PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2020-07-03
Number of transmembrane proteins: 5146 (alpha: 4654 , beta: 460 )
Content of 6nr2
HEADER    TRANSPORT PROTEIN                       22-JAN-19   6NR2              
TITLE CRYO-EM STRUCTURE OF THE TRPM8 ION CHANNEL IN COMPLEX WITH THE MENTHOL
TITLE 2 ANALOG WS-12 AND PI(4,5)P2
COMPND MOL_ID: 1;
COMPND 2 MOLECULE: TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL SUBFAMILY M
COMPND 3 MEMBER 8;
COMPND 4 CHAIN: A, B, C, D;
COMPND 5 ENGINEERED: YES;
COMPND 6 MUTATION: YES
SOURCE MOL_ID: 1;
SOURCE 2 ORGANISM_SCIENTIFIC: FICEDULA ALBICOLLIS;
SOURCE 3 ORGANISM_COMMON: COLLARED FLYCATCHER;
SOURCE 4 ORGANISM_TAXID: 59894;
SOURCE 5 GENE: TRPM8;
SOURCE 6 EXPRESSION_SYSTEM: HOMO SAPIENS;
SOURCE 7 EXPRESSION_SYSTEM_TAXID: 9606
KEYWDS ION CHANNEL, TRP CHANNEL, TRPM CHANNEL, TRPM8 CHANNEL, COLD SENSING,
KEYWDS 2 LIPID SENSING, MENTHOL, ICILIN, WS-12, PI(4, 5)P2, COOLING AGENT,
KEYWDS 3 MEMBRANE PROTEIN, CALCIUM-PERMEABLE ION CHANNEL, TRANSPORT PROTEIN
EXPDTA ELECTRON MICROSCOPY
AUTHOR Y.YIN,S.C.LE,A.L.HSU,M.J.BORGNIA,H.YANG,S.-Y.LEE
REVDAT 2 13-MAR-19 6NR2 1 JRNL
REVDAT 1 20-FEB-19 6NR2 0
JRNL AUTH Y.YIN,S.C.LE,A.L.HSU,M.J.BORGNIA,H.YANG,S.Y.LEE
JRNL TITL STRUCTURAL BASIS OF COOLING AGENT AND LIPID SENSING BY THE
JRNL TITL 2 COLD-ACTIVATED TRPM8 CHANNEL.
JRNL REF SCIENCE V. 363 2019
JRNL REFN ESSN 1095-9203
JRNL PMID 30733385
JRNL DOI 10.1126/SCIENCE.AAV9334
REMARK 2
REMARK 2 RESOLUTION. 4.00 ANGSTROMS.
REMARK 3
REMARK 3 REFINEMENT.
REMARK 3 SOFTWARE PACKAGES : RELION, EPU, RELION, GCTF, COOT,
REMARK 3 RELION, RELION, RELION, PHENIX
REMARK 3 RECONSTRUCTION SCHEMA : NULL
REMARK 3
REMARK 3 EM MAP-MODEL FITTING AND REFINEMENT
REMARK 3 PDB ENTRY : 6BPQ
REMARK 3 REFINEMENT SPACE : REAL
REMARK 3 REFINEMENT PROTOCOL : RIGID BODY FIT
REMARK 3 REFINEMENT TARGET : NULL
REMARK 3 OVERALL ANISOTROPIC B VALUE : 100.000
REMARK 3
REMARK 3 FITTING PROCEDURE : NULL
REMARK 3
REMARK 3 EM IMAGE RECONSTRUCTION STATISTICS
REMARK 3 NOMINAL PIXEL SIZE (ANGSTROMS) : NULL
REMARK 3 ACTUAL PIXEL SIZE (ANGSTROMS) : NULL
REMARK 3 EFFECTIVE RESOLUTION (ANGSTROMS) : 4.000
REMARK 3 NUMBER OF PARTICLES : 46940
REMARK 3 CTF CORRECTION METHOD : PHASE FLIPPING AND AMPLITUDE
REMARK 3 CORRECTION
REMARK 3
REMARK 3 EM RECONSTRUCTION MAGNIFICATION CALIBRATION: NULL
REMARK 3
REMARK 3 OTHER DETAILS: NULL
REMARK 4
REMARK 4 6NR2 COMPLIES WITH FORMAT V. 3.30, 13-JUL-11
REMARK 100
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 23-JAN-19.
REMARK 100 THE DEPOSITION ID IS D_1000239256.
REMARK 245
REMARK 245 EXPERIMENTAL DETAILS
REMARK 245 RECONSTRUCTION METHOD : SINGLE PARTICLE
REMARK 245 SPECIMEN TYPE : NULL
REMARK 245
REMARK 245 ELECTRON MICROSCOPE SAMPLE
REMARK 245 SAMPLE TYPE : PARTICLE
REMARK 245 PARTICLE TYPE : POINT
REMARK 245 NAME OF SAMPLE : TRANSIENT RECEPTOR POTENTIAL
REMARK 245 MELASTATIN MEMBER 8
REMARK 245 SAMPLE CONCENTRATION (MG ML-1) : 0.50
REMARK 245 SAMPLE SUPPORT DETAILS : 15 MA
REMARK 245 SAMPLE VITRIFICATION DETAILS : NULL
REMARK 245 SAMPLE BUFFER : NULL
REMARK 245 PH : 8.00
REMARK 245 SAMPLE DETAILS : NULL
REMARK 245
REMARK 245 DATA ACQUISITION
REMARK 245 DATE OF EXPERIMENT : NULL
REMARK 245 NUMBER OF MICROGRAPHS-IMAGES : 4006
REMARK 245 TEMPERATURE (KELVIN) : NULL
REMARK 245 MICROSCOPE MODEL : FEI TITAN KRIOS
REMARK 245 DETECTOR TYPE : FEI FALCON III (4K X 4K)
REMARK 245 MINIMUM DEFOCUS (NM) : 1250.00
REMARK 245 MAXIMUM DEFOCUS (NM) : 3000.00
REMARK 245 MINIMUM TILT ANGLE (DEGREES) : NULL
REMARK 245 MAXIMUM TILT ANGLE (DEGREES) : NULL
REMARK 245 NOMINAL CS : 2.70
REMARK 245 IMAGING MODE : BRIGHT FIELD
REMARK 245 ELECTRON DOSE (ELECTRONS NM**-2) : 42.00
REMARK 245 ILLUMINATION MODE : FLOOD BEAM
REMARK 245 NOMINAL MAGNIFICATION : 75000
REMARK 245 CALIBRATED MAGNIFICATION : NULL
REMARK 245 SOURCE : FIELD EMISSION GUN
REMARK 245 ACCELERATION VOLTAGE (KV) : 300
REMARK 245 IMAGING DETAILS : NULL
REMARK 247
REMARK 247 ELECTRON MICROSCOPY
REMARK 247 THE COORDINATES IN THIS ENTRY WERE GENERATED FROM ELECTRON
REMARK 247 MICROSCOPY DATA. PROTEIN DATA BANK CONVENTIONS REQUIRE
REMARK 247 THAT CRYST1 AND SCALE RECORDS BE INCLUDED, BUT THE VALUES
REMARK 247 ON THESE RECORDS ARE MEANINGLESS EXCEPT FOR THE CALCULATION
REMARK 247 OF THE STRUCTURE FACTORS.
REMARK 300
REMARK 300 BIOMOLECULE: 1
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON
REMARK 300 BURIED SURFACE AREA.
REMARK 350
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS
REMARK 350 GIVEN BELOW. BOTH NON-CRYSTALLOGRAPHIC AND
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.
REMARK 350
REMARK 350 BIOMOLECULE: 1
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: TETRAMERIC
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D
REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000
REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000
REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000
REMARK 400
REMARK 400 COMPOUND
REMARK 400 1
REMARK 465
REMARK 465 MISSING RESIDUES
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)
REMARK 465
REMARK 465 M RES C SSSEQI
REMARK 465 MET A -43
REMARK 465 ALA A -42
REMARK 465 THR A -41
REMARK 465 LEU A -40
REMARK 465 PHE A -39
REMARK 465 GLN A -38
REMARK 465 VAL A -37
REMARK 465 SER A -36
REMARK 465 MET A -35
REMARK 465 GLY A -34
REMARK 465 SER A -33
REMARK 465 MET A -32
REMARK 465 ARG A -31
REMARK 465 HIS A -30
REMARK 465 ARG A -29
REMARK 465 ARG A -28
REMARK 465 ASN A -27
REMARK 465 GLY A -26
REMARK 465 ASN A -25
REMARK 465 PHE A -24
REMARK 465 GLU A -23
REMARK 465 SER A -22
REMARK 465 SER A -21
REMARK 465 ARG A -20
REMARK 465 LEU A -19
REMARK 465 LEU A -18
REMARK 465 TYR A -17
REMARK 465 SER A -16
REMARK 465 SER A -15
REMARK 465 MET A -14
REMARK 465 SER A -13
REMARK 465 ARG A -12
REMARK 465 SER A -11
REMARK 465 ILE A -10
REMARK 465 ASP A -9
REMARK 465 VAL A -8
REMARK 465 ALA A -7
REMARK 465 CYS A -6
REMARK 465 SER A -5
REMARK 465 ASP A -4
REMARK 465 ALA A -3
REMARK 465 ASP A -2
REMARK 465 LEU A -1
REMARK 465 ALA A 0
REMARK 465 ASN A 1
REMARK 465 PHE A 2
REMARK 465 ILE A 3
REMARK 465 GLN A 4
REMARK 465 GLU A 5
REMARK 465 ASN A 6
REMARK 465 PHE A 7
REMARK 465 LYS A 8
REMARK 465 LYS A 9
REMARK 465 ARG A 10
REMARK 465 GLU A 11
REMARK 465 CYS A 12
REMARK 465 VAL A 13
REMARK 465 PHE A 14
REMARK 465 PHE A 15
REMARK 465 THR A 16
REMARK 465 LYS A 17
REMARK 465 ASP A 18
REMARK 465 THR A 19
REMARK 465 LYS A 20
REMARK 465 SER A 21
REMARK 465 MET A 22
REMARK 465 GLY A 23
REMARK 465 ASN A 24
REMARK 465 LEU A 25
REMARK 465 CYS A 26
REMARK 465 LYS A 27
REMARK 465 CYS A 28
REMARK 465 GLY A 29
REMARK 465 TYR A 30
REMARK 465 PRO A 31
REMARK 465 GLU A 32
REMARK 465 ASN A 33
REMARK 465 GLN A 34
REMARK 465 HIS A 35
REMARK 465 ILE A 36
REMARK 465 GLU A 37
REMARK 465 GLY A 38
REMARK 465 THR A 39
REMARK 465 GLN A 40
REMARK 465 VAL A 41
REMARK 465 ASN A 42
REMARK 465 THR A 43
REMARK 465 THR A 44
REMARK 465 GLU A 45
REMARK 465 LYS A 46
REMARK 465 TRP A 47
REMARK 465 ASN A 48
REMARK 465 TYR A 49
REMARK 465 LYS A 50
REMARK 465 LYS A 51
REMARK 465 HIS A 52
REMARK 465 THR A 149
REMARK 465 GLY A 150
REMARK 465 GLY A 151
REMARK 465 ALA A 152
REMARK 465 GLY A 213
REMARK 465 ILE A 214
REMARK 465 ALA A 215
REMARK 465 ALA A 216
REMARK 465 TRP A 217
REMARK 465 GLY A 218
REMARK 465 MET A 219
REMARK 465 ILE A 220
REMARK 465 SER A 221
REMARK 465 ASN A 222
REMARK 465 ARG A 223
REMARK 465 GLU A 224
REMARK 465 THR A 225
REMARK 465 LEU A 226
REMARK 465 ILE A 227
REMARK 465 ARG A 228
REMARK 465 THR A 229
REMARK 465 ALA A 230
REMARK 465 ASP A 231
REMARK 465 SER A 232
REMARK 465 ASP A 233
REMARK 465 GLY A 234
REMARK 465 SER A 235
REMARK 465 TYR A 236
REMARK 465 LEU A 237
REMARK 465 ALA A 238
REMARK 465 HIS A 239
REMARK 465 TYR A 240
REMARK 465 ILE A 241
REMARK 465 MET A 242
REMARK 465 ASP A 243
REMARK 465 ASP A 244
REMARK 465 LEU A 245
REMARK 465 LYS A 246
REMARK 465 ASP A 264
REMARK 465 ASN A 265
REMARK 465 GLY A 266
REMARK 465 THR A 267
REMARK 465 HIS A 268
REMARK 465 GLY A 269
REMARK 465 HIS A 270
REMARK 465 PRO A 271
REMARK 465 THR A 272
REMARK 465 GLY A 307
REMARK 465 GLY A 308
REMARK 465 GLU A 344
REMARK 465 ALA A 345
REMARK 465 GLU A 346
REMARK 465 GLY A 347
REMARK 465 THR A 348
REMARK 465 LEU A 349
REMARK 465 ALA A 350
REMARK 465 GLU A 398
REMARK 465 ALA A 399
REMARK 465 GLY A 400
REMARK 465 ASP A 401
REMARK 465 GLY A 534
REMARK 465 ALA A 535
REMARK 465 LYS A 536
REMARK 465 ARG A 537
REMARK 465 ASP A 538
REMARK 465 ASP A 539
REMARK 465 LYS A 540
REMARK 465 ASN A 541
REMARK 465 SER A 542
REMARK 465 LYS A 543
REMARK 465 ASP A 544
REMARK 465 GLU A 545
REMARK 465 MET A 546
REMARK 465 GLU A 547
REMARK 465 ILE A 548
REMARK 465 GLU A 549
REMARK 465 LEU A 550
REMARK 465 SER A 551
REMARK 465 GLU A 552
REMARK 465 GLU A 553
REMARK 465 CYS A 554
REMARK 465 LYS A 715
REMARK 465 PRO A 716
REMARK 465 VAL A 717
REMARK 465 GLU A 718
REMARK 465 LYS A 719
REMARK 465 THR A 720
REMARK 465 GLN A 913
REMARK 465 TYR A 914
REMARK 465 PRO A 915
REMARK 465 ASP A 916
REMARK 465 ASP A 917
REMARK 465 ILE A 918
REMARK 465 ASP A 919
REMARK 465 GLY A 920
REMARK 465 THR A 921
REMARK 465 THR A 922
REMARK 465 TYR A 923
REMARK 465 ASN A 924
REMARK 465 PHE A 925
REMARK 465 ASP A 926
REMARK 465 HIS A 927
REMARK 465 CYS A 928
REMARK 465 THR A 929
REMARK 465 PHE A 930
REMARK 465 SER A 931
REMARK 465 GLY A 932
REMARK 465 ASN A 933
REMARK 465 GLU A 934
REMARK 465 SER A 935
REMARK 465 LYS A 936
REMARK 465 PRO A 937
REMARK 465 LEU A 938
REMARK 465 CYS A 939
REMARK 465 VAL A 940
REMARK 465 GLU A 941
REMARK 465 LEU A 942
