 526 40.232 26.056 -39.695 1.00 59.36 C
ATOM 8963 O LYS B 526 41.005 26.881 -40.192 1.00 59.36 O
ATOM 8964 CB LYS B 526 40.659 25.392 -37.313 1.00 59.36 C
ATOM 8965 CG LYS B 526 40.420 25.696 -35.849 1.00 59.36 C
ATOM 8966 CD LYS B 526 40.696 27.153 -35.546 1.00 59.36 C
ATOM 8967 CE LYS B 526 42.180 27.455 -35.611 1.00 59.36 C
ATOM 8968 NZ LYS B 526 42.474 28.873 -35.259 1.00 59.36 N
ATOM 8969 N MET B 527 39.730 25.035 -40.397 1.00 61.83 N
ATOM 8970 CA MET B 527 40.045 24.897 -41.820 1.00 61.83 C
ATOM 8971 C MET B 527 39.467 26.045 -42.640 1.00 61.83 C
ATOM 8972 O MET B 527 40.112 26.547 -43.572 1.00 61.83 O
ATOM 8973 CB MET B 527 39.518 23.570 -42.355 1.00 61.83 C
ATOM 8974 CG MET B 527 39.889 23.319 -43.808 1.00 61.83 C
ATOM 8975 SD MET B 527 39.104 21.868 -44.526 1.00 61.83 S
ATOM 8976 CE MET B 527 39.977 20.534 -43.705 1.00 61.83 C
ATOM 8977 N VAL B 528 38.253 26.479 -42.307 1.00 62.61 N
ATOM 8978 CA VAL B 528 37.619 27.545 -43.078 1.00 62.61 C
ATOM 8979 C VAL B 528 38.324 28.871 -42.840 1.00 62.61 C
ATOM 8980 O VAL B 528 38.564 29.634 -43.782 1.00 62.61 O
ATOM 8981 CB VAL B 528 36.116 27.615 -42.754 1.00 62.61 C
ATOM 8982 CG1 VAL B 528 35.489 28.845 -43.357 1.00 62.61 C
ATOM 8983 CG2 VAL B 528 35.428 26.410 -43.322 1.00 62.61 C
ATOM 8984 N GLU B 529 38.726 29.148 -41.600 1.00 69.39 N
ATOM 8985 CA GLU B 529 39.455 30.392 -41.374 1.00 69.39 C
ATOM 8986 C GLU B 529 40.898 30.297 -41.846 1.00 69.39 C
ATOM 8987 O GLU B 529 41.555 31.325 -42.036 1.00 69.39 O
ATOM 8988 CB GLU B 529 39.387 30.821 -39.916 1.00 69.39 C
ATOM 8989 CG GLU B 529 38.065 31.458 -39.596 1.00 69.39 C
ATOM 8990 CD GLU B 529 38.064 32.166 -38.274 1.00 69.39 C
ATOM 8991 OE1 GLU B 529 39.037 32.005 -37.509 1.00 69.39 O
ATOM 8992 OE2 GLU B 529 37.106 32.924 -38.025 1.00 69.39 O
ATOM 8993 N ASP B 530 41.414 29.087 -42.047 1.00 69.08 N
ATOM 8994 CA ASP B 530 42.710 28.978 -42.704 1.00 69.08 C
ATOM 8995 C ASP B 530 42.592 29.296 -44.187 1.00 69.08 C
ATOM 8996 O ASP B 530 43.440 29.995 -44.750 1.00 69.08 O
ATOM 8997 CB ASP B 530 43.293 27.583 -42.497 1.00 69.08 C
ATOM 8998 N PHE B 531 41.537 28.804 -44.836 1.00 68.61 N
ATOM 8999 CA PHE B 531 41.352 29.104 -46.253 1.00 68.61 C
ATOM 9000 C PHE B 531 40.873 30.526 -46.497 1.00 68.61 C
ATOM 9001 O PHE B 531 41.033 31.043 -47.607 1.00 68.61 O
ATOM 9002 CB PHE B 531 40.361 28.145 -46.892 1.00 68.61 C
ATOM 9003 CG PHE B 531 40.964 26.871 -47.371 1.00 68.61 C
ATOM 9004 CD1 PHE B 531 41.612 26.836 -48.591 1.00 68.61 C
ATOM 9005 CD2 PHE B 531 40.852 25.705 -46.641 1.00 68.61 C
ATOM 9006 CE1 PHE B 531 42.162 25.670 -49.064 1.00 68.61 C
ATOM 9007 CE2 PHE B 531 41.399 24.529 -47.122 1.00 68.61 C
ATOM 9008 CZ PHE B 531 42.041 24.511 -48.329 1.00 68.61 C
ATOM 9009 N ARG B 532 40.270 31.163 -45.493 1.00 66.79 N
ATOM 9010 CA ARG B 532 39.537 32.402 -45.735 1.00 66.79 C
ATOM 9011 C ARG B 532 40.479 33.580 -45.972 1.00 66.79 C
ATOM 9012 O ARG B 532 40.152 34.499 -46.730 1.00 66.79 O
ATOM 9013 CB ARG B 532 38.582 32.661 -44.566 1.00 66.79 C
ATOM 9014 CG ARG B 532 37.754 33.919 -44.696 1.00 66.79 C
ATOM 9015 CD ARG B 532 36.881 33.899 -45.938 1.00 66.79 C
ATOM 9016 NE ARG B 532 35.775 32.957 -45.856 1.00 66.79 N
ATOM 9017 CZ ARG B 532 34.602 33.254 -45.311 1.00 66.79 C
ATOM 9018 NH1 ARG B 532 34.393 34.454 -44.796 1.00 66.79 N
ATOM 9019 NH2 ARG B 532 33.637 32.352 -45.276 1.00 66.79 N
ATOM 9020 N ARG B 533 41.665 33.551 -45.376 1.00 81.11 N
ATOM 9021 CA ARG B 533 42.634 34.626 -45.560 1.00 81.11 C
ATOM 9022 C ARG B 533 43.221 34.619 -46.966 1.00 81.11 C
ATOM 9023 O ARG B 533 44.420 34.813 -47.150 1.00 81.11 O
ATOM 9024 CB ARG B 533 43.752 34.504 -44.535 1.00 81.11 C
ATOM 9025 CG ARG B 533 43.280 34.677 -43.120 1.00 81.11 C
ATOM 9026 CD ARG B 533 44.409 34.407 -42.162 1.00 81.11 C
ATOM 9027 NE ARG B 533 43.968 34.474 -40.776 1.00 81.11 N
ATOM 9028 CZ ARG B 533 44.736 34.168 -39.735 1.00 81.11 C
ATOM 9029 NH1 ARG B 533 45.984 33.767 -39.926 1.00 81.11 N
ATOM 9030 NH2 ARG B 533 44.254 34.258 -38.505 1.00 81.11 N
ATOM 9031 N PRO B 555 50.116 21.858 -48.816 1.00 96.04 N
ATOM 9032 CA PRO B 555 50.841 22.931 -48.129 1.00 96.04 C
ATOM 9033 C PRO B 555 50.156 23.392 -46.843 1.00 96.04 C
ATOM 9034 O PRO B 555 50.746 23.248 -45.773 1.00 96.04 O
ATOM 9035 CB PRO B 555 50.890 24.049 -49.175 1.00 96.04 C
ATOM 9036 CG PRO B 555 49.791 23.748 -50.126 1.00 96.04 C
ATOM 9037 CD PRO B 555 49.670 22.261 -50.160 1.00 96.04 C
ATOM 9038 N ILE B 556 48.942 23.938 -46.935 1.00 86.43 N
ATOM 9039 CA ILE B 556 48.203 24.267 -45.722 1.00 86.43 C
ATOM 9040 C ILE B 556 47.278 23.119 -45.340 1.00 86.43 C
ATOM 9041 O ILE B 556 46.930 22.950 -44.167 1.00 86.43 O
ATOM 9042 CB ILE B 556 47.460 25.610 -45.886 1.00 86.43 C
ATOM 9043 CG1 ILE B 556 46.504 25.610 -47.080 1.00 86.43 C
ATOM 9044 CG2 ILE B 556 48.453 26.749 -46.045 1.00 86.43 C
ATOM 9045 CD1 ILE B 556 45.080 25.346 -46.726 1.00 86.43 C
ATOM 9046 N THR B 557 46.860 22.322 -46.323 1.00 77.11 N
ATOM 9047 CA THR B 557 46.197 21.054 -46.052 1.00 77.11 C
ATOM 9048 C THR B 557 46.470 20.090 -47.195 1.00 77.11 C
ATOM 9049 O THR B 557 46.731 20.490 -48.333 1.00 77.11 O
ATOM 9050 CB THR B 557 44.684 21.211 -45.844 1.00 77.11 C
ATOM 9051 OG1 THR B 557 44.121 19.943 -45.489 1.00 77.11 O
ATOM 9052 CG2 THR B 557 44.002 21.715 -47.096 1.00 77.11 C
ATOM 9053 N ARG B 558 46.460 18.813 -46.854 1.00 69.36 N
ATOM 9054 CA ARG B 558 46.307 17.743 -47.816 1.00 69.36 C
ATOM 9055 C ARG B 558 44.836 17.337 -47.794 1.00 69.36 C
ATOM 9056 O ARG B 558 44.022 17.988 -47.128 1.00 69.36 O
ATOM 9057 CB ARG B 558 47.299 16.622 -47.494 1.00 69.36 C
ATOM 9058 CG ARG B 558 47.189 16.062 -46.089 1.00 69.36 C
ATOM 9059 CD ARG B 558 48.352 15.127 -45.762 1.00 69.36 C
ATOM 9060 NE ARG B 558 48.336 13.912 -46.565 1.00 69.36 N
ATOM 9061 CZ ARG B 558 49.356 13.068 -46.655 1.00 69.36 C
ATOM 9062 NH1 ARG B 558 50.470 13.308 -45.986 1.00 69.36 N
ATOM 9063 NH2 ARG B 558 49.259 11.981 -47.408 1.00 69.36 N
ATOM 9064 N HIS B 559 44.500 16.268 -48.514 1.00 60.32 N
ATOM 9065 CA HIS B 559 43.122 15.879 -48.808 1.00 60.32 C
ATOM 9066 C HIS B 559 42.291 17.016 -49.399 1.00 60.32 C
ATOM 9067 O HIS B 559 41.452 17.610 -48.690 1.00 60.32 O
ATOM 9068 CB HIS B 559 42.436 15.303 -47.576 1.00 60.32 C
ATOM 9069 CG HIS B 559 43.067 14.061 -47.039 1.00 60.32 C
ATOM 9070 ND1 HIS B 559 42.958 12.841 -47.667 1.00 60.32 N
ATOM 9071 CD2 HIS B 559 43.764 13.837 -45.900 1.00 60.32 C
ATOM 9072 CE1 HIS B 559 43.581 11.922 -46.953 1.00 60.32 C
ATOM 9073 NE2 HIS B 559 44.079 12.502 -45.876 1.00 60.32 N
ATOM 9074 N PRO B 560 42.495 17.384 -50.664 1.00 53.22 N
ATOM 9075 CA PRO B 560 41.667 18.454 -51.240 1.00 53.22 C
ATOM 9076 C PRO B 560 40.233 18.041 -51.504 1.00 53.22 C
ATOM 9077 O PRO B 560 39.329 18.893 -51.498 1.00 53.22 O
ATOM 9078 CB PRO B 560 42.390 18.785 -52.548 1.00 53.22 C
ATOM 9079 CG PRO B 560 43.755 18.274 -52.370 1.00 53.22 C
ATOM 9080 CD PRO B 560 43.600 17.036 -51.565 1.00 53.22 C
ATOM 9081 N LEU B 561 40.007 16.755 -51.765 1.00 44.27 N
ATOM 9082 CA LEU B 561 38.676 16.296 -52.143 1.00 44.27 C
ATOM 9083 C LEU B 561 37.694 16.425 -50.991 1.00 44.27 C
ATOM 9084 O LEU B 561 36.533 16.791 -51.199 1.00 44.27 O
ATOM 9085 CB LEU B 561 38.732 14.859 -52.642 1.00 44.27 C
ATOM 9086 CG LEU B 561 38.898 14.664 -54.146 1.00 44.27 C
ATOM 9087 CD1 LEU B 561 37.720 15.287 -54.840 1.00 44.27 C
ATOM 9088 CD2 LEU B 561 40.187 15.229 -54.690 1.00 44.27 C
ATOM 9089 N GLN B 562 38.155 16.187 -49.762 1.00 43.36 N
ATOM 9090 CA GLN B 562 37.305 16.440 -48.605 1.00 43.36 C
ATOM 9091 C GLN B 562 37.042 17.926 -48.409 1.00 43.36 C
ATOM 9092 O GLN B 562 35.989 18.306 -47.889 1.00 43.36 O
ATOM 9093 CB GLN B 562 37.914 15.834 -47.346 1.00 43.36 C
ATOM 9094 CG GLN B 562 37.632 14.357 -47.169 1.00 43.36 C
ATOM 9095 CD GLN B 562 38.482 13.490 -48.045 1.00 43.36 C
ATOM 9096 OE1 GLN B 562 39.485 13.936 -48.591 1.00 43.36 O
ATOM 9097 NE2 GLN B 562 38.083 12.238 -48.191 1.00 43.36 N
ATOM 9098 N ALA B 563 37.964 18.784 -48.843 1.00 40.51 N
ATOM 9099 CA ALA B 563 37.721 20.216 -48.724 1.00 40.51 C
ATOM 9100 C ALA B 563 36.622 20.664 -49.673 1.00 40.51 C
ATOM 9101 O ALA B 563 35.707 21.397 -49.271 1.00 40.51 O
ATOM 9102 CB ALA B 563 39.003 20.997 -48.979 1.00 40.51 C
ATOM 9103 N LEU B 564 36.663 20.193 -50.921 1.00 37.66 N
ATOM 9104 CA LEU B 564 35.586 20.519 -51.852 1.00 37.66 C
ATOM 9105 C LEU B 564 34.272 19.881 -51.424 1.00 37.66 C
ATOM 9106 O LEU B 564 33.200 20.483 -51.574 1.00 37.66 O
ATOM 9107 CB LEU B 564 35.962 20.085 -53.260 1.00 37.66 C