REMARK 465 ASP A 943
REMARK 465 ALA A 944
REMARK 465 ASN A 945
REMARK 465 ASN A 946
REMARK 465 GLN A 947
REMARK 465 PRO A 948
REMARK 465 ARG A 949
REMARK 465 PHE A 950
REMARK 465 PRO A 951
REMARK 465 SER A 984
REMARK 465 VAL A 985
REMARK 465 GLN A 986
REMARK 465 GLU A 987
REMARK 465 CYS A 1027
REMARK 465 PHE A 1028
REMARK 465 LYS A 1029
REMARK 465 CYS A 1030
REMARK 465 CYS A 1031
REMARK 465 CYS A 1032
REMARK 465 LYS A 1033
REMARK 465 LYS A 1034
REMARK 465 GLU A 1035
REMARK 465 SER A 1036
REMARK 465 LYS A 1037
REMARK 465 SER A 1071
REMARK 465 ASP A 1072
REMARK 465 SER A 1073
REMARK 465 SER A 1074
REMARK 465 GLU A 1075
REMARK 465 GLU A 1076
REMARK 465 LYS A 1101
REMARK 465 ILE A 1102
REMARK 465 LYS A 1103
REMARK 465 SER A 1104
REMARK 465 ASN A 1105
REMARK 465 SER A 1106
REMARK 465 LEU A 1107
REMARK 465 GLU A 1108
REMARK 465 VAL A 1109
REMARK 465 LEU A 1110
REMARK 465 PHE A 1111
REMARK 465 GLN A 1112
REMARK 465 GLY A 1113
REMARK 465 PRO A 1114
REMARK 465 ASP A 1115
REMARK 465 TYR A 1116
REMARK 465 LYS A 1117
REMARK 465 ASP A 1118
REMARK 465 ASP A 1119
REMARK 465 ASP A 1120
REMARK 465 ASP A 1121
REMARK 465 LYS A 1122
REMARK 465 ALA A 1123
REMARK 465 HIS A 1124
REMARK 465 HIS A 1125
REMARK 465 HIS A 1126
REMARK 465 HIS A 1127
REMARK 465 HIS A 1128
REMARK 465 HIS A 1129
REMARK 465 HIS A 1130
REMARK 465 HIS A 1131
REMARK 465 HIS A 1132
REMARK 465 HIS A 1133
REMARK 465 MET B -43
REMARK 465 ALA B -42
REMARK 465 THR B -41
REMARK 465 LEU B -40
REMARK 465 PHE B -39
REMARK 465 GLN B -38
REMARK 465 VAL B -37
REMARK 465 SER B -36
REMARK 465 MET B -35
REMARK 465 GLY B -34
REMARK 465 SER B -33
REMARK 465 MET B -32
REMARK 465 ARG B -31
REMARK 465 HIS B -30
REMARK 465 ARG B -29
REMARK 465 ARG B -28
REMARK 465 ASN B -27
REMARK 465 GLY B -26
REMARK 465 ASN B -25
REMARK 465 PHE B -24
REMARK 465 GLU B -23
REMARK 465 SER B -22
REMARK 465 SER B -21
REMARK 465 ARG B -20
REMARK 465 LEU B -19
REMARK 465 LEU B -18
REMARK 465 TYR B -17
REMARK 465 SER B -16
REMARK 465 SER B -15
REMARK 465 MET B -14
REMARK 465 SER B -13
REMARK 465 ARG B -12
REMARK 465 SER B -11
REMARK 465 ILE B -10
REMARK 465 ASP B -9
REMARK 465 VAL B -8
REMARK 465 ALA B -7
REMARK 465 CYS B -6
REMARK 465 SER B -5
REMARK 465 ASP B -4
REMARK 465 ALA B -3
REMARK 465 ASP B -2
REMARK 465 LEU B -1
REMARK 465 ALA B 0
REMARK 465 ASN B 1
REMARK 465 PHE B 2
REMARK 465 ILE B 3
REMARK 465 GLN B 4
REMARK 465 GLU B 5
REMARK 465 ASN B 6
REMARK 465 PHE B 7
REMARK 465 LYS B 8
REMARK 465 LYS B 9
REMARK 465 ARG B 10
REMARK 465 GLU B 11
REMARK 465 CYS B 12
REMARK 465 VAL B 13
REMARK 465 PHE B 14
REMARK 465 PHE B 15
REMARK 465 THR B 16
REMARK 465 LYS B 17
REMARK 465 ASP B 18
REMARK 465 THR B 19
REMARK 465 LYS B 20
REMARK 465 SER B 21
REMARK 465 MET B 22
REMARK 465 GLY B 23
REMARK 465 ASN B 24
REMARK 465 LEU B 25
REMARK 465 CYS B 26
REMARK 465 LYS B 27
REMARK 465 CYS B 28
REMARK 465 GLY B 29
REMARK 465 TYR B 30
REMARK 465 PRO B 31
REMARK 465 GLU B 32
REMARK 465 ASN B 33
REMARK 465 GLN B 34
REMARK 465 HIS B 35
REMARK 465 ILE B 36
REMARK 465 GLU B 37
REMARK 465 GLY B 38
REMARK 465 THR B 39
REMARK 465 GLN B 40
REMARK 465 VAL B 41
REMARK 465 ASN B 42
REMARK 465 THR B 43
REMARK 465 THR B 44
REMARK 465 GLU B 45
REMARK 465 LYS B 46
REMARK 465 TRP B 47
REMARK 465 ASN B 48
REMARK 465 TYR B 49
REMARK 465 LYS B 50
REMARK 465 LYS B 51
REMARK 465 HIS B 52
REMARK 465 THR B 149
REMARK 465 GLY B 150
REMARK 465 GLY B 151
REMARK 465 ALA B 152
REMARK 465 GLY B 213
REMARK 465 ILE B 214
REMARK 465 ALA B 215
REMARK 465 ALA B 216
REMARK 465 TRP B 217
REMARK 465 GLY B 218
REMARK 465 MET B 219
REMARK 465 ILE B 220
REMARK 465 SER B 221
REMARK 465 ASN B 222
REMARK 465 ARG B 223
REMARK 465 GLU B 224
REMARK 465 THR B 225
REMARK 465 LEU B 226
REMARK 465 ILE B 227
REMARK 465 ARG B 228
REMARK 465 THR B 229
REMARK 465 ALA B 230
REMARK 465 ASP B 231
REMARK 465 SER B 232
REMARK 465 ASP B 233
REMARK 465 GLY B 234
REMARK 465 SER B 235
REMARK 465 TYR B 236
REMARK 465 LEU B 237
REMARK 465 ALA B 238
REMARK 465 HIS B 239
REMARK 465 TYR B 240
REMARK 465 ILE B 241
REMARK 465 MET B 242
REMARK 465 ASP B 243
REMARK 465 ASP B 244
REMARK 465 LEU B 245
REMARK 465 LYS B 246
REMARK 465 ASP B 264
REMARK 465 ASN B 265
REMARK 465 GLY B 266
REMARK 465 THR B 267
REMARK 465 HIS B 268
REMARK 465 GLY B 269
REMARK 465 HIS B 270
REMARK 465 PRO B 271
REMARK 465 THR B 272
REMARK 465 GLY B 307
REMARK 465 GLY B 308
REMARK 465 GLU B 344
REMARK 465 ALA B 345
REMARK 465 GLU B 346
REMARK 465 GLY B 347
REMARK 465 THR B 348
REMARK 465 LEU B 349
REMARK 465 ALA B 350
REMARK 465 GLU B 398
REMARK 465 ALA B 399
REMARK 465 GLY B 400
REMARK 465 ASP B 401
REMARK 465 GLY B 534
REMARK 465 ALA B 535
REMARK 465 LYS B 536
REMARK 465 ARG B 537
REMARK 465 ASP B 538
REMARK 465 ASP B 539
REMARK 465 LYS B 540
REMARK 465 ASN B 541
REMARK 465 SER B 542
REMARK 465 LYS B 543
REMARK 465 ASP B 544
REMARK 465 GLU B 545
REMARK 465 MET B 546
REMARK 465 GLU B 547
REMARK 465 ILE B 548
REMARK 465 GLU B 549
REMARK 465 LEU B 550
REMARK 465 SER B 551
REMARK 465 GLU B 552
REMARK 465 GLU B 553
REMARK 465 CYS B 554
REMARK 465 LYS B 715
REMARK 465 PRO B 716
REMARK 465 VAL B 717
REMARK 465 GLU B 718
REMARK 465 LYS B 719
REMARK 465 THR B 720
REMARK 465 GLN B 913
REMARK 465 TYR B 914
REMARK 465 PRO B 915
REMARK 465 ASP B 916
REMARK 465 ASP B 917
REMARK 465 ILE B 918
REMARK 465 ASP B 919
REMARK 465 GLY B 920
REMARK 465 THR B 921
REMARK 465 THR B 922
REMARK 465 TYR B 923
REMARK 465 ASN B 924
REMARK 465 PHE B 925
REMARK 465 ASP B 926
REMARK 465 HIS B 927
REMARK 465 CYS B 928
REMARK 465 THR B 929
REMARK 465 PHE B 930
REMARK 465 SER B 931
REMARK 465 GLY B 932
REMARK 465 ASN B 933
REMARK 465 GLU B 934
REMARK 465 SER B 935
REMARK 465 LYS B 936
REMARK 465 PRO B 937
REMARK 465 LEU B 938
REMARK 465 CYS B 939
REMARK 465 VAL B 940
REMARK 465 GLU B 941
REMARK 465 LEU B 942
REMARK 465 ASP B 943
REMARK 465 ALA B 944
REMARK 465 ASN B 945
REMARK 465 ASN B 946
REMARK 465 GLN B 947
REMARK 465 PRO B 948
REMARK 465 ARG B 949
REMARK 465 PHE B 950
REMARK 465 PRO B 951
REMARK 465 SER B 984
REMARK 465 VAL B 985
REMARK 465 GLN B 986
REMARK 465 GLU B 987
REMARK 465 CYS B 1027
REMARK 465 PHE B 1028
REMARK 465 LYS B 1029
REMARK 465 CYS B 1030
REMARK 465 CYS B 1031
REMARK 465 CYS B 1032
REMARK 465 LYS B 1033
REMARK 465 LYS B 1034
REMARK 465 GLU B 1035
REMARK 465 SER B 1036
REMARK 465 LYS B 1037
REMARK 465 SER B 1071
REMARK 465 ASP B 1072
REMARK 465 SER B 1073
REMARK 465 SER B 1074
REMARK 465 GLU B 1075
REMARK 465 GLU B 1076
REMARK 465 LYS B 1101
REMARK 465 ILE B 1102
REMARK 465 LYS B 1103
REMARK 465 SER B 1104
REMARK 465 ASN B 1105
REMARK 465 SER B 1106
REMARK 465 LEU B 1107
REMARK 465 GLU B 1108
REMARK 465 VAL B 1109
REMARK 465 LEU B 1110
REMARK 465 PHE B 1111
REMARK 465 GLN B 1112
REMARK 465 GLY B 1113
REMARK 465 PRO B 1114
REMARK 465 ASP B 1115
REMARK 465 TYR B 1116
REMARK 465 LYS B 1117
REMARK 465 ASP B 1118
REMARK 465 ASP B 1119
REMARK 465 ASP B 1120
REMARK 465 ASP B 1121
REMARK 465 LYS B 1122
REMARK 465 ALA B 1123
REMARK 465 HIS B 1124
REMARK 465 HIS B 1125
REMARK 465 HIS B 1126
REMARK 465 HIS B 1127
REMARK 465 HIS B 1128
REMARK 465 HIS B 1129
REMARK 465 HIS B 1130
REMARK 465 HIS B 1131
REMARK 465 HIS B 1132
REMARK 465 HIS B 1133
REMARK 465 MET C -43
REMARK 465 ALA C -42
REMARK 465 THR C -41
REMARK 465 LEU C -40
REMARK 465 PHE C -39
REMARK 465 GLN C -38
REMARK 465 VAL C -37
REMARK 465 SER C -36
REMARK 465 MET C -35
REMARK 465 GLY C -34
REMARK 465 SER C -33
REMARK 465 MET C -32
REMARK 465 ARG C -31
REMARK 465 HIS C -30
REMARK 465 ARG C -29
REMARK 465 ARG C -28
REMARK 465 ASN C -27
REMARK 465 GLY C -26
REMARK 465 ASN C -25
REMARK 465 PHE C -24
REMARK 465 GLU C -23
REMARK 465 SER C -22
REMARK 465 SER C -21
REMARK 465 ARG C -20
REMARK 465 LEU C -19
REMARK 465 LEU C -18
REMARK 465 TYR C -17
REMARK 465 SER C -16
REMARK 465 SER C -15
REMARK 465 MET C -14
REMARK 465 SER C -13
REMARK 465 ARG C -12
REMARK 465 SER C -11
REMARK 465 ILE C -10
REMARK 465 ASP C -9
REMARK 465 VAL C -8
REMARK 465 ALA C -7
REMARK 465 CYS C -6
REMARK 465 SER C -5
REMARK 465 ASP C -4
REMARK 465 ALA C -3
REMARK 465 ASP C -2
REMARK 465 LEU C -1
REMARK 465 ALA C 0
REMARK 465 ASN C 1
REMARK 465 PHE C 2
REMARK 465 ILE C 3
REMARK 465 GLN C 4
REMARK 465 GLU C 5
REMARK 465 ASN C 6
REMARK 465 PHE C 7
REMARK 465 LYS C 8
REMARK 465 LYS C 9
REMARK 465 ARG C 10
REMARK 465 GLU C 11
REMARK 465 CYS C 12
REMARK 465 VAL C 13
REMARK 465 PHE C 14
REMARK 465 PHE C 15
REMARK 465 THR C 16
REMARK 465 LYS C 17
REMARK 465 ASP C 18
REMARK 465 THR C 19
REMARK 465 LYS C 20
REMARK 465 SER C 21
REMARK 465 MET C 22
REMARK 465 GLY C 23
REMARK 465 ASN C 24
REMARK 465 LEU C 25
REMARK 465 CYS C 26
REMARK 465 LYS C 27
REMARK 465 CYS C 28
REMARK 465 GLY C 29
REMARK 465 TYR C 30
REMARK 465 PRO C 31
REMARK 465 GLU C 32
REMARK 465 ASN C 33
REMARK 465 GLN C 34
REMARK 465 HIS C 35
REMARK 465 ILE C 36
REMARK 465 GLU C 37
REMARK 465 GLY C 38
REMARK 465 THR C 39
REMARK 465 GLN C 40
REMARK 465 VAL C 41
REMARK 465 ASN C 42
REMARK 465 THR C 43
REMARK 465 THR C 44
REMARK 465 GLU C 45
REMARK 465 LYS C 46
REMARK 465 TRP C 47
REMARK 465 ASN C 48
REMARK 465 TYR C 49
REMARK 465 LYS C 50
REMARK 465 LYS C 51
REMARK 465 HIS C 52
REMARK 465 THR C 149
REMARK 465 GLY C 150
REMARK 465 GLY C 151
REMARK 465 ALA C 152
REMARK 465 GLY C 213
REMARK 465 ILE C 214
REMARK 465 ALA C 215
REMARK 465 ALA C 216
REMARK 465 TRP C 217
REMARK 465 GLY C 218
REMARK 465 MET C 219
REMARK 465 ILE C 220
REMARK 465 SER C 221
REMARK 465 ASN C 222
REMARK 465 ARG C 223
REMARK 465 GLU C 224
REMARK 465 THR C 225
REMARK 465 LEU C 226
REMARK 465 ILE C 227
REMARK 465 ARG C 228
REMARK 465 THR C 229
REMARK 465 ALA C 230
REMARK 465 ASP C 231
REMARK 465 SER C 232
REMARK 465 ASP C 233
REMARK 465 GLY C 234
REMARK 465 SER C 235
REMARK 465 TYR C 236
REMARK 465 LEU C 237
REMARK 465 ALA C 238
REMARK 465 HIS C 239
REMARK 465 TYR C 240
REMARK 465 ILE C 241
REMARK 465 MET C 242
REMARK 465 ASP C 243
REMARK 465 ASP C 244
REMARK 465 LEU C 245
REMARK 465 LYS C 246
REMARK 465 ASP C 264
REMARK 465 ASN C 265
REMARK 465 GLY C 266
REMARK 465 THR C 267
REMARK 465 HIS C 268
REMARK 465 GLY C 269
REMARK 465 HIS C 270
REMARK 465 PRO C 271
REMARK 465 THR C 272
REMARK 465 GLY C 307
REMARK 465 GLY C 308
REMARK 465 GLU C 344
REMARK 465 ALA C 345
REMARK 465 GLU C 346
REMARK 465 GLY C 347
REMARK 465 THR C 348
REMARK 465 LEU C 349
REMARK 465 ALA C 350
REMARK 465 GLU C 398
REMARK 465 ALA C 399
REMARK 465 GLY C 400
REMARK 465 ASP C 401
REMARK 465 GLY C 534
REMARK 465 ALA C 535
REMARK 465 LYS C 536
REMARK 465 ARG C 537
REMARK 465 ASP C 538
REMARK 465 ASP C 539
REMARK 465 LYS C 540
REMARK 465 ASN C 541
REMARK 465 SER C 542
REMARK 465 LYS C 543
REMARK 465 ASP C 544
REMARK 465 GLU C 545
REMARK 465 MET C 546
REMARK 465 GLU C 547
REMARK 465 ILE C 548
REMARK 465 GLU C 549
REMARK 465 LEU C 550
REMARK 465 SER C 551
REMARK 465 GLU C 552
REMARK 465 GLU C 553
REMARK 465 CYS C 554
REMARK 465 LYS C 715
REMARK 465 PRO C 716
REMARK 465 VAL C 717
REMARK 465 GLU C 718
REMARK 465 LYS C 719
REMARK 465 THR C 720
REMARK 465 GLN C 913
REMARK 465 TYR C 914
REMARK 465 PRO C 915
REMARK 465 ASP C 916
REMARK 465 ASP C 917
REMARK 465 ILE C 918
REMARK 465 ASP C 919
REMARK 465 GLY C 920
REMARK 465 THR C 921
REMARK 465 THR C 922
REMARK 465 TYR C 923
REMARK 465 ASN C 924
REMARK 465 PHE C 925
REMARK 465 ASP C 926
REMARK 465 HIS C 927
REMARK 465 CYS C 928
REMARK 465 THR C 929
REMARK 465 PHE C 930
REMARK 465 SER C 931
REMARK 465 GLY C 932
REMARK 465 ASN C 933
REMARK 465 GLU C 934
REMARK 465 SER C 935
REMARK 465 LYS C 936
REMARK 465 PRO C 937
REMARK 465 LEU C 938
REMARK 465 CYS C 939
REMARK 465 VAL C 940
REMARK 465 GLU C 941
REMARK 465 LEU C 942
REMARK 465 ASP C 943
REMARK 465 ALA C 944
REMARK 465 ASN C 945
REMARK 465 ASN C 946
REMARK 465 GLN C 947
REMARK 465 PRO C 948
REMARK 465 ARG C 949
REMARK 465 PHE C 950
REMARK 465 PRO C 951
REMARK 465 SER C 984
REMARK 465 VAL C 985
REMARK 465 GLN C 986
REMARK 465 GLU C 987
REMARK 465 CYS C 1027
REMARK 465 PHE C 1028
REMARK 465 LYS C 1029
REMARK 465 CYS C 1030
REMARK 465 CYS C 1031
REMARK 465 CYS C 1032
REMARK 465 LYS C 1033
REMARK 465 LYS C 1034
REMARK 465 GLU C 1035
REMARK 465 SER C 1036
REMARK 465 LYS C 1037
REMARK 465 SER C 1071
REMARK 465 ASP C 1072
REMARK 465 SER C 1073
REMARK 465 SER C 1074
REMARK 465 GLU C 1075
REMARK 465 GLU C 1076
REMARK 465 LYS C 1101
REMARK 465 ILE C 1102
REMARK 465 LYS C 1103
REMARK 465 SER C 1104
REMARK 465 ASN C 1105
REMARK 465 SER C 1106
REMARK 465 LEU C 1107
REMARK 465 GLU C 1108
REMARK 465 VAL C 1109
REMARK 465 LEU C 1110
REMARK 465 PHE C 1111
REMARK 465 GLN C 1112
REMARK 465 GLY C 1113
REMARK 465 PRO C 1114
REMARK 465 ASP C 1115
REMARK 465 TYR C 1116
REMARK 465 LYS C 1117
REMARK 465 ASP C 1118
REMARK 465 ASP C 1119
REMARK 465 ASP C 1120
REMARK 465 ASP C 1121
REMARK 465 LYS C 1122
REMARK 465 ALA C 1123
REMARK 465 HIS C 1124
REMARK 465 HIS C 1125
REMARK 465 HIS C 1126
REMARK 465 HIS C 1127
REMARK 465 HIS C 1128
REMARK 465 HIS C 1129
REMARK 465 HIS C 1130
REMARK 465 HIS C 1131
REMARK 465 HIS C 1132
REMARK 465 HIS C 1133
REMARK 465 MET D -43
REMARK 465 ALA D -42
REMARK 465 THR D -41
REMARK 465 LEU D -40
REMARK 465 PHE D -39
REMARK 465 GLN D -38
REMARK 465 VAL D -37
REMARK 465 SER D -36
REMARK 465 MET D -35
REMARK 465 GLY D -34
REMARK 465 SER D -33
REMARK 465 MET D -32
REMARK 465 ARG D -31
REMARK 465 HIS D -30
REMARK 465 ARG D -29
REMARK 465 ARG D -28
REMARK 465 ASN D -27
REMARK 465 GLY D -26
REMARK 465 ASN D -25
REMARK 465 PHE D -24
REMARK 465 GLU D -23
REMARK 465 SER D -22
REMARK 465 SER D -21
REMARK 465 ARG D -20
REMARK 465 LEU D -19
REMARK 465 LEU D -18
REMARK 465 TYR D -17
REMARK 465 SER D -16
REMARK 465 SER D -15
REMARK 465 MET D -14
REMARK 465 SER D -13
REMARK 465 ARG D -12
REMARK 465 SER D -11
REMARK 465 ILE D -10
REMARK 465 ASP D -9
REMARK 465 VAL D -8
REMARK 465 ALA D -7
REMARK 465 CYS D -6
REMARK 465 SER D -5
REMARK 465 ASP D -4
REMARK 465 ALA D -3
REMARK 465 ASP D -2
REMARK 465 LEU D -1
REMARK 465 ALA D 0
REMARK 465 ASN D 1
REMARK 465 PHE D 2
REMARK 465 ILE D 3
REMARK 465 GLN D 4
REMARK 465 GLU D 5
REMARK 465 ASN D 6
REMARK 465 PHE D 7
REMARK 465 LYS D 8
REMARK 465 LYS D 9
REMARK 465 ARG D 10
REMARK 465 GLU D 11
REMARK 465 CYS D 12
REMARK 465 VAL D 13
REMARK 465 PHE D 14
REMARK 465 PHE D 15
REMARK 465 THR D 16
REMARK 465 LYS D 17
REMARK 465 ASP D 18
REMARK 465 THR D 19
REMARK 465 LYS D 20
REMARK 465 SER D 21
REMARK 465 MET D 22
REMARK 465 GLY D 23
REMARK 465 ASN D 24
REMARK 465 LEU D 25
REMARK 465 CYS D 26
REMARK 465 LYS D 27
REMARK 465 CYS D 28
REMARK 465 GLY D 29
REMARK 465 TYR D 30
REMARK 465 PRO D 31
REMARK 465 GLU D 32
REMARK 465 ASN D 33
REMARK 465 GLN D 34
REMARK 465 HIS D 35
REMARK 465 ILE D 36
REMARK 465 GLU D 37
REMARK 465 GLY D 38
REMARK 465 THR D 39
REMARK 465 GLN D 40
REMARK 465 VAL D 41
REMARK 465 ASN D 42
REMARK 465 THR D 43
REMARK 465 THR D 44
REMARK 465 GLU D 45
REMARK 465 LYS D 46
REMARK 465 TRP D 47
REMARK 465 ASN D 48
REMARK 465 TYR D 49
REMARK 465 LYS D 50
REMARK 465 LYS D 51
REMARK 465 HIS D 52
REMARK 465 THR D 149
REMARK 465 GLY D 150
REMARK 465 GLY D 151
REMARK 465 ALA D 152
REMARK 465 GLY D 213
REMARK 465 ILE D 214
REMARK 465 ALA D 215
REMARK 465 ALA D 216
REMARK 465 TRP D 217
REMARK 465 GLY D 218
REMARK 465 MET D 219
REMARK 465 ILE D 220
REMARK 465 SER D 221
REMARK 465 ASN D 222
REMARK 465 ARG D 223
REMARK 465 GLU D 224
REMARK 465 THR D 225
REMARK 465 LEU D 226
REMARK 465 ILE D 227
REMARK 465 ARG D 228
REMARK 465 THR D 229
REMARK 465 ALA D 230
REMARK 465 ASP D 231
REMARK 465 SER D 232
REMARK 465 ASP D 233
REMARK 465 GLY D 234
REMARK 465 SER D 235
REMARK 465 TYR D 236
REMARK 465 LEU D 237
REMARK 465 ALA D 238
REMARK 465 HIS D 239
REMARK 465 TYR D 240
REMARK 465 ILE D 241
REMARK 465 MET D 242
REMARK 465 ASP D 243
REMARK 465 ASP D 244
REMARK 465 LEU D 245
REMARK 465 LYS D 246
REMARK 465 ASP D 264
REMARK 465 ASN D 265
REMARK 465 GLY D 266
REMARK 465 THR D 267
REMARK 465 HIS D 268
REMARK 465 GLY D 269
REMARK 465 HIS D 270
REMARK 465 PRO D 271
REMARK 465 THR D 272
REMARK 465 GLY D 307
REMARK 465 GLY D 308
REMARK 465 GLU D 344
REMARK 465 ALA D 345
REMARK 465 GLU D 346
REMARK 465 GLY D 347
REMARK 465 THR D 348
REMARK 465 LEU D 349
REMARK 465 ALA D 350
REMARK 465 GLU D 398
REMARK 465 ALA D 399
REMARK 465 GLY D 400
REMARK 465 ASP D 401
REMARK 465 GLY D 534
REMARK 465 ALA D 535
REMARK 465 LYS D 536
REMARK 465 ARG D 537
REMARK 465 ASP D 538
REMARK 465 ASP D 539
REMARK 465 LYS D 540
REMARK 465 ASN D 541
REMARK 465 SER D 542
REMARK 465 LYS D 543
REMARK 465 ASP D 544
REMARK 465 GLU D 545
REMARK 465 MET D 546
REMARK 465 GLU D 547
REMARK 465 ILE D 548
REMARK 465 GLU D 549
REMARK 465 LEU D 550
REMARK 465 SER D 551
REMARK 465 GLU D 552
REMARK 465 GLU D 553
REMARK 465 CYS D 554
REMARK 465 LYS D 715
REMARK 465 PRO D 716
REMARK 465 VAL D 717
REMARK 465 GLU D 718
REMARK 465 LYS D 719
REMARK 465 THR D 720
REMARK 465 GLN D 913
REMARK 465 TYR D 914
REMARK 465 PRO D 915
REMARK 465 ASP D 916
REMARK 465 ASP D 917
REMARK 465 ILE D 918
REMARK 465 ASP D 919
REMARK 465 GLY D 920
REMARK 465 THR D 921
REMARK 465 THR D 922
REMARK 465 TYR D 923
REMARK 465 ASN D 924
REMARK 465 PHE D 925
REMARK 465 ASP D 926
REMARK 465 HIS D 927
REMARK 465 CYS D 928
REMARK 465 THR D 929
REMARK 465 PHE D 930
REMARK 465 SER D 931
REMARK 465 GLY D 932
REMARK 465 ASN D 933
REMARK 465 GLU D 934
REMARK 465 SER D 935
REMARK 465 LYS D 936
REMARK 465 PRO D 937
REMARK 465 LEU D 938
REMARK 465 CYS D 939
REMARK 465 VAL D 940
REMARK 465 GLU D 941
REMARK 465 LEU D 942
REMARK 465 ASP D 943
REMARK 465 ALA D 944
REMARK 465 ASN D 945
REMARK 465 ASN D 946
REMARK 465 GLN D 947
REMARK 465 PRO D 948
REMARK 465 ARG D 949
REMARK 465 PHE D 950
REMARK 465 PRO D 951
REMARK 465 SER D 984
REMARK 465 VAL D 985
REMARK 465 GLN D 986
REMARK 465 GLU D 987
REMARK 465 CYS D 1027
REMARK 465 PHE D 1028
REMARK 465 LYS D 1029
REMARK 465 CYS D 1030
REMARK 465 CYS D 1031
REMARK 465 CYS D 1032
REMARK 465 LYS D 1033
REMARK 465 LYS D 1034
REMARK 465 GLU D 1035
REMARK 465 SER D 1036
REMARK 465 LYS D 1037
REMARK 465 SER D 1071
REMARK 465 ASP D 1072
REMARK 465 SER D 1073
REMARK 465 SER D 1074
REMARK 465 GLU D 1075
REMARK 465 GLU D 1076
REMARK 465 LYS D 1101
REMARK 465 ILE D 1102
REMARK 465 LYS D 1103
REMARK 465 SER D 1104
REMARK 465 ASN D 1105
REMARK 465 SER D 1106
REMARK 465 LEU D 1107
REMARK 465 GLU D 1108
REMARK 465 VAL D 1109
REMARK 465 LEU D 1110
REMARK 465 PHE D 1111
REMARK 465 GLN D 1112
REMARK 465 GLY D 1113
REMARK 465 PRO D 1114
REMARK 465 ASP D 1115
REMARK 465 TYR D 1116
REMARK 465 LYS D 1117
REMARK 465 ASP D 1118
REMARK 465 ASP D 1119
REMARK 465 ASP D 1120
REMARK 465 ASP D 1121
REMARK 465 LYS D 1122
REMARK 465 ALA D 1123
REMARK 465 HIS D 1124
REMARK 465 HIS D 1125
REMARK 465 HIS D 1126
REMARK 465 HIS D 1127
REMARK 465 HIS D 1128
REMARK 465 HIS D 1129
REMARK 465 HIS D 1130
REMARK 465 HIS D 1131
REMARK 465 HIS D 1132
REMARK 465 HIS D 1133
REMARK 470
REMARK 470 MISSING ATOM
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 470 I=INSERTION CODE):
REMARK 470 M RES CSSEQI ATOMS
REMARK 470 LYS A 116 CG CD CE NZ