ATOM 9108 CG LEU B 564 34.939 20.364 -54.348 1.00 37.66 C
ATOM 9109 CD1 LEU B 564 34.658 21.821 -54.398 1.00 37.66 C
ATOM 9110 CD2 LEU B 564 35.487 19.909 -55.667 1.00 37.66 C
ATOM 9111 N PHE B 565 34.340 18.691 -50.827 1.00 32.66 N
ATOM 9112 CA PHE B 565 33.132 18.024 -50.362 1.00 32.66 C
ATOM 9113 C PHE B 565 32.475 18.768 -49.206 1.00 32.66 C
ATOM 9114 O PHE B 565 31.249 18.924 -49.182 1.00 32.66 O
ATOM 9115 CB PHE B 565 33.467 16.597 -49.962 1.00 32.66 C
ATOM 9116 CG PHE B 565 32.319 15.850 -49.405 1.00 32.66 C
ATOM 9117 CD1 PHE B 565 31.288 15.452 -50.214 1.00 32.66 C
ATOM 9118 CD2 PHE B 565 32.289 15.509 -48.076 1.00 32.66 C
ATOM 9119 CE1 PHE B 565 30.232 14.755 -49.705 1.00 32.66 C
ATOM 9120 CE2 PHE B 565 31.238 14.812 -47.564 1.00 32.66 C
ATOM 9121 CZ PHE B 565 30.209 14.432 -48.378 1.00 32.66 C
ATOM 9122 N ILE B 566 33.266 19.261 -48.254 1.00 35.82 N
ATOM 9123 CA ILE B 566 32.686 19.986 -47.127 1.00 35.82 C
ATOM 9124 C ILE B 566 32.172 21.345 -47.578 1.00 35.82 C
ATOM 9125 O ILE B 566 31.133 21.825 -47.094 1.00 35.82 O
ATOM 9126 CB ILE B 566 33.715 20.072 -45.988 1.00 35.82 C
ATOM 9127 CG1 ILE B 566 33.890 18.690 -45.381 1.00 35.82 C
ATOM 9128 CG2 ILE B 566 33.317 21.038 -44.910 1.00 35.82 C
ATOM 9129 CD1 ILE B 566 35.024 18.602 -44.428 1.00 35.82 C
ATOM 9130 N TRP B 567 32.838 21.946 -48.571 1.00 40.01 N
ATOM 9131 CA TRP B 567 32.306 23.151 -49.200 1.00 40.01 C
ATOM 9132 C TRP B 567 30.951 22.903 -49.842 1.00 40.01 C
ATOM 9133 O TRP B 567 30.073 23.770 -49.804 1.00 40.01 O
ATOM 9134 CB TRP B 567 33.265 23.662 -50.262 1.00 40.01 C
ATOM 9135 CG TRP B 567 32.719 24.828 -50.966 1.00 40.01 C
ATOM 9136 CD1 TRP B 567 32.617 26.080 -50.486 1.00 40.01 C
ATOM 9137 CD2 TRP B 567 32.120 24.841 -52.258 1.00 40.01 C
ATOM 9138 NE1 TRP B 567 32.030 26.894 -51.412 1.00 40.01 N
ATOM 9139 CE2 TRP B 567 31.707 26.149 -52.510 1.00 40.01 C
ATOM 9140 CE3 TRP B 567 31.898 23.872 -53.227 1.00 40.01 C
ATOM 9141 CZ2 TRP B 567 31.097 26.519 -53.689 1.00 40.01 C
ATOM 9142 CZ3 TRP B 567 31.293 24.242 -54.399 1.00 40.01 C
ATOM 9143 CH2 TRP B 567 30.899 25.553 -54.622 1.00 40.01 C
ATOM 9144 N SER B 568 30.759 21.732 -50.437 1.00 37.40 N
ATOM 9145 CA SER B 568 29.466 21.461 -51.053 1.00 37.40 C
ATOM 9146 C SER B 568 28.403 21.155 -50.010 1.00 37.40 C
ATOM 9147 O SER B 568 27.232 21.491 -50.201 1.00 37.40 O
ATOM 9148 CB SER B 568 29.578 20.313 -52.044 1.00 37.40 C
ATOM 9149 OG SER B 568 28.310 20.001 -52.585 1.00 37.40 O
ATOM 9150 N VAL B 569 28.782 20.515 -48.905 1.00 32.54 N
ATOM 9151 CA VAL B 569 27.765 20.084 -47.949 1.00 32.54 C
ATOM 9152 C VAL B 569 27.293 21.243 -47.080 1.00 32.54 C
ATOM 9153 O VAL B 569 26.113 21.303 -46.712 1.00 32.54 O
ATOM 9154 CB VAL B 569 28.296 18.898 -47.126 1.00 32.54 C
ATOM 9155 CG1 VAL B 569 27.375 18.510 -46.004 1.00 32.54 C
ATOM 9156 CG2 VAL B 569 28.428 17.715 -48.024 1.00 32.54 C
ATOM 9157 N LEU B 570 28.168 22.213 -46.791 1.00 34.35 N
ATOM 9158 CA LEU B 570 27.760 23.336 -45.944 1.00 34.35 C
ATOM 9159 C LEU B 570 26.692 24.213 -46.586 1.00 34.35 C
ATOM 9160 O LEU B 570 25.887 24.815 -45.874 1.00 34.35 O
ATOM 9161 CB LEU B 570 28.957 24.200 -45.574 1.00 34.35 C
ATOM 9162 CG LEU B 570 29.869 23.668 -44.488 1.00 34.35 C
ATOM 9163 CD1 LEU B 570 31.053 24.580 -44.335 1.00 34.35 C
ATOM 9164 CD2 LEU B 570 29.075 23.629 -43.224 1.00 34.35 C
ATOM 9165 N GLN B 571 26.641 24.291 -47.907 1.00 37.97 N
ATOM 9166 CA GLN B 571 25.671 25.171 -48.539 1.00 37.97 C
ATOM 9167 C GLN B 571 24.350 24.491 -48.867 1.00 37.97 C
ATOM 9168 O GLN B 571 23.518 25.109 -49.538 1.00 37.97 O
ATOM 9169 CB GLN B 571 26.247 25.776 -49.811 1.00 37.97 C
ATOM 9170 CG GLN B 571 27.377 26.726 -49.573 1.00 37.97 C
ATOM 9171 CD GLN B 571 27.840 27.362 -50.853 1.00 37.97 C
ATOM 9172 OE1 GLN B 571 27.317 27.064 -51.921 1.00 37.97 O
ATOM 9173 NE2 GLN B 571 28.820 28.247 -50.759 1.00 37.97 N
ATOM 9174 N ASN B 572 24.145 23.252 -48.406 1.00 42.92 N
ATOM 9175 CA ASN B 572 22.948 22.441 -48.686 1.00 42.92 C
ATOM 9176 C ASN B 572 22.687 22.292 -50.180 1.00 42.92 C
ATOM 9177 O ASN B 572 21.599 22.583 -50.672 1.00 42.92 O
ATOM 9178 CB ASN B 572 21.711 22.992 -47.984 1.00 42.92 C
ATOM 9179 CG ASN B 572 21.785 22.850 -46.495 1.00 42.92 C
ATOM 9180 OD1 ASN B 572 21.885 23.836 -45.770 1.00 42.92 O
ATOM 9181 ND2 ASN B 572 21.717 21.621 -46.020 1.00 42.92 N
ATOM 9182 N LYS B 573 23.698 21.841 -50.914 1.00 43.16 N
ATOM 9183 CA LYS B 573 23.534 21.497 -52.322 1.00 43.16 C
ATOM 9184 C LYS B 573 23.448 19.982 -52.414 1.00 43.16 C
ATOM 9185 O LYS B 573 24.412 19.279 -52.120 1.00 43.16 O
ATOM 9186 CB LYS B 573 24.684 22.042 -53.152 1.00 43.16 C
ATOM 9187 CG LYS B 573 24.694 23.539 -53.280 1.00 43.16 C
ATOM 9188 CD LYS B 573 25.834 23.982 -54.167 1.00 43.16 C
ATOM 9189 CE LYS B 573 25.842 25.483 -54.337 1.00 43.16 C
ATOM 9190 NZ LYS B 573 26.987 25.930 -55.174 1.00 43.16 N
ATOM 9191 N LYS B 574 22.288 19.470 -52.819 1.00 47.03 N
ATOM 9192 CA LYS B 574 22.093 18.025 -52.833 1.00 47.03 C
ATOM 9193 C LYS B 574 22.805 17.385 -54.013 1.00 47.03 C
ATOM 9194 O LYS B 574 23.715 16.559 -53.843 1.00 47.03 O
ATOM 9195 CB LYS B 574 20.603 17.701 -52.881 1.00 47.03 C
ATOM 9196 CG LYS B 574 19.861 18.079 -51.629 1.00 47.03 C
ATOM 9197 CD LYS B 574 18.392 17.728 -51.730 1.00 47.03 C
ATOM 9198 CE LYS B 574 17.654 18.138 -50.470 1.00 47.03 C
ATOM 9199 NZ LYS B 574 16.207 17.809 -50.532 1.00 47.03 N
ATOM 9200 N GLU B 575 22.409 17.774 -55.223 1.00 43.71 N
ATOM 9201 CA GLU B 575 22.805 17.026 -56.407 1.00 43.71 C
ATOM 9202 C GLU B 575 24.264 17.255 -56.749 1.00 43.71 C
ATOM 9203 O GLU B 575 24.869 16.454 -57.460 1.00 43.71 O
ATOM 9204 CB GLU B 575 21.910 17.393 -57.584 1.00 43.71 C
ATOM 9205 N LEU B 576 24.853 18.338 -56.256 1.00 40.71 N
ATOM 9206 CA LEU B 576 26.282 18.515 -56.461 1.00 40.71 C
ATOM 9207 C LEU B 576 27.075 17.668 -55.478 1.00 40.71 C
ATOM 9208 O LEU B 576 28.140 17.139 -55.821 1.00 40.71 O
ATOM 9209 CB LEU B 576 26.642 19.995 -56.344 1.00 40.71 C
ATOM 9210 CG LEU B 576 27.994 20.537 -56.815 1.00 40.71 C
ATOM 9211 CD1 LEU B 576 29.109 20.420 -55.794 1.00 40.71 C
ATOM 9212 CD2 LEU B 576 28.383 19.826 -58.092 1.00 40.71 C
ATOM 9213 N SER B 577 26.572 17.518 -54.256 1.00 40.93 N
ATOM 9214 CA SER B 577 27.320 16.765 -53.262 1.00 40.93 C
ATOM 9215 C SER B 577 27.251 15.277 -53.540 1.00 40.93 C
ATOM 9216 O SER B 577 28.214 14.553 -53.273 1.00 40.93 O
ATOM 9217 CB SER B 577 26.793 17.046 -51.870 1.00 40.93 C
ATOM 9218 OG SER B 577 25.515 16.465 -51.743 1.00 40.93 O
ATOM 9219 N LYS B 578 26.137 14.803 -54.103 1.00 43.86 N
ATOM 9220 CA LYS B 578 26.069 13.392 -54.472 1.00 43.86 C
ATOM 9221 C LYS B 578 27.021 13.074 -55.613 1.00 43.86 C
ATOM 9222 O LYS B 578 27.523 11.951 -55.714 1.00 43.86 O
ATOM 9223 CB LYS B 578 24.646 13.003 -54.844 1.00 43.86 C
ATOM 9224 CG LYS B 578 23.712 13.018 -53.671 1.00 43.86 C
ATOM 9225 CD LYS B 578 22.314 12.632 -54.074 1.00 43.86 C
ATOM 9226 CE LYS B 578 21.393 12.748 -52.887 1.00 43.86 C
ATOM 9227 NZ LYS B 578 19.988 12.424 -53.238 1.00 43.86 N
ATOM 9228 N VAL B 579 27.288 14.053 -56.476 1.00 41.77 N
ATOM 9229 CA VAL B 579 28.262 13.856 -57.542 1.00 41.77 C
ATOM 9230 C VAL B 579 29.670 13.864 -56.985 1.00 41.77 C
ATOM 9231 O VAL B 579 30.473 12.973 -57.284 1.00 41.77 O
ATOM 9232 CB VAL B 579 28.080 14.921 -58.631 1.00 41.77 C
ATOM 9233 CG1 VAL B 579 29.228 14.881 -59.602 1.00 41.77 C
ATOM 9234 CG2 VAL B 579 26.799 14.654 -59.349 1.00 41.77 C
ATOM 9235 N ILE B 580 29.989 14.840 -56.141 1.00 37.87 N
ATOM 9236 CA ILE B 580 31.363 14.932 -55.668 1.00 37.87 C
ATOM 9237 C ILE B 580 31.670 13.884 -54.600 1.00 37.87 C
ATOM 9238 O ILE B 580 32.841 13.665 -54.278 1.00 37.87 O
ATOM 9239 CB ILE B 580 31.645 16.356 -55.169 1.00 37.87 C
ATOM 9240 CG1 ILE B 580 33.118 16.684 -55.324 1.00 37.87 C
ATOM 9241 CG2 ILE B 580 31.262 16.510 -53.721 1.00 37.87 C
ATOM 9242 CD1 ILE B 580 33.537 16.737 -56.755 1.00 37.87 C
ATOM 9243 N TRP B 581 30.656 13.194 -54.073 1.00 38.04 N
ATOM 9244 CA TRP B 581 30.908 12.138 -53.098 1.00 38.04 C
ATOM 9245 C TRP B 581 31.500 10.902 -53.752 1.00 38.04 C
ATOM 9246 O TRP B 581 32.195 10.119 -53.103 1.00 38.04 O
ATOM 9247 CB TRP B 581 29.615 11.776 -52.382 1.00 38.04 C
ATOM 9248 CG TRP B 581 29.762 10.706 -51.375 1.00 38.04 C
ATOM 9249 CD1 TRP B 581 30.417 10.783 -50.200 1.00 38.04 C
ATOM 9250 CD2 TRP B 581 29.256 9.381 -51.469 1.00 38.04 C
ATOM 9251 NE1 TRP B 581 30.342 9.589 -49.537 1.00 38.04 N
ATOM 9252 CE2 TRP B 581 29.631 8.709 -50.303 1.00 38.04 C