REMARK 470 TYR A 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG A 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU A 120 CG CD1 CD2
REMARK 470 CYS A 122 SG
REMARK 470 ASP A 123 CG OD1 OD2
REMARK 470 THR A 124 OG1 CG2
REMARK 470 ASP A 125 CG OD1 OD2
REMARK 470 GLU A 127 CG CD OE1 OE2
REMARK 470 THR A 128 OG1 CG2
REMARK 470 ASP A 131 CG OD1 OD2
REMARK 470 LEU A 132 CG CD1 CD2
REMARK 470 GLN A 135 CG CD OE1 NE2
REMARK 470 HIS A 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS A 140 CG CD CE NZ
REMARK 470 LYS A 153 CG CD CE NZ
REMARK 470 ASN A 154 CG OD1 ND2
REMARK 470 PHE A 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS A 158 CG CD CE NZ
REMARK 470 ARG A 162 CG CD NE CZ NH1 NH2
REMARK 470 THR A 181 OG1 CG2
REMARK 470 THR A 184 OG1 CG2
REMARK 470 HIS A 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU A 188 CG CD1 CD2
REMARK 470 MET A 189 CG SD CE
REMARK 470 LYS A 190 CG CD CE NZ
REMARK 470 GLU A 194 CG CD OE1 OE2
REMARK 470 ASP A 198 CG OD1 OD2
REMARK 470 ARG A 203 NE CZ NH1 NH2
REMARK 470 SER A 204 OG
REMARK 470 SER A 205 OG
REMARK 470 GLU A 206 CG CD OE1 OE2
REMARK 470 VAL A 209 CG1 CG2
REMARK 470 ARG A 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP A 248 CG OD1 OD2
REMARK 470 LEU A 250 CG CD1 CD2
REMARK 470 ASP A 254 CG OD1 OD2
REMARK 470 ASN A 255 CG OD1 ND2
REMARK 470 VAL A 263 CG1 CG2
REMARK 470 ILE A 273 CG1 CG2 CD1
REMARK 470 GLU A 274 CG CD OE1 OE2
REMARK 470 LYS A 276 CG CD CE NZ
REMARK 470 LYS A 283 CG CD CE NZ
REMARK 470 GLU A 287 CG CD OE1 OE2
REMARK 470 GLU A 292 CG CD OE1 OE2
REMARK 470 SER A 293 OG
REMARK 470 ASN A 294 CG OD1 ND2
REMARK 470 GLN A 306 CG CD OE1 NE2
REMARK 470 GLU A 311 CG CD OE1 OE2
REMARK 470 THR A 312 OG1 CG2
REMARK 470 LYS A 314 CG CD CE NZ
REMARK 470 ASN A 317 CG OD1 ND2
REMARK 470 LYS A 323 CG CD CE NZ
REMARK 470 GLU A 330 CG CD OE1 OE2
REMARK 470 ARG A 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL A 338 CG1 CG2
REMARK 470 SER A 341 OG
REMARK 470 LEU A 342 CG CD1 CD2
REMARK 470 VAL A 343 CG1 CG2
REMARK 470 SER A 351 OG
REMARK 470 LYS A 355 CG CD CE NZ
REMARK 470 GLU A 356 CG CD OE1 OE2
REMARK 470 LEU A 359 CG CD1 CD2
REMARK 470 ARG A 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE A 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU A 362 CG CD1 CD2
REMARK 470 ARG A 364 CG CD NE CZ NH1 NH2
REMARK 470 THR A 365 OG1 CG2
REMARK 470 ARG A 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU A 369 CG CD1 CD2
REMARK 470 SER A 370 OG
REMARK 470 GLU A 371 CG CD OE1 OE2
REMARK 470 GLU A 372 CG CD OE1 OE2
REMARK 470 GLU A 373 CG CD OE1 OE2
REMARK 470 THR A 374 OG1 CG2
REMARK 470 GLU A 375 CG CD OE1 OE2
REMARK 470 LYS A 379 CG CD CE NZ
REMARK 470 TRP A 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP A 380 CZ3 CH2
REMARK 470 LYS A 382 CG CD CE NZ
REMARK 470 GLU A 383 CG CD OE1 OE2
REMARK 470 VAL A 384 CG1 CG2
REMARK 470 GLU A 386 CG CD OE1 OE2
REMARK 470 LYS A 395 CG CD CE NZ
REMARK 470 ILE A 396 CG1 CG2 CD1
REMARK 470 GLU A 397 CG CD OE1 OE2
REMARK 470 GLU A 402 CG CD OE1 OE2
REMARK 470 LYS A 414 CE NZ
REMARK 470 THR A 418 OG1 CG2
REMARK 470 GLU A 420 CG CD OE1 OE2
REMARK 470 HIS A 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP A 422 CG OD1 OD2
REMARK 470 ARG A 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP A 424 CG OD1 OD2
REMARK 470 ASN A 425 CG OD1 ND2
REMARK 470 ASP A 440 CG OD1 OD2
REMARK 470 ASP A 444 CG OD1 OD2
REMARK 470 GLU A 445 CG CD OE1 OE2
REMARK 470 ASN A 449 CG OD1 ND2
REMARK 470 ASP A 450 CG OD1 OD2
REMARK 470 ARG A 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU A 454 CG CD OE1 OE2
REMARK 470 SER A 455 OG
REMARK 470 ASP A 457 CG OD1 OD2
REMARK 470 ASP A 460 CG OD1 OD2
REMARK 470 ASP A 469 CG OD1 OD2
REMARK 470 GLU A 491 CG CD OE1 OE2
REMARK 470 GLU A 495 CG CD OE1 OE2
REMARK 470 LYS A 507 CG CD CE NZ
REMARK 470 ASP A 518 CG OD1 OD2
REMARK 470 ASP A 530 CG OD1 OD2
REMARK 470 GLU A 575 CG CD OE1 OE2
REMARK 470 GLU A 627 CG CD OE1 OE2
REMARK 470 ASP A 636 CG OD1 OD2
REMARK 470 GLU A 685 CG CD OE1 OE2
REMARK 470 LYS A 714 CG CD CE NZ
REMARK 470 LYS A 721 CG CD CE NZ
REMARK 470 LYS A 722 CG CD CE NZ
REMARK 470 LYS A 762 CG CD CE NZ
REMARK 470 GLU A 763 CG CD OE1 OE2
REMARK 470 GLU A 768 CG CD OE1 OE2
REMARK 470 ILE A 770 CG1 CG2 CD1
REMARK 470 LEU A 779 CG CD1 CD2
REMARK 470 LYS A 792 CG CD CE NZ
REMARK 470 SER A 795 OG
REMARK 470 ASP A 796 CG OD1 OD2
REMARK 470 ILE A 810 CG1 CG2 CD1
REMARK 470 ILE A 813 CG1 CG2 CD1
REMARK 470 VAL A 814 CG1 CG2
REMARK 470 LEU A 817 CG CD1 CD2
REMARK 470 HIS A 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER A 819 OG
REMARK 470 ASP A 820 CG OD1 OD2
REMARK 470 GLU A 821 CG CD OE1 OE2
REMARK 470 ASP A 834 CG OD1 OD2
REMARK 470 ARG A 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS A 890 CG CD CE NZ
REMARK 470 ASN A 891 CG OD1 ND2
REMARK 470 HIS A 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU A 896 CG CD OE1 OE2
REMARK 470 GLU A 952 CG CD OE1 OE2
REMARK 470 THR A 955 OG1 CG2
REMARK 470 ILE A 956 CG1 CG2 CD1
REMARK 470 LEU A 958 CG CD1 CD2
REMARK 470 VAL A 959 CG1 CG2
REMARK 470 MET A 963 CG SD CE
REMARK 470 ASN A 989 CG OD1 ND2
REMARK 470 LEU A1008 CG CD1 CD2
REMARK 470 ILE A1020 CG1 CG2 CD1
REMARK 470 MET A1022 CG SD CE
REMARK 470 MET A1024 CG SD CE
REMARK 470 LYS A1026 CG CD CE NZ
REMARK 470 GLU A1038 CG CD OE1 OE2
REMARK 470 GLU A1050 CG CD OE1 OE2
REMARK 470 LYS A1069 CG CD CE NZ
REMARK 470 LYS B 116 CG CD CE NZ
REMARK 470 TYR B 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG B 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU B 120 CG CD1 CD2
REMARK 470 CYS B 122 SG
REMARK 470 ASP B 123 CG OD1 OD2
REMARK 470 THR B 124 OG1 CG2
REMARK 470 ASP B 125 CG OD1 OD2
REMARK 470 GLU B 127 CG CD OE1 OE2
REMARK 470 THR B 128 OG1 CG2
REMARK 470 ASP B 131 CG OD1 OD2
REMARK 470 LEU B 132 CG CD1 CD2
REMARK 470 GLN B 135 CG CD OE1 NE2
REMARK 470 HIS B 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS B 140 CG CD CE NZ
REMARK 470 LYS B 153 CG CD CE NZ
REMARK 470 ASN B 154 CG OD1 ND2
REMARK 470 PHE B 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS B 158 CG CD CE NZ
REMARK 470 ARG B 162 CG CD NE CZ NH1 NH2
REMARK 470 THR B 181 OG1 CG2
REMARK 470 THR B 184 OG1 CG2
REMARK 470 HIS B 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU B 188 CG CD1 CD2
REMARK 470 MET B 189 CG SD CE
REMARK 470 LYS B 190 CG CD CE NZ
REMARK 470 GLU B 194 CG CD OE1 OE2
REMARK 470 ASP B 198 CG OD1 OD2
REMARK 470 ARG B 203 NE CZ NH1 NH2
REMARK 470 SER B 204 OG
REMARK 470 SER B 205 OG
REMARK 470 GLU B 206 CG CD OE1 OE2
REMARK 470 VAL B 209 CG1 CG2
REMARK 470 ARG B 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP B 248 CG OD1 OD2
REMARK 470 LEU B 250 CG CD1 CD2
REMARK 470 ASP B 254 CG OD1 OD2
REMARK 470 ASN B 255 CG OD1 ND2
REMARK 470 VAL B 263 CG1 CG2
REMARK 470 ILE B 273 CG1 CG2 CD1
REMARK 470 GLU B 274 CG CD OE1 OE2
REMARK 470 LYS B 276 CG CD CE NZ
REMARK 470 LYS B 283 CG CD CE NZ
REMARK 470 GLU B 287 CG CD OE1 OE2
REMARK 470 GLU B 292 CG CD OE1 OE2
REMARK 470 SER B 293 OG
REMARK 470 ASN B 294 CG OD1 ND2
REMARK 470 GLN B 306 CG CD OE1 NE2
REMARK 470 GLU B 311 CG CD OE1 OE2
REMARK 470 THR B 312 OG1 CG2
REMARK 470 LYS B 314 CG CD CE NZ
REMARK 470 ASN B 317 CG OD1 ND2
REMARK 470 LYS B 323 CG CD CE NZ
REMARK 470 GLU B 330 CG CD OE1 OE2
REMARK 470 ARG B 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL B 338 CG1 CG2
REMARK 470 SER B 341 OG
REMARK 470 LEU B 342 CG CD1 CD2
REMARK 470 VAL B 343 CG1 CG2
REMARK 470 SER B 351 OG
REMARK 470 LYS B 355 CG CD CE NZ
REMARK 470 GLU B 356 CG CD OE1 OE2
REMARK 470 LEU B 359 CG CD1 CD2
REMARK 470 ARG B 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE B 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU B 362 CG CD1 CD2
REMARK 470 ARG B 364 CG CD NE CZ NH1 NH2
REMARK 470 THR B 365 OG1 CG2
REMARK 470 ARG B 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU B 369 CG CD1 CD2
REMARK 470 SER B 370 OG
REMARK 470 GLU B 371 CG CD OE1 OE2
REMARK 470 GLU B 372 CG CD OE1 OE2
REMARK 470 GLU B 373 CG CD OE1 OE2
REMARK 470 THR B 374 OG1 CG2
REMARK 470 GLU B 375 CG CD OE1 OE2
REMARK 470 LYS B 379 CG CD CE NZ
REMARK 470 TRP B 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP B 380 CZ3 CH2
REMARK 470 LYS B 382 CG CD CE NZ
REMARK 470 GLU B 383 CG CD OE1 OE2
REMARK 470 VAL B 384 CG1 CG2
REMARK 470 GLU B 386 CG CD OE1 OE2
REMARK 470 LYS B 395 CG CD CE NZ
REMARK 470 ILE B 396 CG1 CG2 CD1
REMARK 470 GLU B 397 CG CD OE1 OE2
REMARK 470 GLU B 402 CG CD OE1 OE2
REMARK 470 LYS B 414 CE NZ
REMARK 470 THR B 418 OG1 CG2
REMARK 470 GLU B 420 CG CD OE1 OE2
REMARK 470 HIS B 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP B 422 CG OD1 OD2
REMARK 470 ARG B 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP B 424 CG OD1 OD2
REMARK 470 ASN B 425 CG OD1 ND2
REMARK 470 ASP B 440 CG OD1 OD2
REMARK 470 ASP B 444 CG OD1 OD2
REMARK 470 GLU B 445 CG CD OE1 OE2
REMARK 470 ASN B 449 CG OD1 ND2
REMARK 470 ASP B 450 CG OD1 OD2
REMARK 470 ARG B 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU B 454 CG CD OE1 OE2
REMARK 470 SER B 455 OG
REMARK 470 ASP B 457 CG OD1 OD2
REMARK 470 ASP B 460 CG OD1 OD2
REMARK 470 ASP B 469 CG OD1 OD2
REMARK 470 GLU B 491 CG CD OE1 OE2
REMARK 470 GLU B 495 CG CD OE1 OE2
REMARK 470 LYS B 507 CG CD CE NZ
REMARK 470 ASP B 518 CG OD1 OD2
REMARK 470 ASP B 530 CG OD1 OD2
REMARK 470 GLU B 575 CG CD OE1 OE2
REMARK 470 GLU B 627 CG CD OE1 OE2
REMARK 470 ASP B 636 CG OD1 OD2
REMARK 470 GLU B 685 CG CD OE1 OE2
REMARK 470 LYS B 714 CG CD CE NZ
REMARK 470 LYS B 721 CG CD CE NZ
REMARK 470 LYS B 722 CG CD CE NZ
REMARK 470 LYS B 762 CG CD CE NZ
REMARK 470 GLU B 763 CG CD OE1 OE2
REMARK 470 GLU B 768 CG CD OE1 OE2
REMARK 470 ILE B 770 CG1 CG2 CD1
REMARK 470 LEU B 779 CG CD1 CD2
REMARK 470 LYS B 792 CG CD CE NZ
REMARK 470 SER B 795 OG
REMARK 470 ASP B 796 CG OD1 OD2
REMARK 470 ILE B 810 CG1 CG2 CD1
REMARK 470 ILE B 813 CG1 CG2 CD1
REMARK 470 VAL B 814 CG1 CG2
REMARK 470 LEU B 817 CG CD1 CD2
REMARK 470 HIS B 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER B 819 OG
REMARK 470 ASP B 820 CG OD1 OD2
REMARK 470 GLU B 821 CG CD OE1 OE2
REMARK 470 ASP B 834 CG OD1 OD2
REMARK 470 ARG B 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS B 890 CG CD CE NZ
REMARK 470 ASN B 891 CG OD1 ND2
REMARK 470 HIS B 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU B 896 CG CD OE1 OE2
REMARK 470 GLU B 952 CG CD OE1 OE2
REMARK 470 THR B 955 OG1 CG2
REMARK 470 ILE B 956 CG1 CG2 CD1
REMARK 470 LEU B 958 CG CD1 CD2
REMARK 470 VAL B 959 CG1 CG2
REMARK 470 MET B 963 CG SD CE
REMARK 470 ASN B 989 CG OD1 ND2
REMARK 470 LEU B1008 CG CD1 CD2
REMARK 470 ILE B1020 CG1 CG2 CD1
REMARK 470 MET B1022 CG SD CE
REMARK 470 MET B1024 CG SD CE
REMARK 470 LYS B1026 CG CD CE NZ
REMARK 470 GLU B1038 CG CD OE1 OE2
REMARK 470 GLU B1050 CG CD OE1 OE2
REMARK 470 LYS B1069 CG CD CE NZ
REMARK 470 LYS C 116 CG CD CE NZ
REMARK 470 TYR C 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG C 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU C 120 CG CD1 CD2
REMARK 470 CYS C 122 SG
REMARK 470 ASP C 123 CG OD1 OD2
REMARK 470 THR C 124 OG1 CG2
REMARK 470 ASP C 125 CG OD1 OD2
REMARK 470 GLU C 127 CG CD OE1 OE2
REMARK 470 THR C 128 OG1 CG2
REMARK 470 ASP C 131 CG OD1 OD2
REMARK 470 LEU C 132 CG CD1 CD2
REMARK 470 GLN C 135 CG CD OE1 NE2
REMARK 470 HIS C 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS C 140 CG CD CE NZ
REMARK 470 LYS C 153 CG CD CE NZ
REMARK 470 ASN C 154 CG OD1 ND2
REMARK 470 PHE C 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS C 158 CG CD CE NZ
REMARK 470 ARG C 162 CG CD NE CZ NH1 NH2
REMARK 470 THR C 181 OG1 CG2
REMARK 470 THR C 184 OG1 CG2
REMARK 470 HIS C 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU C 188 CG CD1 CD2
REMARK 470 MET C 189 CG SD CE
REMARK 470 LYS C 190 CG CD CE NZ
REMARK 470 GLU C 194 CG CD OE1 OE2
REMARK 470 ASP C 198 CG OD1 OD2
REMARK 470 ARG C 203 NE CZ NH1 NH2
REMARK 470 SER C 204 OG
REMARK 470 SER C 205 OG
REMARK 470 GLU C 206 CG CD OE1 OE2
REMARK 470 VAL C 209 CG1 CG2
REMARK 470 ARG C 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP C 248 CG OD1 OD2
REMARK 470 LEU C 250 CG CD1 CD2
REMARK 470 ASP C 254 CG OD1 OD2
REMARK 470 ASN C 255 CG OD1 ND2
REMARK 470 VAL C 263 CG1 CG2
REMARK 470 ILE C 273 CG1 CG2 CD1
REMARK 470 GLU C 274 CG CD OE1 OE2
REMARK 470 LYS C 276 CG CD CE NZ
REMARK 470 LYS C 283 CG CD CE NZ
REMARK 470 GLU C 287 CG CD OE1 OE2
REMARK 470 GLU C 292 CG CD OE1 OE2
REMARK 470 SER C 293 OG
REMARK 470 ASN C 294 CG OD1 ND2
REMARK 470 GLN C 306 CG CD OE1 NE2
REMARK 470 GLU C 311 CG CD OE1 OE2
REMARK 470 THR C 312 OG1 CG2
REMARK 470 LYS C 314 CG CD CE NZ
REMARK 470 ASN C 317 CG OD1 ND2
REMARK 470 LYS C 323 CG CD CE NZ
REMARK 470 GLU C 330 CG CD OE1 OE2
REMARK 470 ARG C 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL C 338 CG1 CG2
REMARK 470 SER C 341 OG
REMARK 470 LEU C 342 CG CD1 CD2
REMARK 470 VAL C 343 CG1 CG2
REMARK 470 SER C 351 OG
REMARK 470 LYS C 355 CG CD CE NZ
REMARK 470 GLU C 356 CG CD OE1 OE2
REMARK 470 LEU C 359 CG CD1 CD2
REMARK 470 ARG C 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE C 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU C 362 CG CD1 CD2
REMARK 470 ARG C 364 CG CD NE CZ NH1 NH2
REMARK 470 THR C 365 OG1 CG2
REMARK 470 ARG C 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU C 369 CG CD1 CD2
REMARK 470 SER C 370 OG
REMARK 470 GLU C 371 CG CD OE1 OE2
REMARK 470 GLU C 372 CG CD OE1 OE2
REMARK 470 GLU C 373 CG CD OE1 OE2
REMARK 470 THR C 374 OG1 CG2
REMARK 470 GLU C 375 CG CD OE1 OE2
REMARK 470 LYS C 379 CG CD CE NZ
REMARK 470 TRP C 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP C 380 CZ3 CH2
REMARK 470 LYS C 382 CG CD CE NZ
REMARK 470 GLU C 383 CG CD OE1 OE2
REMARK 470 VAL C 384 CG1 CG2
REMARK 470 GLU C 386 CG CD OE1 OE2
REMARK 470 LYS C 395 CG CD CE NZ
REMARK 470 ILE C 396 CG1 CG2 CD1
REMARK 470 GLU C 397 CG CD OE1 OE2
REMARK 470 GLU C 402 CG CD OE1 OE2
REMARK 470 LYS C 414 CE NZ
REMARK 470 THR C 418 OG1 CG2
REMARK 470 GLU C 420 CG CD OE1 OE2
REMARK 470 HIS C 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP C 422 CG OD1 OD2
REMARK 470 ARG C 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP C 424 CG OD1 OD2
REMARK 470 ASN C 425 CG OD1 ND2
REMARK 470 ASP C 440 CG OD1 OD2
REMARK 470 ASP C 444 CG OD1 OD2
REMARK 470 GLU C 445 CG CD OE1 OE2
REMARK 470 ASN C 449 CG OD1 ND2
REMARK 470 ASP C 450 CG OD1 OD2
REMARK 470 ARG C 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU C 454 CG CD OE1 OE2
REMARK 470 SER C 455 OG
REMARK 470 ASP C 457 CG OD1 OD2
REMARK 470 ASP C 460 CG OD1 OD2
REMARK 470 ASP C 469 CG OD1 OD2
REMARK 470 GLU C 491 CG CD OE1 OE2
REMARK 470 GLU C 495 CG CD OE1 OE2
REMARK 470 LYS C 507 CG CD CE NZ
REMARK 470 ASP C 518 CG OD1 OD2
REMARK 470 ASP C 530 CG OD1 OD2
REMARK 470 GLU C 575 CG CD OE1 OE2
REMARK 470 GLU C 627 CG CD OE1 OE2
REMARK 470 ASP C 636 CG OD1 OD2
REMARK 470 GLU C 685 CG CD OE1 OE2
REMARK 470 LYS C 714 CG CD CE NZ
REMARK 470 LYS C 721 CG CD CE NZ
REMARK 470 LYS C 722 CG CD CE NZ
REMARK 470 LYS C 762 CG CD CE NZ
REMARK 470 GLU C 763 CG CD OE1 OE2
REMARK 470 GLU C 768 CG CD OE1 OE2
REMARK 470 ILE C 770 CG1 CG2 CD1
REMARK 470 LEU C 779 CG CD1 CD2
REMARK 470 LYS C 792 CG CD CE NZ
REMARK 470 SER C 795 OG
REMARK 470 ASP C 796 CG OD1 OD2
REMARK 470 ILE C 810 CG1 CG2 CD1
REMARK 470 ILE C 813 CG1 CG2 CD1
REMARK 470 VAL C 814 CG1 CG2
REMARK 470 LEU C 817 CG CD1 CD2
REMARK 470 HIS C 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER C 819 OG
REMARK 470 ASP C 820 CG OD1 OD2
REMARK 470 GLU C 821 CG CD OE1 OE2
REMARK 470 ASP C 834 CG OD1 OD2
REMARK 470 ARG C 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS C 890 CG CD CE NZ
REMARK 470 ASN C 891 CG OD1 ND2
REMARK 470 HIS C 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU C 896 CG CD OE1 OE2
REMARK 470 GLU C 952 CG CD OE1 OE2
REMARK 470 THR C 955 OG1 CG2
REMARK 470 ILE C 956 CG1 CG2 CD1
REMARK 470 LEU C 958 CG CD1 CD2
REMARK 470 VAL C 959 CG1 CG2
REMARK 470 MET C 963 CG SD CE
REMARK 470 ASN C 989 CG OD1 ND2
REMARK 470 LEU C1008 CG CD1 CD2
REMARK 470 ILE C1020 CG1 CG2 CD1
REMARK 470 MET C1022 CG SD CE
REMARK 470 MET C1024 CG SD CE
REMARK 470 LYS C1026 CG CD CE NZ
REMARK 470 GLU C1038 CG CD OE1 OE2
REMARK 470 GLU C1050 CG CD OE1 OE2
REMARK 470 LYS C1069 CG CD CE NZ
REMARK 470 LYS D 116 CG CD CE NZ
REMARK 470 TYR D 117 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 ARG D 119 CG CD NE CZ NH1 NH2
REMARK 470 LEU D 120 CG CD1 CD2
REMARK 470 CYS D 122 SG
REMARK 470 ASP D 123 CG OD1 OD2
REMARK 470 THR D 124 OG1 CG2
REMARK 470 ASP D 125 CG OD1 OD2
REMARK 470 GLU D 127 CG CD OE1 OE2
REMARK 470 THR D 128 OG1 CG2
REMARK 470 ASP D 131 CG OD1 OD2
REMARK 470 LEU D 132 CG CD1 CD2
REMARK 470 GLN D 135 CG CD OE1 NE2
REMARK 470 HIS D 138 CG ND1 CD2 CE1 NE2
REMARK 470 LYS D 140 CG CD CE NZ
REMARK 470 LYS D 153 CG CD CE NZ
REMARK 470 ASN D 154 CG OD1 ND2
REMARK 470 PHE D 155 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LYS D 158 CG CD CE NZ
REMARK 470 ARG D 162 CG CD NE CZ NH1 NH2
REMARK 470 THR D 181 OG1 CG2
REMARK 470 THR D 184 OG1 CG2
REMARK 470 HIS D 185 CG ND1 CD2 CE1 NE2
REMARK 470 LEU D 188 CG CD1 CD2
REMARK 470 MET D 189 CG SD CE
REMARK 470 LYS D 190 CG CD CE NZ
REMARK 470 GLU D 194 CG CD OE1 OE2
REMARK 470 ASP D 198 CG OD1 OD2
REMARK 470 ARG D 203 NE CZ NH1 NH2
REMARK 470 SER D 204 OG
REMARK 470 SER D 205 OG
REMARK 470 GLU D 206 CG CD OE1 OE2
REMARK 470 VAL D 209 CG1 CG2
REMARK 470 ARG D 247 CG CD NE CZ NH1 NH2
REMARK 470 ASP D 248 CG OD1 OD2
REMARK 470 LEU D 250 CG CD1 CD2
REMARK 470 ASP D 254 CG OD1 OD2
REMARK 470 ASN D 255 CG OD1 ND2
REMARK 470 VAL D 263 CG1 CG2
REMARK 470 ILE D 273 CG1 CG2 CD1
REMARK 470 GLU D 274 CG CD OE1 OE2
REMARK 470 LYS D 276 CG CD CE NZ
REMARK 470 LYS D 283 CG CD CE NZ
REMARK 470 GLU D 287 CG CD OE1 OE2
REMARK 470 GLU D 292 CG CD OE1 OE2
REMARK 470 SER D 293 OG
REMARK 470 ASN D 294 CG OD1 ND2
REMARK 470 GLN D 306 CG CD OE1 NE2
REMARK 470 GLU D 311 CG CD OE1 OE2
REMARK 470 THR D 312 OG1 CG2
REMARK 470 LYS D 314 CG CD CE NZ
REMARK 470 ASN D 317 CG OD1 ND2
REMARK 470 LYS D 323 CG CD CE NZ
REMARK 470 GLU D 330 CG CD OE1 OE2
REMARK 470 ARG D 334 CG CD NE CZ NH1 NH2
REMARK 470 VAL D 338 CG1 CG2
REMARK 470 SER D 341 OG
REMARK 470 LEU D 342 CG CD1 CD2
REMARK 470 VAL D 343 CG1 CG2
REMARK 470 SER D 351 OG
REMARK 470 LYS D 355 CG CD CE NZ
REMARK 470 GLU D 356 CG CD OE1 OE2
REMARK 470 LEU D 359 CG CD1 CD2
REMARK 470 ARG D 360 CG CD NE CZ NH1 NH2
REMARK 470 PHE D 361 CG CD1 CD2 CE1 CE2 CZ
REMARK 470 LEU D 362 CG CD1 CD2
REMARK 470 ARG D 364 CG CD NE CZ NH1 NH2
REMARK 470 THR D 365 OG1 CG2
REMARK 470 ARG D 368 CG CD NE CZ NH1 NH2
REMARK 470 LEU D 369 CG CD1 CD2
REMARK 470 SER D 370 OG
REMARK 470 GLU D 371 CG CD OE1 OE2
REMARK 470 GLU D 372 CG CD OE1 OE2
REMARK 470 GLU D 373 CG CD OE1 OE2
REMARK 470 THR D 374 OG1 CG2
REMARK 470 GLU D 375 CG CD OE1 OE2
REMARK 470 LYS D 379 CG CD CE NZ
REMARK 470 TRP D 380 CG CD1 CD2 NE1 CE2 CE3 CZ2
REMARK 470 TRP D 380 CZ3 CH2
REMARK 470 LYS D 382 CG CD CE NZ
REMARK 470 GLU D 383 CG CD OE1 OE2
REMARK 470 VAL D 384 CG1 CG2
REMARK 470 GLU D 386 CG CD OE1 OE2
REMARK 470 LYS D 395 CG CD CE NZ
REMARK 470 ILE D 396 CG1 CG2 CD1