ATOM 9253 CE3 TRP B 581 28.514 8.698 -52.429 1.00 38.04 C
ATOM 9254 CZ2 TRP B 581 29.292 7.393 -50.067 1.00 38.04 C
ATOM 9255 CZ3 TRP B 581 28.180 7.395 -52.195 1.00 38.04 C
ATOM 9256 CH2 TRP B 581 28.564 6.754 -51.025 1.00 38.04 C
ATOM 9257 N GLU B 582 31.255 10.716 -55.044 1.00 46.01 N
ATOM 9258 CA GLU B 582 31.696 9.486 -55.685 1.00 46.01 C
ATOM 9259 C GLU B 582 33.163 9.551 -56.082 1.00 46.01 C
ATOM 9260 O GLU B 582 33.701 8.590 -56.637 1.00 46.01 O
ATOM 9261 CB GLU B 582 30.826 9.191 -56.898 1.00 46.01 C
ATOM 9262 CG GLU B 582 29.394 8.880 -56.537 1.00 46.01 C
ATOM 9263 CD GLU B 582 28.530 8.649 -57.754 1.00 46.01 C
ATOM 9264 OE1 GLU B 582 29.043 8.792 -58.882 1.00 46.01 O
ATOM 9265 OE2 GLU B 582 27.333 8.344 -57.582 1.00 46.01 O
ATOM 9266 N GLN B 583 33.827 10.676 -55.833 1.00 46.25 N
ATOM 9267 CA GLN B 583 35.226 10.772 -56.223 1.00 46.25 C
ATOM 9268 C GLN B 583 36.149 10.734 -55.015 1.00 46.25 C
ATOM 9269 O GLN B 583 37.370 10.633 -55.168 1.00 46.25 O
ATOM 9270 CB GLN B 583 35.453 12.044 -57.027 1.00 46.25 C
ATOM 9271 CG GLN B 583 34.585 12.123 -58.247 1.00 46.25 C
ATOM 9272 CD GLN B 583 34.879 11.029 -59.221 1.00 46.25 C
ATOM 9273 OE1 GLN B 583 36.033 10.664 -59.430 1.00 46.25 O
ATOM 9274 NE2 GLN B 583 33.836 10.492 -59.833 1.00 46.25 N
ATOM 9275 N THR B 584 35.597 10.828 -53.809 1.00 45.48 N
ATOM 9276 CA THR B 584 36.452 10.910 -52.633 1.00 45.48 C
ATOM 9277 C THR B 584 36.977 9.530 -52.263 1.00 45.48 C
ATOM 9278 O THR B 584 36.456 8.508 -52.709 1.00 45.48 O
ATOM 9279 CB THR B 584 35.700 11.533 -51.461 1.00 45.48 C
ATOM 9280 OG1 THR B 584 36.614 11.773 -50.389 1.00 45.48 O
ATOM 9281 CG2 THR B 584 34.624 10.617 -50.973 1.00 45.48 C
ATOM 9282 N ARG B 585 38.043 9.505 -51.467 1.00 48.64 N
ATOM 9283 CA ARG B 585 38.743 8.247 -51.242 1.00 48.64 C
ATOM 9284 C ARG B 585 38.076 7.426 -50.150 1.00 48.64 C
ATOM 9285 O ARG B 585 37.603 6.316 -50.406 1.00 48.64 O
ATOM 9286 CB ARG B 585 40.203 8.516 -50.901 1.00 48.64 C
ATOM 9287 CG ARG B 585 40.915 9.341 -51.953 1.00 48.64 C
ATOM 9288 CD ARG B 585 41.015 8.621 -53.287 1.00 48.64 C
ATOM 9289 NE ARG B 585 41.947 7.500 -53.273 1.00 48.64 N
ATOM 9290 CZ ARG B 585 41.975 6.551 -54.201 1.00 48.64 C
ATOM 9291 NH1 ARG B 585 41.118 6.585 -55.209 1.00 48.64 N
ATOM 9292 NH2 ARG B 585 42.858 5.569 -54.123 1.00 48.64 N
ATOM 9293 N GLY B 586 38.015 7.951 -48.931 1.00 47.83 N
ATOM 9294 CA GLY B 586 37.423 7.204 -47.839 1.00 47.83 C
ATOM 9295 C GLY B 586 35.928 7.414 -47.803 1.00 47.83 C
ATOM 9296 O GLY B 586 35.449 8.411 -47.263 1.00 47.83 O
ATOM 9297 N CYS B 587 35.178 6.457 -48.349 1.00 47.07 N
ATOM 9298 CA CYS B 587 33.807 6.739 -48.758 1.00 47.07 C
ATOM 9299 C CYS B 587 32.861 6.772 -47.567 1.00 47.07 C
ATOM 9300 O CYS B 587 32.160 7.771 -47.349 1.00 47.07 O
ATOM 9301 CB CYS B 587 33.368 5.701 -49.779 1.00 47.07 C
ATOM 9302 SG CYS B 587 34.490 5.656 -51.171 1.00 47.07 S
ATOM 9303 N THR B 588 32.840 5.697 -46.774 1.00 43.32 N
ATOM 9304 CA THR B 588 31.937 5.639 -45.630 1.00 43.32 C
ATOM 9305 C THR B 588 32.332 6.644 -44.559 1.00 43.32 C
ATOM 9306 O THR B 588 31.468 7.198 -43.865 1.00 43.32 O
ATOM 9307 CB THR B 588 31.883 4.228 -45.058 1.00 43.32 C
ATOM 9308 OG1 THR B 588 31.061 4.227 -43.892 1.00 43.32 O
ATOM 9309 CG2 THR B 588 33.246 3.716 -44.709 1.00 43.32 C
ATOM 9310 N LEU B 589 33.627 6.949 -44.459 1.00 43.21 N
ATOM 9311 CA LEU B 589 34.081 7.936 -43.494 1.00 43.21 C
ATOM 9312 C LEU B 589 33.615 9.325 -43.887 1.00 43.21 C
ATOM 9313 O LEU B 589 33.154 10.093 -43.037 1.00 43.21 O
ATOM 9314 CB LEU B 589 35.596 7.893 -43.385 1.00 43.21 C
ATOM 9315 CG LEU B 589 36.154 8.847 -42.349 1.00 43.21 C
ATOM 9316 CD1 LEU B 589 35.645 8.458 -40.990 1.00 43.21 C
ATOM 9317 CD2 LEU B 589 37.654 8.802 -42.390 1.00 43.21 C
ATOM 9318 N ALA B 590 33.683 9.643 -45.180 1.00 42.37 N
ATOM 9319 CA ALA B 590 33.234 10.947 -45.645 1.00 42.37 C
ATOM 9320 C ALA B 590 31.729 11.090 -45.516 1.00 42.37 C
ATOM 9321 O ALA B 590 31.232 12.166 -45.153 1.00 42.37 O
ATOM 9322 CB ALA B 590 33.665 11.172 -47.088 1.00 42.37 C
ATOM 9323 N ALA B 591 30.990 10.010 -45.788 1.00 39.14 N
ATOM 9324 CA ALA B 591 29.542 10.053 -45.629 1.00 39.14 C
ATOM 9325 C ALA B 591 29.157 10.284 -44.178 1.00 39.14 C
ATOM 9326 O ALA B 591 28.291 11.121 -43.875 1.00 39.14 O
ATOM 9327 CB ALA B 591 28.926 8.760 -46.145 1.00 39.14 C
ATOM 9328 N LEU B 592 29.851 9.622 -43.259 1.00 36.57 N
ATOM 9329 CA LEU B 592 29.465 9.751 -41.867 1.00 36.57 C
ATOM 9330 C LEU B 592 29.913 11.095 -41.301 1.00 36.57 C
ATOM 9331 O LEU B 592 29.245 11.668 -40.427 1.00 36.57 O
ATOM 9332 CB LEU B 592 30.048 8.597 -41.076 1.00 36.57 C
ATOM 9333 CG LEU B 592 29.228 8.378 -39.826 1.00 36.57 C
ATOM 9334 CD1 LEU B 592 27.903 7.821 -40.253 1.00 36.57 C
ATOM 9335 CD2 LEU B 592 29.915 7.440 -38.905 1.00 36.57 C
ATOM 9336 N GLY B 593 31.016 11.636 -41.821 1.00 38.94 N
ATOM 9337 CA GLY B 593 31.422 12.976 -41.433 1.00 38.94 C
ATOM 9338 C GLY B 593 30.450 14.038 -41.898 1.00 38.94 C
ATOM 9339 O GLY B 593 30.180 15.001 -41.174 1.00 38.94 O
ATOM 9340 N ALA B 594 29.900 13.871 -43.101 1.00 37.30 N
ATOM 9341 CA ALA B 594 28.871 14.794 -43.566 1.00 37.30 C
ATOM 9342 C ALA B 594 27.625 14.708 -42.700 1.00 37.30 C
ATOM 9343 O ALA B 594 26.973 15.728 -42.441 1.00 37.30 O
ATOM 9344 CB ALA B 594 28.526 14.514 -45.023 1.00 37.30 C
ATOM 9345 N SER B 595 27.297 13.505 -42.215 1.00 37.82 N
ATOM 9346 CA SER B 595 26.152 13.378 -41.314 1.00 37.82 C
ATOM 9347 C SER B 595 26.385 14.116 -40.002 1.00 37.82 C
ATOM 9348 O SER B 595 25.508 14.862 -39.536 1.00 37.82 O
ATOM 9349 CB SER B 595 25.861 11.919 -41.011 1.00 37.82 C
ATOM 9350 OG SER B 595 26.840 11.415 -40.131 1.00 37.82 O
ATOM 9351 N LYS B 596 27.565 13.942 -39.398 1.00 36.83 N
ATOM 9352 CA LYS B 596 27.808 14.572 -38.100 1.00 36.83 C
ATOM 9353 C LYS B 596 27.996 16.077 -38.244 1.00 36.83 C
ATOM 9354 O LYS B 596 27.789 16.833 -37.291 1.00 36.83 O
ATOM 9355 CB LYS B 596 29.008 13.932 -37.410 1.00 36.83 C
ATOM 9356 CG LYS B 596 29.135 14.260 -35.929 1.00 36.83 C
ATOM 9357 CD LYS B 596 30.151 15.335 -35.646 1.00 36.83 C
ATOM 9358 CE LYS B 596 30.253 15.604 -34.172 1.00 36.83 C
ATOM 9359 NZ LYS B 596 28.992 16.217 -33.687 1.00 36.83 N
ATOM 9360 N LEU B 597 28.355 16.536 -39.438 1.00 35.14 N
ATOM 9361 CA LEU B 597 28.416 17.973 -39.664 1.00 35.14 C
ATOM 9362 C LEU B 597 27.023 18.566 -39.818 1.00 35.14 C
ATOM 9363 O LEU B 597 26.725 19.632 -39.259 1.00 35.14 O
ATOM 9364 CB LEU B 597 29.261 18.260 -40.895 1.00 35.14 C
ATOM 9365 CG LEU B 597 29.494 19.721 -41.204 1.00 35.14 C
ATOM 9366 CD1 LEU B 597 30.216 20.354 -40.063 1.00 35.14 C
ATOM 9367 CD2 LEU B 597 30.324 19.812 -42.443 1.00 35.14 C
ATOM 9368 N LEU B 598 26.148 17.890 -40.560 1.00 34.60 N
ATOM 9369 CA LEU B 598 24.841 18.473 -40.821 1.00 34.60 C
ATOM 9370 C LEU B 598 23.930 18.414 -39.607 1.00 34.60 C
ATOM 9371 O LEU B 598 23.023 19.240 -39.487 1.00 34.60 O
ATOM 9372 CB LEU B 598 24.176 17.803 -42.006 1.00 34.60 C
ATOM 9373 CG LEU B 598 24.816 18.184 -43.320 1.00 34.60 C
ATOM 9374 CD1 LEU B 598 24.112 17.450 -44.425 1.00 34.60 C
ATOM 9375 CD2 LEU B 598 24.722 19.664 -43.515 1.00 34.60 C
ATOM 9376 N LYS B 599 24.145 17.460 -38.694 1.00 39.19 N
ATOM 9377 CA LYS B 599 23.383 17.501 -37.443 1.00 39.19 C
ATOM 9378 C LYS B 599 23.693 18.762 -36.644 1.00 39.19 C
ATOM 9379 O LYS B 599 22.780 19.445 -36.155 1.00 39.19 O
ATOM 9380 CB LYS B 599 23.666 16.274 -36.588 1.00 39.19 C
ATOM 9381 CG LYS B 599 23.229 14.969 -37.176 1.00 39.19 C
ATOM 9382 CD LYS B 599 21.743 14.791 -37.188 1.00 39.19 C
ATOM 9383 CE LYS B 599 21.440 13.399 -37.701 1.00 39.19 C
ATOM 9384 NZ LYS B 599 19.993 13.096 -37.768 1.00 39.19 N
ATOM 9385 N SER B 600 24.975 19.108 -36.534 1.00 38.87 N
ATOM 9386 CA SER B 600 25.356 20.284 -35.762 1.00 38.87 C
ATOM 9387 C SER B 600 24.962 21.565 -36.476 1.00 38.87 C
ATOM 9388 O SER B 600 24.715 22.588 -35.832 1.00 38.87 O
ATOM 9389 CB SER B 600 26.852 20.267 -35.486 1.00 38.87 C
ATOM 9390 OG SER B 600 27.231 21.419 -34.765 1.00 38.87 O
ATOM 9391 N MET B 601 24.904 21.538 -37.805 1.00 41.08 N
ATOM 9392 CA MET B 601 24.309 22.669 -38.512 1.00 41.08 C
ATOM 9393 C MET B 601 22.802 22.723 -38.310 1.00 41.08 C
ATOM 9394 O MET B 601 22.196 23.791 -38.418 1.00 41.08 O
ATOM 9395 CB MET B 601 24.637 22.598 -39.995 1.00 41.08 C
ATOM 9396 CG MET B 601 26.008 23.085 -40.342 1.00 41.08 C
ATOM 9397 SD MET B 601 26.060 24.859 -40.156 1.00 41.08 S
ATOM 9398 CE MET B 601 24.968 25.308 -41.497 1.00 41.08 C
ATOM 9399 N ALA B 602 22.174 21.580 -38.045 1.00 42.10 N
ATOM 9400 CA ALA B 602 20.724 21.563 -37.905 1.00 42.10 C
ATOM 9401 C ALA B 602 20.287 21.994 -36.515 1.00 42.10 C
ATOM 9402 O ALA B 602 19.130 22.375 -36.318 1.00 42.10 O
ATOM 9403 CB ALA B 602 20.182 20.174 -38.223 1.00 42.10 C
ATOM 9404 N LYS B 603 21.186 21.929 -35.530 1.00 50.03 N
ATOM 9405 CA LYS B 603 20.799 22.341 -34.180 1.00 50.03 C
ATOM 9406 C LYS B 603 20.639 23.851 -34.042 1.00 50.03 C
ATOM 9407 O LYS B 603 20.154 24.328 -33.012 1.00 50.03 O
ATOM 9408 CB LYS B 603 21.807 21.863 -33.143 1.00 50.03 C
ATOM 9409 CG LYS B 603 21.705 20.425 -32.754 1.00 50.03 C
ATOM 9410 CD LYS B 603 22.684 20.173 -31.638 1.00 50.03 C
ATOM 9411 CE LYS B 603 22.654 18.743 -31.180 1.00 50.03 C
ATOM 9412 NZ LYS B 603 23.645 18.536 -30.095 1.00 50.03 N
ATOM 9413 N VAL B 604 21.076 24.629 -35.033 1.00 54.31 N
ATOM 9414 CA VAL B 604 20.923 26.073 -34.930 1.00 54.31 C
ATOM 9415 C VAL B 604 19.467 26.426 -35.199 1.00 54.31 C
ATOM 9416 O VAL B 604 18.718 25.641 -35.793 1.00 54.31 O
ATOM 9417 CB VAL B 604 21.878 26.790 -35.898 1.00 54.31 C
ATOM 9418 CG1 VAL B 604 21.337 26.773 -37.304 1.00 54.31 C
ATOM 9419 CG2 VAL B 604 22.204 28.191 -35.419 1.00 54.31 C
ATOM 9420 N LYS B 605 19.034 27.586 -34.706 1.00 61.19 N
ATOM 9421 CA LYS B 605 17.640 27.997 -34.802 1.00 61.19 C
ATOM 9422 C LYS B 605 17.486 29.434 -35.273 1.00 61.19 C
ATOM 9423 O LYS B 605 16.528 30.104 -34.881 1.00 61.19 O
ATOM 9424 CB LYS B 605 16.944 27.818 -33.455 1.00 61.19 C
ATOM 9425 CG LYS B 605 16.818 26.375 -32.998 1.00 61.19 C
ATOM 9426 CD LYS B 605 16.224 26.285 -31.614 1.00 61.19 C
ATOM 9427 CE LYS B 605 16.217 24.856 -31.113 1.00 61.19 C
ATOM 9428 NZ LYS B 605 15.663 24.768 -29.738 1.00 61.19 N
ATOM 9429 N ASN B 606 18.414 29.934 -36.083 1.00 57.88 N
ATOM 9430 CA ASN B 606 18.278 31.289 -36.602 1.00 57.88 C
ATOM 9431 C ASN B 606 17.363 31.313 -37.819 1.00 57.88 C
ATOM 9432 O ASN B 606 16.563 32.239 -37.992 1.00 57.88 O
ATOM 9433 CB ASN B 606 19.653 31.849 -36.947 1.00 57.88 C
ATOM 9434 CG ASN B 606 19.643 33.342 -37.135 1.00 57.88 C
ATOM 9435 OD1 ASN B 606 18.622 33.998 -36.963 1.00 57.88 O
ATOM 9436 ND2 ASN B 606 20.791 33.891 -37.495 1.00 57.88 N
ATOM 9437 N ASP B 607 17.470 30.305 -38.677 1.00 64.60 N
ATOM 9438 CA ASP B 607 16.698 30.217 -39.913 1.00 64.60 C
ATOM 9439 C ASP B 607 16.253 28.772 -40.066 1.00 64.60 C
ATOM 9440 O ASP B 607 17.087 27.864 -40.107 1.00 64.60 O
ATOM 9441 CB ASP B 607 17.538 30.667 -41.105 1.00 64.60 C
ATOM 9442 CG ASP B 607 16.720 30.870 -42.361 1.00 64.60 C
ATOM 9443 OD1 ASP B 607 15.487 30.677 -42.324 1.00 64.60 O
ATOM 9444 OD2 ASP B 607 17.320 31.228 -43.395 1.00 64.60 O
ATOM 9445 N ILE B 608 14.944 28.555 -40.167 1.00 58.76 N
ATOM 9446 CA ILE B 608 14.429 27.192 -40.102 1.00 58.76 C
ATOM 9447 C ILE B 608 14.387 26.565 -41.495 1.00 58.76 C
ATOM 9448 O ILE B 608 14.421 25.331 -41.641 1.00 58.76 O
ATOM 9449 CB ILE B 608 13.057 27.194 -39.400 1.00 58.76 C
ATOM 9450 CG1 ILE B 608 12.640 25.788 -38.993 1.00 58.76 C
ATOM 9451 CG2 ILE B 608 12.001 27.838 -40.261 1.00 58.76 C
ATOM 9452 CD1 ILE B 608 11.510 25.776 -38.019 1.00 58.76 C
ATOM 9453 N ASN B 609 14.385 27.402 -42.537 1.00 62.64 N
ATOM 9454 CA ASN B 609 14.249 26.912 -43.906 1.00 62.64 C
ATOM 9455 C ASN B 609 15.479 26.134 -44.349 1.00 62.64 C
ATOM 9456 O ASN B 609 15.363 25.122 -45.046 1.00 62.64 O
ATOM 9457 CB ASN B 609 14.001 28.077 -44.855 1.00 62.64 C
ATOM 9458 CG ASN B 609 12.645 28.683 -44.669 1.00 62.64 C
ATOM 9459 OD1 ASN B 609 11.658 27.973 -44.496 1.00 62.64 O
ATOM 9460 ND2 ASN B 609 12.580 30.007 -44.699 1.00 62.64 N
ATOM 9461 N ALA B 610 16.666 26.595 -43.965 1.00 62.38 N
ATOM 9462 CA ALA B 610 17.861 25.810 -44.237 1.00 62.38 C
ATOM 9463 C ALA B 610 17.937 24.604 -43.314 1.00 62.38 C
ATOM 9464 O ALA B 610 18.465 23.553 -43.699 1.00 62.38 O
ATOM 9465 CB ALA B 610 19.109 26.679 -44.095 1.00 62.38 C
ATOM 9466 N ALA B 611 17.387 24.728 -42.103 1.00 60.04 N
ATOM 9467 CA ALA B 611 17.568 23.696 -41.088 1.00 60.04 C
ATOM 9468 C ALA B 611 16.800 22.427 -41.427 1.00 60.04 C
ATOM 9469 O ALA B 611 17.305 21.313 -41.214 1.00 60.04 O
ATOM 9470 CB ALA B 611 17.144 24.223 -39.724 1.00 60.04 C
ATOM 9471 N GLY B 612 15.586 22.571 -41.964 1.00 64.17 N
ATOM 9472 CA GLY B 612 14.829 21.394 -42.367 1.00 64.17 C
ATOM 9473 C GLY B 612 15.502 20.612 -43.481 1.00 64.17 C
ATOM 9474 O GLY B 612 15.622 19.378 -43.410 1.00 64.17 O
ATOM 9475 N GLU B 613 16.001 21.325 -44.496 1.00 66.09 N
ATOM 9476 CA GLU B 613 16.700 20.676 -45.597 1.00 66.09 C
ATOM 9477 C GLU B 613 18.002 20.057 -45.126 1.00 66.09 C
ATOM 9478 O GLU B 613 18.421 19.009 -45.632 1.00 66.09 O
ATOM 9479 CB GLU B 613 16.975 21.683 -46.701 1.00 66.09 C
ATOM 9480 CG GLU B 613 15.726 22.286 -47.277 1.00 66.09 C
ATOM 9481 CD GLU B 613 16.024 23.296 -48.358 1.00 66.09 C
ATOM 9482 OE1 GLU B 613 17.218 23.550 -48.616 1.00 66.09 O
ATOM 9483 OE2 GLU B 613 15.066 23.850 -48.936 1.00 66.09 O
ATOM 9484 N SER B 614 18.632 20.673 -44.127 1.00 52.74 N
ATOM 9485 CA SER B 614 19.880 20.140 -43.606 1.00 52.74 C
ATOM 9486 C SER B 614 19.654 18.825 -42.880 1.00 52.74 C
ATOM 9487 O SER B 614 20.425 17.874 -43.053 1.00 52.74 O
ATOM 9488 CB SER B 614 20.538 21.156 -42.682 1.00 52.74 C
ATOM 9489 OG SER B 614 21.761 20.644 -42.193 1.00 52.74 O
ATOM 9490 N GLU B 615 18.582 18.733 -42.092 1.00 57.37 N
ATOM 9491 CA GLU B 615 18.352 17.478 -41.384 1.00 57.37 C
ATOM 9492 C GLU B 615 17.910 16.377 -42.344 1.00 57.37 C
ATOM 9493 O GLU B 615 18.273 15.201 -42.163 1.00 57.37 O
ATOM 9494 CB GLU B 615 17.340 17.674 -40.262 1.00 57.37 C
ATOM 9495 CG GLU B 615 17.260 16.492 -39.323 1.00 57.37 C
ATOM 9496 CD GLU B 615 16.404 16.772 -38.116 1.00 57.37 C
ATOM 9497 OE1 GLU B 615 15.851 17.884 -38.034 1.00 57.37 O
ATOM 9498 OE2 GLU B 615 16.291 15.886 -37.244 1.00 57.37 O
ATOM 9499 N GLU B 616 17.189 16.745 -43.413 1.00 61.87 N
ATOM 9500 CA GLU B 616 16.843 15.744 -44.425 1.00 61.87 C
ATOM 9501 C GLU B 616 18.074 15.239 -45.167 1.00 61.87 C
ATOM 9502 O GLU B 616 18.196 14.034 -45.429 1.00 61.87 O
ATOM 9503 CB GLU B 616 15.833 16.293 -45.423 1.00 61.87 C
ATOM 9504 CG GLU B 616 14.439 16.436 -44.867 1.00 61.87 C
ATOM 9505 CD GLU B 616 13.449 16.934 -45.901 1.00 61.87 C
ATOM 9506 OE1 GLU B 616 13.877 17.269 -47.026 1.00 61.87 O
ATOM 9507 OE2 GLU B 616 12.239 16.994 -45.592 1.00 61.87 O
ATOM 9508 N LEU B 617 19.001 16.139 -45.507 1.00 45.35 N
ATOM 9509 CA LEU B 617 20.219 15.709 -46.183 1.00 45.35 C
ATOM 9510 C LEU B 617 21.086 14.857 -45.265 1.00 45.35 C
ATOM 9511 O LEU B 617 21.743 13.910 -45.721 1.00 45.35 O
ATOM 9512 CB LEU B 617 20.994 16.920 -46.686 1.00 45.35 C
ATOM 9513 CG LEU B 617 22.203 16.586 -47.546 1.00 45.35 C
ATOM 9514 CD1 LEU B 617 21.738 15.882 -48.780 1.00 45.35 C
ATOM 9515 CD2 LEU B 617 22.902 17.849 -47.936 1.00 45.35 C
ATOM 9516 N ALA B 618 21.049 15.137 -43.961 1.00 46.11 N
ATOM 9517 CA ALA B 618 21.811 14.328 -43.016 1.00 46.11 C
ATOM 9518 C ALA B 618 21.284 12.906 -42.941 1.00 46.11 C
ATOM 9519 O ALA B 618 22.069 11.946 -42.964 1.00 46.11 O
ATOM 9520 CB ALA B 618 21.779 14.962 -41.633 1.00 46.11 C
ATOM 9521 N ASN B 619 19.960 12.746 -42.857 1.00 50.92 N
ATOM 9522 CA ASN B 619 19.404 11.393 -42.831 1.00 50.92 C
ATOM 9523 C ASN B 619 19.637 10.668 -44.152 1.00 50.92 C
ATOM 9524 O ASN B 619 19.901 9.451 -44.168 1.00 50.92 O
ATOM 9525 CB ASN B 619 17.920 11.435 -42.495 1.00 50.92 C
ATOM 9526 CG ASN B 619 17.676 11.749 -41.049 1.00 50.92 C
ATOM 9527 OD1 ASN B 619 18.372 11.241 -40.174 1.00 50.92 O
ATOM 9528 ND2 ASN B 619 16.693 12.596 -40.780 1.00 50.92 N
ATOM 9529 N GLU B 620 19.602 11.407 -45.264 1.00 50.67 N
ATOM 9530 CA GLU B 620 19.853 10.792 -46.558 1.00 50.67 C
ATOM 9531 C GLU B 620 21.298 10.341 -46.712 1.00 50.67 C
ATOM 9532 O GLU B 620 21.551 9.345 -47.391 1.00 50.67 O
ATOM 9533 CB GLU B 620 19.469 11.760 -47.669 1.00 50.67 C
ATOM 9534 CG GLU B 620 19.458 11.148 -49.040 1.00 50.67 C
ATOM 9535 CD GLU B 620 18.938 12.098 -50.080 1.00 50.67 C
ATOM 9536 OE1 GLU B 620 18.656 13.260 -49.731 1.00 50.67 O
ATOM 9537 OE2 GLU B 620 18.784 11.678 -51.242 1.00 50.67 O
ATOM 9538 N TYR B 621 22.249 11.009 -46.070 1.00 39.98 N
ATOM 9539 CA TYR B 621 23.611 10.483 -46.078 1.00 39.98 C
ATOM 9540 C TYR B 621 23.833 9.345 -45.098 1.00 39.98 C
ATOM 9541 O TYR B 621 24.660 8.463 -45.369 1.00 39.98 O
ATOM 9542 CB TYR B 621 24.633 11.583 -45.817 1.00 39.98 C
ATOM 9543 CG TYR B 621 25.130 12.207 -47.082 1.00 39.98 C
ATOM 9544 CD1 TYR B 621 26.126 11.600 -47.806 1.00 39.98 C
ATOM 9545 CD2 TYR B 621 24.607 13.385 -47.560 1.00 39.98 C