REMARK 470 GLU D 397 CG CD OE1 OE2
REMARK 470 GLU D 402 CG CD OE1 OE2
REMARK 470 LYS D 414 CE NZ
REMARK 470 THR D 418 OG1 CG2
REMARK 470 GLU D 420 CG CD OE1 OE2
REMARK 470 HIS D 421 CG ND1 CD2 CE1 NE2
REMARK 470 ASP D 422 CG OD1 OD2
REMARK 470 ARG D 423 CG CD NE CZ NH1 NH2
REMARK 470 ASP D 424 CG OD1 OD2
REMARK 470 ASN D 425 CG OD1 ND2
REMARK 470 ASP D 440 CG OD1 OD2
REMARK 470 ASP D 444 CG OD1 OD2
REMARK 470 GLU D 445 CG CD OE1 OE2
REMARK 470 ASN D 449 CG OD1 ND2
REMARK 470 ASP D 450 CG OD1 OD2
REMARK 470 ARG D 451 CG CD NE CZ NH1 NH2
REMARK 470 GLU D 454 CG CD OE1 OE2
REMARK 470 SER D 455 OG
REMARK 470 ASP D 457 CG OD1 OD2
REMARK 470 ASP D 460 CG OD1 OD2
REMARK 470 ASP D 469 CG OD1 OD2
REMARK 470 GLU D 491 CG CD OE1 OE2
REMARK 470 GLU D 495 CG CD OE1 OE2
REMARK 470 LYS D 507 CG CD CE NZ
REMARK 470 ASP D 518 CG OD1 OD2
REMARK 470 ASP D 530 CG OD1 OD2
REMARK 470 GLU D 575 CG CD OE1 OE2
REMARK 470 GLU D 627 CG CD OE1 OE2
REMARK 470 ASP D 636 CG OD1 OD2
REMARK 470 GLU D 685 CG CD OE1 OE2
REMARK 470 LYS D 714 CG CD CE NZ
REMARK 470 LYS D 721 CG CD CE NZ
REMARK 470 LYS D 722 CG CD CE NZ
REMARK 470 LYS D 762 CG CD CE NZ
REMARK 470 GLU D 763 CG CD OE1 OE2
REMARK 470 GLU D 768 CG CD OE1 OE2
REMARK 470 ILE D 770 CG1 CG2 CD1
REMARK 470 LEU D 779 CG CD1 CD2
REMARK 470 LYS D 792 CG CD CE NZ
REMARK 470 SER D 795 OG
REMARK 470 ASP D 796 CG OD1 OD2
REMARK 470 ILE D 810 CG1 CG2 CD1
REMARK 470 ILE D 813 CG1 CG2 CD1
REMARK 470 VAL D 814 CG1 CG2
REMARK 470 LEU D 817 CG CD1 CD2
REMARK 470 HIS D 818 CG ND1 CD2 CE1 NE2
REMARK 470 SER D 819 OG
REMARK 470 ASP D 820 CG OD1 OD2
REMARK 470 GLU D 821 CG CD OE1 OE2
REMARK 470 ASP D 834 CG OD1 OD2
REMARK 470 ARG D 889 CG CD NE CZ NH1 NH2
REMARK 470 LYS D 890 CG CD CE NZ
REMARK 470 ASN D 891 CG OD1 ND2
REMARK 470 HIS D 893 CG ND1 CD2 CE1 NE2
REMARK 470 GLU D 896 CG CD OE1 OE2
REMARK 470 GLU D 952 CG CD OE1 OE2
REMARK 470 THR D 955 OG1 CG2
REMARK 470 ILE D 956 CG1 CG2 CD1
REMARK 470 LEU D 958 CG CD1 CD2
REMARK 470 VAL D 959 CG1 CG2
REMARK 470 MET D 963 CG SD CE
REMARK 470 ASN D 989 CG OD1 ND2
REMARK 470 LEU D1008 CG CD1 CD2
REMARK 470 ILE D1020 CG1 CG2 CD1
REMARK 470 MET D1022 CG SD CE
REMARK 470 MET D1024 CG SD CE
REMARK 470 LYS D1026 CG CD CE NZ
REMARK 470 GLU D1038 CG CD OE1 OE2
REMARK 470 GLU D1050 CG CD OE1 OE2
REMARK 470 LYS D1069 CG CD CE NZ
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: TORSION ANGLES
REMARK 500
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)
REMARK 500
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400
REMARK 500
REMARK 500 M RES CSSEQI PSI PHI
REMARK 500 UNK A 110 32.78 -150.09
REMARK 500 ASP A 125 66.34 60.48
REMARK 500 SER A 204 79.26 -102.86
REMARK 500 LYS A 276 -5.91 63.30
REMARK 500 ARG A 334 -166.52 -126.41
REMARK 500 SER A 352 -9.15 71.47
REMARK 500 ASN A 449 -0.37 -59.48
REMARK 500 HIS A 559 74.12 51.80
REMARK 500 GLU A 821 -4.45 70.15
REMARK 500 GLU A 892 74.11 59.96
REMARK 500 HIS A 893 32.24 -81.01
REMARK 500 PHE A 978 -164.89 -105.86
REMARK 500 UNK B 110 32.76 -150.09
REMARK 500 ASP B 125 66.38 60.39
REMARK 500 SER B 204 79.29 -102.88
REMARK 500 LYS B 276 -5.90 63.25
REMARK 500 ARG B 334 -166.52 -126.45
REMARK 500 SER B 352 -9.15 71.41
REMARK 500 ASN B 449 -0.33 -59.45
REMARK 500 HIS B 559 74.15 51.82
REMARK 500 GLU B 821 -4.42 70.09
REMARK 500 GLU B 892 74.15 59.98
REMARK 500 HIS B 893 32.33 -81.07
REMARK 500 PHE B 978 -164.87 -105.90
REMARK 500 UNK C 110 32.78 -150.14
REMARK 500 ASP C 125 66.37 60.41
REMARK 500 SER C 204 79.28 -102.82
REMARK 500 LYS C 276 -5.88 63.28
REMARK 500 ARG C 334 -166.48 -126.39
REMARK 500 SER C 352 -9.13 71.51
REMARK 500 ASN C 449 -0.41 -59.46
REMARK 500 HIS C 559 74.21 51.78
REMARK 500 GLU C 821 -4.51 70.24
REMARK 500 GLU C 892 74.18 59.96
REMARK 500 HIS C 893 32.15 -80.96
REMARK 500 PHE C 978 -164.92 -105.86
REMARK 500 UNK D 110 32.74 -150.06
REMARK 500 ASP D 125 66.36 60.45
REMARK 500 SER D 204 79.23 -102.85
REMARK 500 LYS D 276 -5.94 63.33
REMARK 500 ARG D 334 -166.51 -126.45
REMARK 500 SER D 352 -9.10 71.39
REMARK 500 ASN D 449 -0.35 -59.48
REMARK 500 HIS D 559 74.11 51.82
REMARK 500 GLU D 821 -4.50 70.18
REMARK 500 GLU D 892 74.12 60.02
REMARK 500 HIS D 893 32.26 -81.02
REMARK 500 PHE D 978 -164.87 -105.86
REMARK 500
REMARK 500 REMARK: NULL
REMARK 610
REMARK 610 MISSING HETEROATOM
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 610 I=INSERTION CODE):
REMARK 610 M RES C SSEQI
REMARK 610 KXP A 1301
REMARK 610 KXP B 1301
REMARK 610 KXP C 1301
REMARK 610 KXP D 1301
REMARK 800
REMARK 800 SITE
REMARK 800 SITE_IDENTIFIER: AC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP A 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS A 1302
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP B 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS B 1302
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP C 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS C 1302
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXP D 1301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue KXS D 1302
REMARK 900
REMARK 900 RELATED ENTRIES
REMARK 900 RELATED ID: EMD-0487 RELATED DB: EMDB
REMARK 900 CRYO-EM STRUCTURE OF THE TRPM8 ION CHANNEL IN COMPLEX WITH MENTHOL
REMARK 900 ANALOG WS-12 AND PI(4,5)P2
REMARK 900 RELATED ID: EMD-0488 RELATED DB: EMDB
REMARK 900 RELATED ID: EMD-0489 RELATED DB: EMDB
REMARK 999
REMARK 999 SEQUENCE
REMARK 999 THE COMPLETE SAMPLE SEQUENCE INCLUDING TAGS AND ENGINEERED
REMARK 999 MUTATIONS IS THE FOLLOWING:
REMARK 999 MATLFQVSMGSMRHRRNGNFESSRLLYSSMSRSIDVACSDADLANFIQENFKKRECVFFTKD TKSMG
REMARK 999 NLCKCGYPENQHIEGTQVNTTEKWNYKKHTKELPTDAFGDIQFENLGKRGKYIRL SCDTDSETLYDL
REMARK 999 MTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIF TGGTHYGLMKYIGEVVRDN
REMARK 999 TISRSSEENVVAIGIAAWGMISNRETLIRTADSDGSYLAHY IMDDLKRDPLYCLDNNHTHLLLVDNG
REMARK 999 THGHPTIEAKVRTQLEKYISERVIPESNYGGKIP IVCFAQGGGKETLKSINVAIKSKIPCVVVEGSG
REMARK 999 RIADVIASLVEAEGTLASSCVKESLLR FLPRTISRLSEEETESWIKWIKEVLESPHLLTVIKIEEAG
REMARK 999 DEIVSNAISFALYKAFSTNE HDRDNWNGQLKLLLEWNQLDLASDEIFTNDRNWESADLQDVMFTALV
REMARK 999 KDRPKFVRLFLEN GLNLRKFLTTEVLRELYTNNFSSLVFKNLQIAKNSYNDALLTFVWKMVEDFRRG
REMARK 999 AKRDDK NSKDEMEIELSEECPITRHPLQALFIWSVLQNKKELSKVIWEQTRGCTLAALGASKLLKS
REMARK 999 MAKVKNDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELA VEARDQQ
REMARK 999 FIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFFFPLIGCGFISFRKKPVEKT KKLFLYYVSFFTSP
REMARK 999 FVVFSWNVIFYIAFLLLFAYVLLMDFQKEPTALEIILYVLVFILLC DEVRQWYMNGSKYFSDLWNVM
REMARK 999 DTLAIFYFIAGIVFRLHSDESSWYSGRVIFCLDYIVFTL RLIHIFTVSRNLGPKIIMLQRMMIDVFF
REMARK 999 FLFLFAVWMVAFGVARQGILRKNEHRWEWIFR SVIYEPYLAMFGQYPDDIDGTTYNFDHCTFSGNES
REMARK 999 KPLCVELDANNQPRFPEWITIPLVC IYMLSTNILLVNLLVAMFGYTVGSVQENNDQVWKFQRFFLVQ
REMARK 999 EYCSRLTIPFPFVIFAYI FMVMRKCFKCCCKKESKEPSVCCSRNEDNEILAWEAVMKENYLVKINTK
REMARK 999 ASDSSEEMVHR FRQLDAKLSDLKGLLKEISSKIKSNSLEVLFQGPDYKDDDDKAHHHHHHHHHH
DBREF 6NR2 A -43 50 PDB 6NR2 6NR2 -43 50
DBREF 6NR2 A 51 109 PDB 6NR2 6NR2 51 109
DBREF 6NR2 A 110 1074 PDB 6NR2 6NR2 110 1074
DBREF 6NR2 A 1075 1133 PDB 6NR2 6NR2 1075 1133
DBREF 6NR2 B -43 50 PDB 6NR2 6NR2 -43 50
DBREF 6NR2 B 51 109 PDB 6NR2 6NR2 51 109
DBREF 6NR2 B 110 1074 PDB 6NR2 6NR2 110 1074
DBREF 6NR2 B 1075 1133 PDB 6NR2 6NR2 1075 1133
DBREF 6NR2 C -43 50 PDB 6NR2 6NR2 -43 50
DBREF 6NR2 C 51 109 PDB 6NR2 6NR2 51 109
DBREF 6NR2 C 110 1074 PDB 6NR2 6NR2 110 1074
DBREF 6NR2 C 1075 1133 PDB 6NR2 6NR2 1075 1133
DBREF 6NR2 D -43 50 PDB 6NR2 6NR2 -43 50
DBREF 6NR2 D 51 109 PDB 6NR2 6NR2 51 109
DBREF 6NR2 D 110 1074 PDB 6NR2 6NR2 110 1074
DBREF 6NR2 D 1075 1133 PDB 6NR2 6NR2 1075 1133
SEQRES 1 A 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 A 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 A 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 A 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 A 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 A 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 A 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 A 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 A 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 A 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 A 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 A 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 A 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 A 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 A 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 A 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 A 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 A 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 A 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 A 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 A 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 A 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 A 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 A 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 A 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 A 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 A 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 A 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 A 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 A 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 A 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 A 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 A 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 A 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 A 