ATOM 9546 CE1 TYR B 621 26.594 12.144 -48.961 1.00 39.98 C
ATOM 9547 CE2 TYR B 621 25.070 13.945 -48.721 1.00 39.98 C
ATOM 9548 CZ TYR B 621 26.064 13.316 -49.418 1.00 39.98 C
ATOM 9549 OH TYR B 621 26.538 13.874 -50.577 1.00 39.98 O
ATOM 9550 N GLU B 622 23.108 9.327 -43.978 1.00 48.50 N
ATOM 9551 CA GLU B 622 23.248 8.211 -43.046 1.00 48.50 C
ATOM 9552 C GLU B 622 22.791 6.897 -43.669 1.00 48.50 C
ATOM 9553 O GLU B 622 23.473 5.867 -43.531 1.00 48.50 O
ATOM 9554 CB GLU B 622 22.464 8.479 -41.773 1.00 48.50 C
ATOM 9555 CG GLU B 622 22.651 7.398 -40.752 1.00 48.50 C
ATOM 9556 CD GLU B 622 21.747 7.552 -39.552 1.00 48.50 C
ATOM 9557 OE1 GLU B 622 20.970 8.529 -39.501 1.00 48.50 O
ATOM 9558 OE2 GLU B 622 21.795 6.672 -38.667 1.00 48.50 O
ATOM 9559 N THR B 623 21.665 6.918 -44.394 1.00 46.60 N
ATOM 9560 CA THR B 623 21.187 5.675 -45.006 1.00 46.60 C
ATOM 9561 C THR B 623 22.117 5.204 -46.117 1.00 46.60 C
ATOM 9562 O THR B 623 22.292 3.994 -46.318 1.00 46.60 O
ATOM 9563 CB THR B 623 19.780 5.839 -45.563 1.00 46.60 C
ATOM 9564 OG1 THR B 623 19.802 6.793 -46.627 1.00 46.60 O
ATOM 9565 CG2 THR B 623 18.831 6.306 -44.486 1.00 46.60 C
ATOM 9566 N ARG B 624 22.755 6.137 -46.819 1.00 41.66 N
ATOM 9567 CA ARG B 624 23.685 5.743 -47.866 1.00 41.66 C
ATOM 9568 C ARG B 624 24.944 5.134 -47.275 1.00 41.66 C
ATOM 9569 O ARG B 624 25.481 4.154 -47.811 1.00 41.66 O
ATOM 9570 CB ARG B 624 24.014 6.941 -48.738 1.00 41.66 C
ATOM 9571 CG ARG B 624 24.879 6.613 -49.910 1.00 41.66 C
ATOM 9572 CD ARG B 624 24.936 7.796 -50.815 1.00 41.66 C
ATOM 9573 NE ARG B 624 23.622 8.069 -51.374 1.00 41.66 N
ATOM 9574 CZ ARG B 624 23.327 9.154 -52.070 1.00 41.66 C
ATOM 9575 NH1 ARG B 624 24.254 10.072 -52.292 1.00 41.66 N
ATOM 9576 NH2 ARG B 624 22.106 9.327 -52.545 1.00 41.66 N
ATOM 9577 N ALA B 625 25.391 5.659 -46.135 1.00 38.37 N
ATOM 9578 CA ALA B 625 26.546 5.076 -45.466 1.00 38.37 C
ATOM 9579 C ALA B 625 26.252 3.666 -44.975 1.00 38.37 C
ATOM 9580 O ALA B 625 27.091 2.766 -45.110 1.00 38.37 O
ATOM 9581 CB ALA B 625 26.982 5.956 -44.306 1.00 38.37 C
ATOM 9582 N VAL B 626 25.048 3.436 -44.445 1.00 40.27 N
ATOM 9583 CA VAL B 626 24.785 2.107 -43.899 1.00 40.27 C
ATOM 9584 C VAL B 626 24.571 1.092 -45.022 1.00 40.27 C
ATOM 9585 O VAL B 626 24.982 -0.071 -44.902 1.00 40.27 O
ATOM 9586 CB VAL B 626 23.625 2.128 -42.882 1.00 40.27 C
ATOM 9587 CG1 VAL B 626 22.289 2.393 -43.509 1.00 40.27 C
ATOM 9588 CG2 VAL B 626 23.571 0.834 -42.140 1.00 40.27 C
ATOM 9589 N GLU B 627 24.014 1.523 -46.162 1.00 41.06 N
ATOM 9590 CA GLU B 627 23.867 0.597 -47.281 1.00 41.06 C
ATOM 9591 C GLU B 627 25.224 0.223 -47.871 1.00 41.06 C
ATOM 9592 O GLU B 627 25.475 -0.958 -48.163 1.00 41.06 O
ATOM 9593 CB GLU B 627 22.959 1.195 -48.352 1.00 41.06 C
ATOM 9594 N LEU B 628 26.124 1.210 -48.003 1.00 40.62 N
ATOM 9595 CA LEU B 628 27.474 0.930 -48.493 1.00 40.62 C
ATOM 9596 C LEU B 628 28.230 -0.004 -47.564 1.00 40.62 C
ATOM 9597 O LEU B 628 28.914 -0.923 -48.027 1.00 40.62 O
ATOM 9598 CB LEU B 628 28.263 2.222 -48.670 1.00 40.62 C
ATOM 9599 CG LEU B 628 29.736 2.043 -49.033 1.00 40.62 C
ATOM 9600 CD1 LEU B 628 29.884 1.371 -50.373 1.00 40.62 C
ATOM 9601 CD2 LEU B 628 30.446 3.361 -49.019 1.00 40.62 C
ATOM 9602 N PHE B 629 28.104 0.185 -46.253 1.00 40.82 N
ATOM 9603 CA PHE B 629 28.892 -0.669 -45.375 1.00 40.82 C
ATOM 9604 C PHE B 629 28.304 -2.066 -45.261 1.00 40.82 C
ATOM 9605 O PHE B 629 29.055 -3.019 -45.052 1.00 40.82 O
ATOM 9606 CB PHE B 629 29.043 -0.060 -43.996 1.00 40.82 C
ATOM 9607 CG PHE B 629 29.955 -0.833 -43.120 1.00 40.82 C
ATOM 9608 CD1 PHE B 629 31.311 -0.780 -43.312 1.00 40.82 C
ATOM 9609 CD2 PHE B 629 29.455 -1.637 -42.128 1.00 40.82 C
ATOM 9610 CE1 PHE B 629 32.150 -1.495 -42.509 1.00 40.82 C
ATOM 9611 CE2 PHE B 629 30.285 -2.353 -41.327 1.00 40.82 C
ATOM 9612 CZ PHE B 629 31.630 -2.289 -41.522 1.00 40.82 C
ATOM 9613 N THR B 630 26.986 -2.222 -45.417 1.00 43.93 N
ATOM 9614 CA THR B 630 26.431 -3.572 -45.488 1.00 43.93 C
ATOM 9615 C THR B 630 26.928 -4.304 -46.725 1.00 43.93 C
ATOM 9616 O THR B 630 27.352 -5.471 -46.642 1.00 43.93 O
ATOM 9617 CB THR B 630 24.908 -3.519 -45.473 1.00 43.93 C
ATOM 9618 OG1 THR B 630 24.472 -3.014 -44.208 1.00 43.93 O
ATOM 9619 CG2 THR B 630 24.312 -4.888 -45.681 1.00 43.93 C
ATOM 9620 N GLU B 631 26.945 -3.608 -47.864 1.00 48.54 N
ATOM 9621 CA GLU B 631 27.455 -4.218 -49.085 1.00 48.54 C
ATOM 9622 C GLU B 631 28.934 -4.568 -48.968 1.00 48.54 C
ATOM 9623 O GLU B 631 29.350 -5.653 -49.381 1.00 48.54 O
ATOM 9624 CB GLU B 631 27.216 -3.288 -50.265 1.00 48.54 C
ATOM 9625 CG GLU B 631 27.682 -3.857 -51.578 1.00 48.54 C
ATOM 9626 CD GLU B 631 26.883 -5.064 -52.013 1.00 48.54 C
ATOM 9627 OE1 GLU B 631 25.688 -5.166 -51.651 1.00 48.54 O
ATOM 9628 OE2 GLU B 631 27.452 -5.917 -52.726 1.00 48.54 O
ATOM 9629 N CYS B 632 29.726 -3.704 -48.333 1.00 48.09 N
ATOM 9630 CA CYS B 632 31.153 -3.979 -48.193 1.00 48.09 C
ATOM 9631 C CYS B 632 31.416 -5.043 -47.136 1.00 48.09 C
ATOM 9632 O CYS B 632 32.453 -5.711 -47.160 1.00 48.09 O
ATOM 9633 CB CYS B 632 31.891 -2.690 -47.857 1.00 48.09 C
ATOM 9634 SG CYS B 632 33.674 -2.829 -47.787 1.00 48.09 S
ATOM 9635 N TYR B 633 30.491 -5.221 -46.200 1.00 48.82 N
ATOM 9636 CA TYR B 633 30.684 -6.242 -45.182 1.00 48.82 C
ATOM 9637 C TYR B 633 30.267 -7.599 -45.705 1.00 48.82 C
ATOM 9638 O TYR B 633 30.578 -8.630 -45.099 1.00 48.82 O
ATOM 9639 CB TYR B 633 29.889 -5.874 -43.939 1.00 48.82 C
ATOM 9640 CG TYR B 633 30.137 -6.744 -42.745 1.00 48.82 C
ATOM 9641 CD1 TYR B 633 31.314 -6.640 -42.035 1.00 48.82 C
ATOM 9642 CD2 TYR B 633 29.188 -7.649 -42.315 1.00 48.82 C
ATOM 9643 CE1 TYR B 633 31.547 -7.416 -40.938 1.00 48.82 C
ATOM 9644 CE2 TYR B 633 29.416 -8.434 -41.214 1.00 48.82 C
ATOM 9645 CZ TYR B 633 30.603 -8.309 -40.532 1.00 48.82 C
ATOM 9646 OH TYR B 633 30.868 -9.079 -39.427 1.00 48.82 O
ATOM 9647 N SER B 634 29.520 -7.616 -46.809 1.00 49.58 N
ATOM 9648 CA SER B 634 29.135 -8.894 -47.399 1.00 49.58 C
ATOM 9649 C SER B 634 30.332 -9.672 -47.943 1.00 49.58 C
ATOM 9650 O SER B 634 30.332 -10.905 -47.901 1.00 49.58 O
ATOM 9651 CB SER B 634 28.098 -8.688 -48.495 1.00 49.58 C
ATOM 9652 OG SER B 634 26.864 -8.283 -47.936 1.00 49.58 O
ATOM 9653 N ASN B 635 31.361 -8.989 -48.455 1.00 52.14 N
ATOM 9654 CA ASN B 635 32.436 -9.734 -49.111 1.00 52.14 C
ATOM 9655 C ASN B 635 33.440 -10.312 -48.120 1.00 52.14 C
ATOM 9656 O ASN B 635 33.557 -11.533 -47.990 1.00 52.14 O
ATOM 9657 CB ASN B 635 33.160 -8.870 -50.138 1.00 52.14 C
ATOM 9658 CG ASN B 635 32.386 -8.734 -51.416 1.00 52.14 C
ATOM 9659 OD1 ASN B 635 31.612 -9.611 -51.775 1.00 52.14 O
ATOM 9660 ND2 ASN B 635 32.663 -7.690 -52.160 1.00 52.14 N
ATOM 9661 N ASP B 636 34.173 -9.463 -47.411 1.00 60.39 N
ATOM 9662 CA ASP B 636 35.348 -9.914 -46.670 1.00 60.39 C
ATOM 9663 C ASP B 636 35.330 -9.274 -45.295 1.00 60.39 C
ATOM 9664 O ASP B 636 35.483 -8.058 -45.179 1.00 60.39 O
ATOM 9665 CB ASP B 636 36.636 -9.567 -47.411 1.00 60.39 C
ATOM 9666 N GLU B 637 35.168 -10.094 -44.258 1.00 66.93 N
ATOM 9667 CA GLU B 637 34.881 -9.558 -42.934 1.00 66.93 C
ATOM 9668 C GLU B 637 36.108 -8.907 -42.308 1.00 66.93 C
ATOM 9669 O GLU B 637 35.996 -7.858 -41.655 1.00 66.93 O
ATOM 9670 CB GLU B 637 34.344 -10.667 -42.037 1.00 66.93 C
ATOM 9671 CG GLU B 637 33.852 -10.172 -40.700 1.00 66.93 C
ATOM 9672 CD GLU B 637 33.273 -11.276 -39.852 1.00 66.93 C
ATOM 9673 OE1 GLU B 637 33.300 -12.441 -40.297 1.00 66.93 O
ATOM 9674 OE2 GLU B 637 32.785 -10.977 -38.742 1.00 66.93 O
ATOM 9675 N ASP B 638 37.285 -9.506 -42.503 1.00 70.93 N
ATOM 9676 CA ASP B 638 38.502 -9.011 -41.864 1.00 70.93 C
ATOM 9677 C ASP B 638 38.889 -7.639 -42.392 1.00 70.93 C
ATOM 9678 O ASP B 638 39.194 -6.721 -41.615 1.00 70.93 O
ATOM 9679 CB ASP B 638 39.638 -10.000 -42.093 1.00 70.93 C
ATOM 9680 CG ASP B 638 39.392 -11.323 -41.416 1.00 70.93 C
ATOM 9681 OD1 ASP B 638 38.710 -11.329 -40.370 1.00 70.93 O
ATOM 9682 OD2 ASP B 638 39.872 -12.355 -41.932 1.00 70.93 O
ATOM 9683 N LEU B 639 38.846 -7.477 -43.711 1.00 64.34 N
ATOM 9684 CA LEU B 639 39.164 -6.190 -44.307 1.00 64.34 C
ATOM 9685 C LEU B 639 38.094 -5.154 -43.984 1.00 64.34 C
ATOM 9686 O LEU B 639 38.401 -3.967 -43.845 1.00 64.34 O
ATOM 9687 CB LEU B 639 39.340 -6.353 -45.809 1.00 64.34 C
ATOM 9688 CG LEU B 639 40.549 -7.189 -46.200 1.00 64.34 C
ATOM 9689 CD1 LEU B 639 40.578 -7.388 -47.697 1.00 64.34 C
ATOM 9690 CD2 LEU B 639 41.810 -6.508 -45.723 1.00 64.34 C
ATOM 9691 N ALA B 640 36.847 -5.591 -43.800 1.00 58.53 N
ATOM 9692 CA ALA B 640 35.787 -4.656 -43.437 1.00 58.53 C
ATOM 9693 C ALA B 640 35.972 -4.125 -42.022 1.00 58.53 C
ATOM 9694 O ALA B 640 35.742 -2.940 -41.762 1.00 58.53 O
ATOM 9695 CB ALA B 640 34.424 -5.323 -43.580 1.00 58.53 C
ATOM 9696 N GLU B 641 36.422 -4.966 -41.097 1.00 61.12 N
ATOM 9697 CA GLU B 641 36.611 -4.466 -39.739 1.00 61.12 C
ATOM 9698 C GLU B 641 37.876 -3.628 -39.626 1.00 61.12 C
ATOM 9699 O GLU B 641 37.922 -2.645 -38.866 1.00 61.12 O
ATOM 9700 CB GLU B 641 36.630 -5.621 -38.758 1.00 61.12 C
ATOM 9701 CG GLU B 641 35.281 -6.264 -38.644 1.00 61.12 C
ATOM 9702 CD GLU B 641 35.296 -7.441 -37.722 1.00 61.12 C
ATOM 9703 OE1 GLU B 641 36.402 -7.809 -37.275 1.00 61.12 O
ATOM 9704 OE2 GLU B 641 34.211 -7.994 -37.448 1.00 61.12 O
ATOM 9705 N GLN B 642 38.906 -3.983 -40.395 1.00 60.14 N
ATOM 9706 CA GLN B 642 40.074 -3.117 -40.492 1.00 60.14 C
ATOM 9707 C GLN B 642 39.710 -1.783 -41.133 1.00 60.14 C
ATOM 9708 O GLN B 642 40.313 -0.750 -40.822 1.00 60.14 O
ATOM 9709 CB GLN B 642 41.167 -3.833 -41.278 1.00 60.14 C
ATOM 9710 CG GLN B 642 42.508 -3.150 -41.294 1.00 60.14 C
ATOM 9711 CD GLN B 642 43.549 -3.991 -41.994 1.00 60.14 C
ATOM 9712 OE1 GLN B 642 43.248 -5.079 -42.484 1.00 60.14 O
ATOM 9713 NE2 GLN B 642 44.778 -3.498 -42.047 1.00 60.14 N
ATOM 9714 N LEU B 643 38.700 -1.781 -42.004 1.00 52.69 N
ATOM 9715 CA LEU B 643 38.183 -0.538 -42.560 1.00 52.69 C
ATOM 9716 C LEU B 643 37.406 0.257 -41.520 1.00 52.69 C
ATOM 9717 O LEU B 643 37.349 1.489 -41.595 1.00 52.69 O
ATOM 9718 CB LEU B 643 37.318 -0.856 -43.780 1.00 52.69 C
ATOM 9719 CG LEU B 643 36.762 0.201 -44.733 1.00 52.69 C
ATOM 9720 CD1 LEU B 643 35.449 0.786 -44.284 1.00 52.69 C
ATOM 9721 CD2 LEU B 643 37.776 1.294 -44.884 1.00 52.69 C
ATOM 9722 N LEU B 644 36.744 -0.427 -40.585 1.00 49.65 N
ATOM 9723 CA LEU B 644 36.088 0.287 -39.490 1.00 49.65 C
ATOM 9724 C LEU B 644 37.087 1.017 -38.618 1.00 49.65 C
ATOM 9725 O LEU B 644 36.945 2.217 -38.370 1.00 49.65 O
ATOM 9726 CB LEU B 644 35.272 -0.644 -38.607 1.00 49.65 C
ATOM 9727 CG LEU B 644 33.909 -1.071 -39.087 1.00 49.65 C
ATOM 9728 CD1 LEU B 644 33.314 -2.012 -38.085 1.00 49.65 C
ATOM 9729 CD2 LEU B 644 33.062 0.149 -39.220 1.00 49.65 C
ATOM 9730 N THR B 645 38.106 0.320 -38.138 1.00 56.30 N
ATOM 9731 CA THR B 645 38.975 0.950 -37.154 1.00 56.30 C
ATOM 9732 C THR B 645 40.015 1.889 -37.761 1.00 56.30 C
ATOM 9733 O THR B 645 40.859 2.407 -37.026 1.00 56.30 O
ATOM 9734 CB THR B 645 39.672 -0.116 -36.312 1.00 56.30 C
ATOM 9735 OG1 THR B 645 40.411 0.514 -35.260 1.00 56.30 O
ATOM 9736 CG2 THR B 645 40.608 -0.938 -37.173 1.00 56.30 C
ATOM 9737 N TYR B 646 39.970 2.139 -39.063 1.00 58.23 N
ATOM 9738 CA TYR B 646 40.945 3.011 -39.704 1.00 58.23 C
ATOM 9739 C TYR B 646 40.618 4.474 -39.455 1.00 58.23 C
ATOM 9740 O TYR B 646 39.448 4.855 -39.406 1.00 58.23 O
ATOM 9741 CB TYR B 646 40.970 2.723 -41.196 1.00 58.23 C
ATOM 9742 CG TYR B 646 41.841 3.638 -41.995 1.00 58.23 C
ATOM 9743 CD1 TYR B 646 43.211 3.627 -41.832 1.00 58.23 C
ATOM 9744 CD2 TYR B 646 41.296 4.470 -42.953 1.00 58.23 C
ATOM 9745 CE1 TYR B 646 44.015 4.449 -42.568 1.00 58.23 C
ATOM 9746 CE2 TYR B 646 42.092 5.293 -43.705 1.00 58.23 C
ATOM 9747 CZ TYR B 646 43.453 5.279 -43.506 1.00 58.23 C
ATOM 9748 OH TYR B 646 44.265 6.097 -44.247 1.00 58.23 O
ATOM 9749 N SER B 647 41.649 5.300 -39.308 1.00 60.27 N
ATOM 9750 CA SER B 647 41.484 6.725 -39.058 1.00 60.27 C
ATOM 9751 C SER B 647 42.199 7.534 -40.128 1.00 60.27 C
ATOM 9752 O SER B 647 43.179 7.069 -40.714 1.00 60.27 O
ATOM 9753 CB SER B 647 42.027 7.103 -37.685 1.00 60.27 C
ATOM 9754 OG SER B 647 43.427 6.917 -37.636 1.00 60.27 O
ATOM 9755 N CYS B 648 41.705 8.748 -40.385 1.00 65.41 N
ATOM 9756 CA CYS B 648 42.362 9.670 -41.301 1.00 65.41 C
ATOM 9757 C CYS B 648 42.504 11.042 -40.664 1.00 65.41 C
ATOM 9758 O CYS B 648 41.881 11.342 -39.645 1.00 65.41 O
ATOM 9759 CB CYS B 648 41.622 9.839 -42.616 1.00 65.41 C
ATOM 9760 SG CYS B 648 42.569 10.884 -43.741 1.00 65.41 S
ATOM 9761 N GLU B 649 43.344 11.875 -41.282 1.00 75.19 N
ATOM 9762 CA GLU B 649 43.577 13.222 -40.777 1.00 75.19 C
ATOM 9763 C GLU B 649 42.647 14.255 -41.387 1.00 75.19 C
ATOM 9764 O GLU B 649 42.617 15.387 -40.897 1.00 75.19 O
ATOM 9765 CB GLU B 649 45.011 13.661 -41.047 1.00 75.19 C
ATOM 9766 CG GLU B 649 46.058 12.985 -40.209 1.00 75.19 C
ATOM 9767 CD GLU B 649 47.449 13.425 -40.604 1.00 75.19 C
ATOM 9768 OE1 GLU B 649 47.577 14.117 -41.636 1.00 75.19 O
ATOM 9769 OE2 GLU B 649 48.410 13.091 -39.884 1.00 75.19 O
ATOM 9770 N ALA B 650 41.938 13.914 -42.467 1.00 60.49 N
ATOM 9771 CA ALA B 650 41.101 14.894 -43.155 1.00 60.49 C
ATOM 9772 C ALA B 650 39.941 15.331 -42.279 1.00 60.49 C
ATOM 9773 O ALA B 650 39.625 16.520 -42.190 1.00 60.49 O
ATOM 9774 CB ALA B 650 40.584 14.316 -44.468 1.00 60.49 C
ATOM 9775 N TRP B 651 39.309 14.380 -41.615 1.00 47.52 N
ATOM 9776 CA TRP B 651 38.355 14.664 -40.561 1.00 47.52 C
ATOM 9777 C TRP B 651 39.131 14.784 -39.265 1.00 47.52 C
ATOM 9778 O TRP B 651 40.358 14.691 -39.250 1.00 47.52 O
ATOM 9779 CB TRP B 651 37.307 13.561 -40.499 1.00 47.52 C
ATOM 9780 CG TRP B 651 36.671 13.408 -41.816 1.00 47.52 C
ATOM 9781 CD1 TRP B 651 37.036 12.547 -42.791 1.00 47.52 C
ATOM 9782 CD2 TRP B 651 35.577 14.157 -42.332 1.00 47.52 C
ATOM 9783 NE1 TRP B 651 36.239 12.704 -43.889 1.00 47.52 N
ATOM 9784 CE2 TRP B 651 35.330 13.690 -43.629 1.00 47.52 C
ATOM 9785 CE3 TRP B 651 34.777 15.174 -41.818 1.00 47.52 C
ATOM 9786 CZ2 TRP B 651 34.318 14.198 -44.417 1.00 47.52 C
ATOM 9787 CZ3 TRP B 651 33.773 15.674 -42.603 1.00 47.52 C
ATOM 9788 CH2 TRP B 651 33.550 15.189 -43.888 1.00 47.52 C
ATOM 9789 N GLY B 652 38.420 14.964 -38.164 1.00 64.50 N
ATOM 9790 CA GLY B 652 39.105 15.298 -36.931 1.00 64.50 C
ATOM 9791 C GLY B 652 39.885 14.185 -36.258 1.00 64.50 C
ATOM 9792 O GLY B 652 39.692 13.933 -35.066 1.00 64.50 O
ATOM 9793 N GLY B 653 40.810 13.566 -36.997 1.00 67.49 N
ATOM 9794 CA GLY B 653 41.634 12.463 -36.541 1.00 67.49 C
ATOM 9795 C GLY B 653 40.869 11.316 -35.918 1.00 67.49 C
ATOM 9796 O GLY B 653 41.252 10.820 -34.857 1.00 67.49 O
ATOM 9797 N SER B 654 39.785 10.891 -36.554 1.00 65.35 N
ATOM 9798 CA SER B 654 38.838 10.013 -35.891 1.00 65.35 C
ATOM 9799 C SER B 654 38.350 8.917 -36.822 1.00 65.35 C
ATOM 9800 O SER B 654 37.949 9.178 -37.958 1.00 65.35 O
ATOM 9801 CB SER B 654 37.654 10.813 -35.363 1.00 65.35 C
ATOM 9802 OG SER B 654 36.740 9.971 -34.691 1.00 65.35 O
ATOM 9803 N ASN B 655 38.373 7.690 -36.318 1.00 58.10 N
ATOM 9804 CA ASN B 655 37.832 6.545 -37.021 1.00 58.10 C
ATOM 9805 C ASN B 655 36.312 6.611 -37.070 1.00 58.10 C
ATOM 9806 O ASN B 655 35.675 7.346 -36.315 1.00 58.10 O
ATOM 9807 CB ASN B 655 38.292 5.255 -36.350 1.00 58.10 C
ATOM 9808 CG ASN B 655 38.137 5.304 -34.855 1.00 58.10 C
ATOM 9809 OD1 ASN B 655 37.697 6.307 -34.313 1.00 58.10 O
ATOM 9810 ND2 ASN B 655 38.503 4.223 -34.178 1.00 58.10 N
ATOM 9811 N CYS B 656 35.741 5.819 -37.982 1.00 49.67 N
ATOM 9812 CA CYS B 656 34.318 5.903 -38.300 1.00 49.67 C
ATOM 9813 C CYS B 656 33.446 5.510 -37.117 1.00 49.67 C
ATOM 9814 O CYS B 656 32.388 6.111 -36.881 1.00 49.67 O
ATOM 9815 CB CYS B 656 34.022 5.009 -39.499 1.00 49.67 C
ATOM 9816 SG CYS B 656 32.302 4.913 -39.984 1.00 49.67 S
ATOM 9817 N LEU B 657 33.893 4.530 -36.340 1.00 48.83 N
ATOM 9818 CA LEU B 657 33.058 3.989 -35.282 1.00 48.83 C
ATOM 9819 C LEU B 657 32.966 4.950 -34.108 1.00 48.83 C
ATOM 9820 O LEU B 657 31.969 4.953 -33.381 1.00 48.83 O
ATOM 9821 CB LEU B 657 33.602 2.625 -34.864 1.00 48.83 C
ATOM 9822 CG LEU B 657 32.800 1.651 -34.009 1.00 48.83 C
ATOM 9823 CD1 LEU B 657 32.968 1.893 -32.528 1.00 48.83 C
ATOM 9824 CD2 LEU B 657 31.347 1.753 -34.404 1.00 48.83 C
ATOM 9825 N GLU B 658 33.989 5.775 -33.901 1.00 57.17 N
ATOM 9826 CA GLU B 658 33.875 6.810 -32.882 1.00 57.17 C
ATOM 9827 C GLU B 658 33.012 7.954 -33.379 1.00 57.17 C
ATOM 9828 O GLU B 658 32.327 8.617 -32.593 1.00 57.17 O
ATOM 9829 CB GLU B 658 35.255 7.324 -32.495 1.00 57.17 C
ATOM 9830 CG GLU B 658 35.283 8.276 -31.326 1.00 57.17 C
ATOM 9831 CD GLU B 658 36.682 8.750 -31.023 1.00 57.17 C
ATOM 9832 OE1 GLU B 658 37.605 8.375 -31.777 1.00 57.17 O
ATOM 9833 OE2 GLU B 658 36.863 9.490 -30.033 1.00 57.17 O
ATOM 9834 N LEU B 659 33.026 8.192 -34.687 1.00 47.61 N
ATOM 9835 CA LEU B 659 32.275 9.309 -35.237 1.00 47.61 C
ATOM 9836 C LEU B 659 30.782 9.025 -35.206 1.00 47.61 C
ATOM 9837 O LEU B 659 29.970 9.947 -35.054 1.00 47.61 O
ATOM 9838 CB LEU B 659 32.738 9.587 -36.658 1.00 47.61 C