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 A 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 A 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 A 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 A 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 A 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 A 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 A 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 A 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 A 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 A 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 A 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 A 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 A 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 A 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 A 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 A 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 A 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 A 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 A 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 A 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 A 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 A 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 A 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 A 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 A 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 A 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 A 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 A 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 A 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 A 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 A 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 A 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 A 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 A 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 A 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 A 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 A 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 A 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 A 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 A 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 A 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 A 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 A 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 A 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 A 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 A 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 A 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 A 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 A 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 A 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 A 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 A 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 A 1135 HIS HIS HIS HIS
SEQRES 1 B 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 B 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 B 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 B 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 B 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 B 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 B 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 B 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 B 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 B 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 B 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 B 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 B 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 B 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 B 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 B 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 B 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 B 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 B 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 B 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 B 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 B 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 B 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 B 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 B 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 B 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 B 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 B 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 B 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 B 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 B 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 B 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 B 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 B 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 B 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 B 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 B 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 B 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 B 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 B 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 B 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 B 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 B 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 B 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 B 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 B 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 B 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 B 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 B 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 B 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 B 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 B 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 B 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 B 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 B 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 B 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 B 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 B 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 B 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 B 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 B 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 B 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 B 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 B 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 B 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 B 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 B 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 B 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 B 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 B 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 B 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 B 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 B 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 B 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 B 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 B 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 B 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 B 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 B 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 B 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 B 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 B 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 B 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 B 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 B 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 B 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 B 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 B 1135 HIS HIS HIS HIS
SEQRES 1 C 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 C 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 C 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 C 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 C 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 C 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 C 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 C 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 C 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 C 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 C 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 C 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 C 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 C 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 C 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 C 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 C 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 C 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 C 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 C 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 C 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 C 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 C 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 C 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 C 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 C 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 C 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 C 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 C 