ATOM 9839 CG LEU B 659 32.250 10.889 -37.251 1.00 47.61 C
ATOM 9840 CD1 LEU B 659 32.865 12.015 -36.480 1.00 47.61 C
ATOM 9841 CD2 LEU B 659 32.658 10.945 -38.675 1.00 47.61 C
ATOM 9842 N ALA B 660 30.402 7.752 -35.338 1.00 52.44 N
ATOM 9843 CA ALA B 660 28.986 7.400 -35.288 1.00 52.44 C
ATOM 9844 C ALA B 660 28.390 7.652 -33.912 1.00 52.44 C
ATOM 9845 O ALA B 660 27.228 8.055 -33.799 1.00 52.44 O
ATOM 9846 CB ALA B 660 28.789 5.942 -35.677 1.00 52.44 C
ATOM 9847 N VAL B 661 29.167 7.430 -32.855 1.00 52.66 N
ATOM 9848 CA VAL B 661 28.650 7.636 -31.506 1.00 52.66 C
ATOM 9849 C VAL B 661 28.511 9.123 -31.209 1.00 52.66 C
ATOM 9850 O VAL B 661 27.524 9.561 -30.608 1.00 52.66 O
ATOM 9851 CB VAL B 661 29.549 6.917 -30.486 1.00 52.66 C
ATOM 9852 CG1 VAL B 661 29.139 7.234 -29.065 1.00 52.66 C
ATOM 9853 CG2 VAL B 661 29.478 5.430 -30.715 1.00 52.66 C
ATOM 9854 N GLU B 662 29.476 9.930 -31.656 1.00 60.58 N
ATOM 9855 CA GLU B 662 29.378 11.372 -31.449 1.00 60.58 C
ATOM 9856 C GLU B 662 28.268 11.981 -32.287 1.00 60.58 C
ATOM 9857 O GLU B 662 27.665 12.983 -31.890 1.00 60.58 O
ATOM 9858 CB GLU B 662 30.705 12.052 -31.763 1.00 60.58 C
ATOM 9859 CG GLU B 662 31.797 11.787 -30.754 1.00 60.58 C
ATOM 9860 CD GLU B 662 33.082 12.509 -31.101 1.00 60.58 C
ATOM 9861 OE1 GLU B 662 33.153 13.096 -32.202 1.00 60.58 O
ATOM 9862 OE2 GLU B 662 34.016 12.496 -30.271 1.00 60.58 O
ATOM 9863 N ALA B 663 27.980 11.393 -33.450 1.00 57.71 N
ATOM 9864 CA ALA B 663 26.864 11.878 -34.254 1.00 57.71 C
ATOM 9865 C ALA B 663 25.533 11.538 -33.611 1.00 57.71 C
ATOM 9866 O ALA B 663 24.524 12.196 -33.884 1.00 57.71 O
ATOM 9867 CB ALA B 663 26.931 11.295 -35.661 1.00 57.71 C
ATOM 9868 N ARG B 664 25.528 10.517 -32.745 1.00 61.59 N
ATOM 9869 CA ARG B 664 24.343 9.978 -32.076 1.00 61.59 C
ATOM 9870 C ARG B 664 23.277 9.593 -33.094 1.00 61.59 C
ATOM 9871 O ARG B 664 22.118 9.999 -33.001 1.00 61.59 O
ATOM 9872 CB ARG B 664 23.806 10.953 -31.020 1.00 61.59 C
ATOM 9873 CG ARG B 664 22.884 10.369 -29.955 1.00 61.59 C
ATOM 9874 CD ARG B 664 22.493 11.453 -28.986 1.00 61.59 C
ATOM 9875 NE ARG B 664 21.652 12.459 -29.622 1.00 61.59 N
ATOM 9876 CZ ARG B 664 21.391 13.650 -29.095 1.00 61.59 C
ATOM 9877 NH1 ARG B 664 21.921 13.988 -27.928 1.00 61.59 N
ATOM 9878 NH2 ARG B 664 20.611 14.507 -29.740 1.00 61.59 N
ATOM 9879 N ASP B 665 23.681 8.860 -34.122 1.00 58.74 N
ATOM 9880 CA ASP B 665 22.712 8.396 -35.096 1.00 58.74 C
ATOM 9881 C ASP B 665 22.363 6.933 -34.860 1.00 58.74 C
ATOM 9882 O ASP B 665 23.146 6.165 -34.300 1.00 58.74 O
ATOM 9883 CB ASP B 665 23.218 8.631 -36.518 1.00 58.74 C
ATOM 9884 CG ASP B 665 24.542 7.963 -36.807 1.00 58.74 C
ATOM 9885 OD1 ASP B 665 25.187 7.416 -35.892 1.00 58.74 O
ATOM 9886 OD2 ASP B 665 24.944 7.992 -37.985 1.00 58.74 O
ATOM 9887 N GLN B 666 21.163 6.558 -35.278 1.00 57.42 N
ATOM 9888 CA GLN B 666 20.567 5.298 -34.881 1.00 57.42 C
ATOM 9889 C GLN B 666 20.819 4.189 -35.881 1.00 57.42 C
ATOM 9890 O GLN B 666 20.990 3.034 -35.481 1.00 57.42 O
ATOM 9891 CB GLN B 666 19.059 5.468 -34.713 1.00 57.42 C
ATOM 9892 CG GLN B 666 18.635 6.636 -33.864 1.00 57.42 C
ATOM 9893 CD GLN B 666 19.083 6.513 -32.445 1.00 57.42 C
ATOM 9894 OE1 GLN B 666 19.117 5.420 -31.890 1.00 57.42 O
ATOM 9895 NE2 GLN B 666 19.407 7.640 -31.830 1.00 57.42 N
ATOM 9896 N GLN B 667 20.868 4.510 -37.171 1.00 51.64 N
ATOM 9897 CA GLN B 667 20.649 3.504 -38.198 1.00 51.64 C
ATOM 9898 C GLN B 667 21.972 2.970 -38.734 1.00 51.64 C
ATOM 9899 O GLN B 667 21.983 2.102 -39.604 1.00 51.64 O
ATOM 9900 CB GLN B 667 19.786 4.098 -39.319 1.00 51.64 C
ATOM 9901 CG GLN B 667 19.085 3.107 -40.243 1.00 51.64 C
ATOM 9902 CD GLN B 667 18.287 3.795 -41.315 1.00 51.64 C
ATOM 9903 OE1 GLN B 667 18.284 5.019 -41.403 1.00 51.64 O
ATOM 9904 NE2 GLN B 667 17.601 3.015 -42.140 1.00 51.64 N
ATOM 9905 N PHE B 668 23.096 3.407 -38.182 1.00 43.15 N
ATOM 9906 CA PHE B 668 24.359 2.821 -38.602 1.00 43.15 C
ATOM 9907 C PHE B 668 24.736 1.706 -37.648 1.00 43.15 C
ATOM 9908 O PHE B 668 25.347 0.713 -38.049 1.00 43.15 O
ATOM 9909 CB PHE B 668 25.483 3.846 -38.636 1.00 43.15 C
ATOM 9910 CG PHE B 668 26.763 3.310 -39.197 1.00 43.15 C
ATOM 9911 CD1 PHE B 668 26.924 3.197 -40.558 1.00 43.15 C
ATOM 9912 CD2 PHE B 668 27.796 2.914 -38.371 1.00 43.15 C
ATOM 9913 CE1 PHE B 668 28.086 2.711 -41.084 1.00 43.15 C
ATOM 9914 CE2 PHE B 668 28.959 2.416 -38.900 1.00 43.15 C
ATOM 9915 CZ PHE B 668 29.103 2.320 -40.254 1.00 43.15 C
ATOM 9916 N ILE B 669 24.391 1.872 -36.382 1.00 41.62 N
ATOM 9917 CA ILE B 669 24.824 0.951 -35.345 1.00 41.62 C
ATOM 9918 C ILE B 669 23.893 -0.254 -35.350 1.00 41.62 C
ATOM 9919 O ILE B 669 24.240 -1.333 -34.864 1.00 41.62 O
ATOM 9920 CB ILE B 669 24.852 1.671 -33.989 1.00 41.62 C
ATOM 9921 CG1 ILE B 669 25.654 2.957 -34.122 1.00 41.62 C
ATOM 9922 CG2 ILE B 669 25.536 0.859 -32.951 1.00 41.62 C
ATOM 9923 CD1 ILE B 669 27.081 2.754 -34.545 1.00 41.62 C
ATOM 9924 N ALA B 670 22.725 -0.098 -35.962 1.00 44.79 N
ATOM 9925 CA ALA B 670 21.682 -1.110 -35.868 1.00 44.79 C
ATOM 9926 C ALA B 670 21.975 -2.367 -36.673 1.00 44.79 C
ATOM 9927 O ALA B 670 21.447 -3.433 -36.347 1.00 44.79 O
ATOM 9928 CB ALA B 670 20.347 -0.529 -36.325 1.00 44.79 C
ATOM 9929 N GLN B 671 22.782 -2.269 -37.714 1.00 45.57 N
ATOM 9930 CA GLN B 671 22.989 -3.407 -38.595 1.00 45.57 C
ATOM 9931 C GLN B 671 23.871 -4.451 -37.909 1.00 45.57 C
ATOM 9932 O GLN B 671 24.589 -4.119 -36.961 1.00 45.57 O
ATOM 9933 CB GLN B 671 23.619 -2.932 -39.900 1.00 45.57 C
ATOM 9934 CG GLN B 671 24.928 -2.283 -39.715 1.00 45.57 C
ATOM 9935 CD GLN B 671 25.491 -1.864 -41.020 1.00 45.57 C
ATOM 9936 OE1 GLN B 671 24.965 -2.210 -42.071 1.00 45.57 O
ATOM 9937 NE2 GLN B 671 26.530 -1.061 -40.975 1.00 45.57 N
ATOM 9938 N PRO B 672 23.825 -5.720 -38.330 1.00 43.11 N
ATOM 9939 CA PRO B 672 24.557 -6.749 -37.576 1.00 43.11 C
ATOM 9940 C PRO B 672 26.060 -6.744 -37.760 1.00 43.11 C
ATOM 9941 O PRO B 672 26.747 -7.495 -37.057 1.00 43.11 O
ATOM 9942 CB PRO B 672 23.939 -8.050 -38.094 1.00 43.11 C
ATOM 9943 CG PRO B 672 22.636 -7.672 -38.620 1.00 43.11 C
ATOM 9944 CD PRO B 672 22.841 -6.341 -39.230 1.00 43.11 C
ATOM 9945 N GLY B 673 26.592 -5.952 -38.690 1.00 44.74 N
ATOM 9946 CA GLY B 673 28.034 -5.929 -38.888 1.00 44.74 C
ATOM 9947 C GLY B 673 28.781 -5.389 -37.684 1.00 44.74 C
ATOM 9948 O GLY B 673 29.643 -6.067 -37.112 1.00 44.74 O
ATOM 9949 N VAL B 674 28.417 -4.188 -37.241 1.00 46.34 N
ATOM 9950 CA VAL B 674 29.110 -3.612 -36.100 1.00 46.34 C
ATOM 9951 C VAL B 674 28.669 -4.287 -34.814 1.00 46.34 C
ATOM 9952 O VAL B 674 29.392 -4.262 -33.816 1.00 46.34 O
ATOM 9953 CB VAL B 674 28.900 -2.094 -36.047 1.00 46.34 C
ATOM 9954 CG1 VAL B 674 29.373 -1.489 -37.326 1.00 46.34 C
ATOM 9955 CG2 VAL B 674 27.460 -1.768 -35.825 1.00 46.34 C
ATOM 9956 N GLN B 675 27.508 -4.944 -34.822 1.00 46.00 N
ATOM 9957 CA GLN B 675 27.104 -5.724 -33.659 1.00 46.00 C
ATOM 9958 C GLN B 675 27.977 -6.956 -33.494 1.00 46.00 C
ATOM 9959 O GLN B 675 28.399 -7.284 -32.377 1.00 46.00 O
ATOM 9960 CB GLN B 675 25.640 -6.118 -33.770 1.00 46.00 C
ATOM 9961 CG GLN B 675 24.719 -4.972 -33.553 1.00 46.00 C
ATOM 9962 CD GLN B 675 24.785 -4.486 -32.135 1.00 46.00 C
ATOM 9963 OE1 GLN B 675 24.899 -5.278 -31.204 1.00 46.00 O
ATOM 9964 NE2 GLN B 675 24.714 -3.181 -31.956 1.00 46.00 N
ATOM 9965 N ASN B 676 28.259 -7.651 -34.597 1.00 49.58 N
ATOM 9966 CA ASN B 676 29.170 -8.786 -34.545 1.00 49.58 C
ATOM 9967 C ASN B 676 30.566 -8.333 -34.149 1.00 49.58 C
ATOM 9968 O ASN B 676 31.239 -9.000 -33.350 1.00 49.58 O
ATOM 9969 CB ASN B 676 29.190 -9.490 -35.898 1.00 49.58 C
ATOM 9970 CG ASN B 676 29.829 -10.857 -35.842 1.00 49.58 C
ATOM 9971 OD1 ASN B 676 30.247 -11.328 -34.789 1.00 49.58 O
ATOM 9972 ND2 ASN B 676 29.907 -11.507 -36.990 1.00 49.58 N
ATOM 9973 N PHE B 677 30.992 -7.175 -34.667 1.00 45.22 N
ATOM 9974 CA PHE B 677 32.280 -6.599 -34.284 1.00 45.22 C
ATOM 9975 C PHE B 677 32.362 -6.316 -32.793 1.00 45.22 C
ATOM 9976 O PHE B 677 33.329 -6.720 -32.132 1.00 45.22 O
ATOM 9977 CB PHE B 677 32.530 -5.315 -35.058 1.00 45.22 C
ATOM 9978 CG PHE B 677 33.714 -4.563 -34.576 1.00 45.22 C
ATOM 9979 CD1 PHE B 677 34.981 -5.047 -34.800 1.00 45.22 C
ATOM 9980 CD2 PHE B 677 33.562 -3.375 -33.892 1.00 45.22 C
ATOM 9981 CE1 PHE B 677 36.080 -4.361 -34.347 1.00 45.22 C
ATOM 9982 CE2 PHE B 677 34.652 -2.687 -33.441 1.00 45.22 C
ATOM 9983 CZ PHE B 677 35.914 -3.179 -33.669 1.00 45.22 C
ATOM 9984 N LEU B 678 31.359 -5.619 -32.259 1.00 49.30 N
ATOM 9985 CA LEU B 678 31.309 -5.296 -30.841 1.00 49.30 C
ATOM 9986 C LEU B 678 31.316 -6.548 -29.985 1.00 49.30 C
ATOM 9987 O LEU B 678 32.085 -6.649 -29.024 1.00 49.30 O
ATOM 9988 CB LEU B 678 30.056 -4.491 -30.540 1.00 49.30 C
ATOM 9989 CG LEU B 678 29.976 -4.201 -29.050 1.00 49.30 C
ATOM 9990 CD1 LEU B 678 30.942 -3.105 -28.672 1.00 49.30 C
ATOM 9991 CD2 LEU B 678 28.561 -3.941 -28.582 1.00 49.30 C
ATOM 9992 N SER B 679 30.474 -7.521 -30.329 1.00 51.47 N
ATOM 9993 CA SER B 679 30.316 -8.683 -29.471 1.00 51.47 C
ATOM 9994 C SER B 679 31.567 -9.554 -29.476 1.00 51.47 C
ATOM 9995 O SER B 679 31.966 -10.089 -28.435 1.00 51.47 O
ATOM 9996 CB SER B 679 29.086 -9.470 -29.901 1.00 51.47 C
ATOM 9997 OG SER B 679 28.907 -10.604 -29.082 1.00 51.47 O
ATOM 9998 N LYS B 680 32.251 -9.651 -30.617 1.00 52.99 N
ATOM 9999 CA LYS B 680 33.463 -10.456 -30.602 1.00 52.99 C
ATOM 10000 C LYS B 680 34.647 -9.653 -30.090 1.00 52.99 C
ATOM 10001 O LYS B 680 35.727 -10.206 -29.868 1.00 52.99 O
ATOM 10002 CB LYS B 680 33.758 -11.040 -31.977 1.00 52.99 C
ATOM 10003 CG LYS B 680 34.397 -10.120 -32.968 1.00 52.99 C
ATOM 10004 CD LYS B 680 34.636 -10.917 -34.224 1.00 52.99 C
ATOM 10005 CE LYS B 680 35.429 -10.146 -35.239 1.00 52.99 C
ATOM 10006 NZ LYS B 680 35.630 -10.943 -36.475 1.00 52.99 N
ATOM 10007 N GLN B 681 34.475 -8.344 -29.906 1.00 55.70 N
ATOM 10008 CA GLN B 681 35.438 -7.618 -29.085 1.00 55.70 C
ATOM 10009 C GLN B 681 35.147 -7.815 -27.602 1.00 55.70 C
ATOM 10010 O GLN B 681 36.067 -7.820 -26.778 1.00 55.70 O
ATOM 10011 CB GLN B 681 35.425 -6.137 -29.452 1.00 55.70 C
ATOM 10012 CG GLN B 681 36.459 -5.291 -28.740 1.00 55.70 C
ATOM 10013 CD GLN B 681 36.413 -3.845 -29.174 1.00 55.70 C
ATOM 10014 OE1 GLN B 681 35.602 -3.463 -30.015 1.00 55.70 O
ATOM 10015 NE2 GLN B 681 37.277 -3.026 -28.594 1.00 55.70 N
ATOM 10016 N TRP B 682 33.875 -7.998 -27.250 1.00 57.63 N
ATOM 10017 CA TRP B 682 33.498 -8.275 -25.867 1.00 57.63 C
ATOM 10018 C TRP B 682 33.978 -9.647 -25.423 1.00 57.63 C
ATOM 10019 O TRP B 682 34.320 -9.842 -24.253 1.00 57.63 O
ATOM 10020 CB TRP B 682 31.984 -8.169 -25.714 1.00 57.63 C
ATOM 10021 CG TRP B 682 31.430 -8.639 -24.406 1.00 57.63 C
ATOM 10022 CD1 TRP B 682 30.838 -9.835 -24.169 1.00 57.63 C
ATOM 10023 CD2 TRP B 682 31.377 -7.918 -23.177 1.00 57.63 C
ATOM 10024 NE1 TRP B 682 30.434 -9.916 -22.868 1.00 57.63 N
ATOM 10025 CE2 TRP B 682 30.754 -8.750 -22.234 1.00 57.63 C
ATOM 10026 CE3 TRP B 682 31.803 -6.657 -22.779 1.00 57.63 C
ATOM 10027 CZ2 TRP B 682 30.546 -8.364 -20.922 1.00 57.63 C
ATOM 10028 CZ3 TRP B 682 31.594 -6.273 -21.472 1.00 57.63 C
ATOM 10029 CH2 TRP B 682 30.975 -7.124 -20.559 1.00 57.63 C
ATOM 10030 N TYR B 683 34.010 -10.612 -26.340 1.00 58.12 N
ATOM 10031 CA TYR B 683 34.548 -11.914 -25.973 1.00 58.12 C
ATOM 10032 C TYR B 683 36.049 -12.008 -26.172 1.00 58.12 C
ATOM 10033 O TYR B 683 36.690 -12.823 -25.506 1.00 58.12 O
ATOM 10034 CB TYR B 683 33.847 -13.024 -26.744 1.00 58.12 C
ATOM 10035 CG TYR B 683 32.562 -13.477 -26.105 1.00 58.12 C
ATOM 10036 CD1 TYR B 683 32.305 -13.216 -24.771 1.00 58.12 C
ATOM 10037 CD2 TYR B 683 31.612 -14.174 -26.833 1.00 58.12 C
ATOM 10038 CE1 TYR B 683 31.144 -13.637 -24.182 1.00 58.12 C
ATOM 10039 CE2 TYR B 683 30.446 -14.592 -26.254 1.00 58.12 C
ATOM 10040 CZ TYR B 683 30.217 -14.318 -24.931 1.00 58.12 C
ATOM 10041 OH TYR B 683 29.048 -14.740 -24.353 1.00 58.12 O
ATOM 10042 N GLY B 684 36.620 -11.208 -27.060 1.00 64.66 N
ATOM 10043 CA GLY B 684 38.069 -11.177 -27.167 1.00 64.66 C
ATOM 10044 C GLY B 684 38.601 -12.405 -27.869 1.00 64.66 C
ATOM 10045 O GLY B 684 38.009 -12.908 -28.828 1.00 64.66 O
ATOM 10046 N GLU B 685 39.727 -12.919 -27.373 1.00 69.27 N
ATOM 10047 CA GLU B 685 40.353 -14.065 -28.020 1.00 69.27 C
ATOM 10048 C GLU B 685 39.632 -15.363 -27.675 1.00 69.27 C
ATOM 10049 O GLU B 685 39.873 -16.398 -28.307 1.00 69.27 O
ATOM 10050 CB GLU B 685 41.825 -14.144 -27.631 1.00 69.27 C
ATOM 10051 N ILE B 686 38.762 -15.337 -26.660 1.00 66.07 N
ATOM 10052 CA ILE B 686 37.850 -16.451 -26.447 1.00 66.07 C
ATOM 10053 C ILE B 686 36.880 -16.517 -27.607 1.00 66.07 C
ATOM 10054 O ILE B 686 36.204 -15.534 -27.929 1.00 66.07 O
ATOM 10055 CB ILE B 686 37.085 -16.304 -25.124 1.00 66.07 C
ATOM 10056 CG1 ILE B 686 38.032 -16.418 -23.945 1.00 66.07 C
ATOM 10057 CG2 ILE B 686 36.006 -17.350 -25.016 1.00 66.07 C
ATOM 10058 CD1 ILE B 686 37.371 -16.116 -22.645 1.00 66.07 C
ATOM 10059 N SER B 687 36.824 -17.671 -28.261 1.00 75.91 N
ATOM 10060 CA SER B 687 35.893 -17.832 -29.360 1.00 75.91 C
ATOM 10061 C SER B 687 34.476 -17.911 -28.828 1.00 75.91 C
ATOM 10062 O SER B 687 34.235 -18.298 -27.683 1.00 75.91 O
ATOM 10063 CB SER B 687 36.201 -19.088 -30.167 1.00 75.91 C
ATOM 10064 OG SER B 687 35.874 -20.242 -29.422 1.00 75.91 O
ATOM 10065 N ARG B 688 33.530 -17.555 -29.684 1.00 69.34 N
ATOM 10066 CA ARG B 688 32.124 -17.584 -29.338 1.00 69.34 C
ATOM 10067 C ARG B 688 31.618 -19.024 -29.338 1.00 69.34 C
ATOM 10068 O ARG B 688 32.389 -19.980 -29.472 1.00 69.34 O
ATOM 10069 CB ARG B 688 31.343 -16.714 -30.316 1.00 69.34 C
ATOM 10070 CG ARG B 688 31.800 -15.281 -30.303 1.00 69.34 C
ATOM 10071 CD ARG B 688 31.142 -14.463 -31.392 1.00 69.34 C
ATOM 10072 NE ARG B 688 29.698 -14.372 -31.232 1.00 69.34 N
ATOM 10073 CZ ARG B 688 29.099 -13.501 -30.431 1.00 69.34 C
ATOM 10074 NH1 ARG B 688 29.831 -12.676 -29.705 1.00 69.34 N
ATOM 10075 NH2 ARG B 688 27.779 -13.468 -30.340 1.00 69.34 N
ATOM 10076 N ASP B 689 30.300 -19.162 -29.161 1.00 73.11 N
ATOM 10077 CA ASP B 689 29.580 -20.435 -29.255 1.00 73.11 C
ATOM 10078 C ASP B 689 30.072 -21.435 -28.215 1.00 73.11 C
ATOM 10079 O ASP B 689 30.172 -22.634 -28.475 1.00 73.11 O
ATOM 10080 CB ASP B 689 29.661 -21.017 -30.666 1.00 73.11 C
ATOM 10081 CG ASP B 689 29.024 -20.112 -31.682 1.00 73.11 C
ATOM 10082 OD1 ASP B 689 28.079 -19.401 -31.295 1.00 73.11 O
ATOM 10083 OD2 ASP B 689 29.473 -20.088 -32.847 1.00 73.11 O
ATOM 10084 N THR B 690 30.411 -20.930 -27.037 1.00 82.55 N
ATOM 10085 CA THR B 690 30.645 -21.752 -25.864 1.00 82.55 C
ATOM 10086 C THR B 690 29.646 -21.346 -24.796 1.00 82.55 C
ATOM 10087 O THR B 690 29.159 -20.213 -24.790 1.00 82.55 O
ATOM 10088 CB THR B 690 32.066 -21.606 -25.326 1.00 82.55 C
ATOM 10089 OG1 THR B 690 32.299 -20.245 -24.956 1.00 82.55 O
ATOM 10090 CG2 THR B 690 33.071 -22.016 -26.372 1.00 82.55 C
ATOM 10091 N LYS B 691 29.333 -22.276 -23.907 1.00 92.80 N
ATOM 10092 CA LYS B 691 28.343 -22.006 -22.879 1.00 92.80 C
ATOM 10093 C LYS B 691 28.927 -21.101 -21.805 1.00 92.80 C
ATOM 10094 O LYS B 691 30.144 -21.024 -21.625 1.00 92.80 O
ATOM 10095 CB LYS B 691 27.861 -23.308 -22.255 1.00 92.80 C
ATOM 10096 CG LYS B 691 26.924 -24.125 -23.124 1.00 92.80 C
ATOM 10097 CD LYS B 691 27.682 -25.134 -23.966 1.00 92.80 C
ATOM 10098 CE LYS B 691 26.736 -26.083 -24.662 1.00 92.80 C
ATOM 10099 NZ LYS B 691 25.896 -25.391 -25.679 1.00 92.80 N
ATOM 10100 N ASN B 692 28.046 -20.409 -21.087 1.00101.48 N
ATOM 10101 CA ASN B 692 28.508 -19.448 -20.095 1.00101.48 C
ATOM 10102 C ASN B 692 28.930 -20.143 -18.807 1.00101.48 C
ATOM 10103 O ASN B 692 29.899 -19.726 -18.157 1.00101.48 O
ATOM 10104 CB ASN B 692 27.417 -18.418 -19.833 1.00101.48 C
ATOM 10105 CG ASN B 692 27.102 -17.597 -21.062 1.00101.48 C
ATOM 10106 OD1 ASN B 692 27.996 -17.249 -21.829 1.00101.48 O
ATOM 10107 ND2 ASN B 692 25.829 -17.285 -21.258 1.00101.48 N
ATOM 10108 N TRP B 693 28.223 -21.216 -18.431 1.00104.30 N
ATOM 10109 CA TRP B 693 28.612 -21.985 -17.251 1.00104.30 C
ATOM 10110 C TRP B 693 29.958 -22.653 -17.457 1.00104.30 C
ATOM 10111 O TRP B 693 30.714 -22.855 -16.501 1.00104.30 O
ATOM 10112 CB TRP B 693 27.551 -23.033 -16.917 1.00104.30 C
ATOM 10113 CG TRP B 693 27.323 -24.040 -18.004 1.00104.30 C
ATOM 10114 CD1 TRP B 693 26.398 -23.967 -18.999 1.00104.30 C
ATOM 10115 CD2 TRP B 693 28.036 -25.267 -18.212 1.00104.30 C
ATOM 10116 NE1 TRP B 693 26.479 -25.073 -19.806 1.00104.30 N
ATOM 10117 CE2 TRP B 693 27.484 -25.882 -19.350 1.00104.30 C
ATOM 10118 CE3 TRP B 693 29.086 -25.903 -17.548 1.00104.30 C
ATOM 10119 CZ2 TRP B 693 27.946 -27.100 -19.836 1.00104.30 C
ATOM 10120 CZ3 TRP B 693 29.543 -27.108 -18.033 1.00104.30 C
ATOM 10121 CH2 TRP B 693 28.974 -27.695 -19.164 1.00104.30 C
ATOM 10122 N LYS B 694 30.272 -22.998 -18.705 1.00105.65 N
ATOM 10123 CA LYS B 694 31.564 -23.583 -19.026 1.00105.65 C
ATOM 10124 C LYS B 694 32.690 -22.588 -18.787 1.00105.65 C
ATOM 10125 O LYS B 694 33.738 -22.944 -18.236 1.00105.65 O
ATOM 10126 CB LYS B 694 31.545 -24.059 -20.472 1.00105.65 C
ATOM