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 C 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 C 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 C 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 C 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 C 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 C 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 C 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 C 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 C 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 C 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 C 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 C 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 C 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 C 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 C 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 C 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 C 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 C 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 C 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 C 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 C 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 C 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 C 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 C 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 C 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 C 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 C 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 C 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 C 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 C 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 C 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 C 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 C 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 C 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 C 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 C 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 C 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 C 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 C 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 C 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 C 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 C 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 C 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 C 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 C 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 C 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 C 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 C 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 C 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 C 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 C 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 C 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 C 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 C 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 C 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 C 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 C 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 C 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 C 1135 HIS HIS HIS HIS
SEQRES 1 D 1135 MET ALA THR LEU PHE GLN VAL SER MET GLY SER MET ARG
SEQRES 2 D 1135 HIS ARG ARG ASN GLY ASN PHE GLU SER SER ARG LEU LEU
SEQRES 3 D 1135 TYR SER SER MET SER ARG SER ILE ASP VAL ALA CYS SER
SEQRES 4 D 1135 ASP ALA ASP LEU ALA ASN PHE ILE GLN GLU ASN PHE LYS
SEQRES 5 D 1135 LYS ARG GLU CYS VAL PHE PHE THR LYS ASP THR LYS SER
SEQRES 6 D 1135 MET GLY ASN LEU CYS LYS CYS GLY TYR PRO GLU ASN GLN
SEQRES 7 D 1135 HIS ILE GLU GLY THR GLN VAL ASN THR THR GLU LYS TRP
SEQRES 8 D 1135 ASN TYR LYS LYS HIS UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 9 D 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 10 D 1135 LYS TYR ILE ARG LEU SER CYS ASP THR ASP SER GLU THR
SEQRES 11 D 1135 LEU TYR ASP LEU MET THR GLN HIS TRP HIS LEU LYS THR
SEQRES 12 D 1135 PRO ASN LEU VAL ILE SER VAL THR GLY GLY ALA LYS ASN
SEQRES 13 D 1135 PHE ALA LEU LYS PRO ARG MET ARG LYS ILE PHE SER ARG
SEQRES 14 D 1135 LEU ILE TYR ILE ALA GLN SER LYS GLY ALA TRP ILE PHE
SEQRES 15 D 1135 THR GLY GLY THR HIS TYR GLY LEU MET LYS TYR ILE GLY
SEQRES 16 D 1135 GLU VAL VAL ARG ASP ASN THR ILE SER ARG SER SER GLU
SEQRES 17 D 1135 GLU ASN VAL VAL ALA ILE GLY ILE ALA ALA TRP GLY MET
SEQRES 18 D 1135 ILE SER ASN ARG GLU THR LEU ILE ARG THR ALA ASP SER
SEQRES 19 D 1135 ASP GLY SER TYR LEU ALA HIS TYR ILE MET ASP ASP LEU
SEQRES 20 D 1135 LYS ARG ASP PRO LEU TYR CYS LEU ASP ASN ASN HIS THR
SEQRES 21 D 1135 HIS LEU LEU LEU VAL ASP ASN GLY THR HIS GLY HIS PRO
SEQRES 22 D 1135 THR ILE GLU ALA LYS VAL ARG THR GLN LEU GLU LYS TYR
SEQRES 23 D 1135 ILE SER GLU ARG VAL ILE PRO GLU SER ASN TYR GLY GLY
SEQRES 24 D 1135 LYS ILE PRO ILE VAL CYS PHE ALA GLN GLY GLY GLY LYS
SEQRES 25 D 1135 GLU THR LEU LYS SER ILE ASN VAL ALA ILE LYS SER LYS
SEQRES 26 D 1135 ILE PRO CYS VAL VAL VAL GLU GLY SER GLY ARG ILE ALA
SEQRES 27 D 1135 ASP VAL ILE ALA SER LEU VAL GLU ALA GLU GLY THR LEU
SEQRES 28 D 1135 ALA SER SER CYS VAL LYS GLU SER LEU LEU ARG PHE LEU
SEQRES 29 D 1135 PRO ARG THR ILE SER ARG LEU SER GLU GLU GLU THR GLU
SEQRES 30 D 1135 SER TRP ILE LYS TRP ILE LYS GLU VAL LEU GLU SER PRO
SEQRES 31 D 1135 HIS LEU LEU THR VAL ILE LYS ILE GLU GLU ALA GLY ASP
SEQRES 32 D 1135 GLU ILE VAL SER ASN ALA ILE SER PHE ALA LEU TYR LYS
SEQRES 33 D 1135 ALA PHE SER THR ASN GLU HIS ASP ARG ASP ASN TRP ASN
SEQRES 34 D 1135 GLY GLN LEU LYS LEU LEU LEU GLU TRP ASN GLN LEU ASP
SEQRES 35 D 1135 LEU ALA SER ASP GLU ILE PHE THR ASN ASP ARG ASN TRP
SEQRES 36 D 1135 GLU SER ALA ASP LEU GLN ASP VAL MET PHE THR ALA LEU
SEQRES 37 D 1135 VAL LYS ASP ARG PRO LYS PHE VAL ARG LEU PHE LEU GLU
SEQRES 38 D 1135 ASN GLY LEU ASN LEU ARG LYS PHE LEU THR THR GLU VAL
SEQRES 39 D 1135 LEU ARG GLU LEU TYR THR ASN ASN PHE SER SER LEU VAL
SEQRES 40 D 1135 PHE LYS ASN LEU GLN ILE ALA LYS ASN SER TYR ASN ASP
SEQRES 41 D 1135 ALA LEU LEU THR PHE VAL TRP LYS MET VAL GLU ASP PHE
SEQRES 42 D 1135 ARG ARG GLY ALA LYS ARG ASP ASP LYS ASN SER LYS ASP
SEQRES 43 D 1135 GLU MET GLU ILE GLU LEU SER GLU GLU CYS PRO ILE THR
SEQRES 44 D 1135 ARG HIS PRO LEU GLN ALA LEU PHE ILE TRP SER VAL LEU
SEQRES 45 D 1135 GLN ASN LYS LYS GLU LEU SER LYS VAL ILE TRP GLU GLN
SEQRES 46 D 1135 THR ARG GLY CYS THR LEU ALA ALA LEU GLY ALA SER LYS
SEQRES 47 D 1135 LEU LEU LYS SER MET ALA LYS VAL LYS ASN ASP ILE ASN
SEQRES 48 D 1135 ALA ALA GLY GLU SER GLU GLU LEU ALA ASN GLU TYR GLU
SEQRES 49 D 1135 THR ARG ALA VAL GLU LEU PHE THR GLU CYS TYR SER ASN
SEQRES 50 D 1135 ASP GLU ASP LEU ALA GLU GLN LEU LEU THR TYR SER CYS
SEQRES 51 D 1135 GLU ALA TRP GLY GLY SER ASN CYS LEU GLU LEU ALA VAL
SEQRES 52 D 1135 GLU ALA ARG ASP GLN GLN PHE ILE ALA GLN PRO GLY VAL
SEQRES 53 D 1135 GLN ASN PHE LEU SER LYS GLN TRP TYR GLY GLU ILE SER
SEQRES 54 D 1135 ARG ASP THR LYS ASN TRP LYS ILE ILE LEU CYS LEU PHE
SEQRES 55 D 1135 PHE PHE PRO LEU ILE GLY CYS GLY PHE ILE SER PHE ARG
SEQRES 56 D 1135 LYS LYS PRO VAL GLU LYS THR LYS LYS LEU PHE LEU TYR
SEQRES 57 D 1135 TYR VAL SER PHE PHE THR SER PRO PHE VAL VAL PHE SER
SEQRES 58 D 1135 TRP ASN VAL ILE PHE TYR ILE ALA PHE LEU LEU LEU PHE
SEQRES 59 D 1135 ALA TYR VAL LEU LEU MET ASP PHE GLN LYS GLU PRO THR
SEQRES 60 D 1135 ALA LEU GLU ILE ILE LEU TYR VAL LEU VAL PHE ILE LEU
SEQRES 61 D 1135 LEU CYS ASP GLU VAL ARG GLN TRP TYR MET ASN GLY SER
SEQRES 62 D 1135 LYS TYR PHE SER ASP LEU TRP ASN VAL MET ASP THR LEU
SEQRES 63 D 1135 ALA ILE PHE TYR PHE ILE ALA GLY ILE VAL PHE ARG LEU
SEQRES 64 D 1135 HIS SER ASP GLU SER SER TRP TYR SER GLY ARG VAL ILE
SEQRES 65 D 1135 PHE CYS LEU ASP TYR ILE VAL PHE THR LEU ARG LEU ILE
SEQRES 66 D 1135 HIS ILE PHE THR VAL SER ARG ASN LEU GLY PRO LYS ILE
SEQRES 67 D 1135 ILE MET LEU GLN ARG MET MET ILE ASP VAL PHE PHE PHE
SEQRES 68 D 1135 LEU PHE LEU PHE ALA VAL TRP MET VAL ALA PHE GLY VAL
SEQRES 69 D 1135 ALA ARG GLN GLY ILE LEU ARG LYS ASN GLU HIS ARG TRP
SEQRES 70 D 1135 GLU TRP ILE PHE ARG SER VAL ILE TYR GLU PRO TYR LEU
SEQRES 71 D 1135 ALA MET PHE GLY GLN TYR PRO ASP ASP ILE ASP GLY THR
SEQRES 72 D 1135 THR TYR ASN PHE ASP HIS CYS THR PHE SER GLY ASN GLU
SEQRES 73 D 1135 SER LYS PRO LEU CYS VAL GLU LEU ASP ALA ASN ASN GLN
SEQRES 74 D 1135 PRO ARG PHE PRO GLU TRP ILE THR ILE PRO LEU VAL CYS
SEQRES 75 D 1135 ILE TYR MET LEU SER THR ASN ILE LEU LEU VAL ASN LEU
SEQRES 76 D 1135 LEU VAL ALA MET PHE GLY TYR THR VAL GLY SER VAL GLN
SEQRES 77 D 1135 GLU ASN ASN ASP GLN VAL TRP LYS PHE GLN ARG PHE PHE
SEQRES 78 D 1135 LEU VAL GLN GLU TYR CYS SER ARG LEU THR ILE PRO PHE
SEQRES 79 D 1135 PRO PHE VAL ILE PHE ALA TYR ILE PHE MET VAL MET ARG
SEQRES 80 D 1135 LYS CYS PHE LYS CYS CYS CYS LYS LYS GLU SER LYS GLU
SEQRES 81 D 1135 PRO SER VAL CYS CYS SER ARG ASN GLU ASP ASN GLU ILE
SEQRES 82 D 1135 LEU ALA TRP GLU ALA VAL MET LYS GLU ASN TYR LEU VAL
SEQRES 83 D 1135 LYS ILE ASN THR LYS ALA SER ASP SER SER GLU GLU UNK
SEQRES 84 D 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 85 D 1135 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK LYS ILE LYS
SEQRES 86 D 1135 SER ASN SER LEU GLU VAL LEU PHE GLN GLY PRO ASP TYR
SEQRES 87 D 1135 LYS ASP ASP ASP ASP LYS ALA HIS HIS HIS HIS HIS HIS
SEQRES 88 D 1135 HIS HIS HIS HIS
HET KXP A1301 47
HET KXS A1302 48
HET KXP B1301 47
HET KXS B1302 48
HET KXP C1301 47
HET KXS C1302 48
HET KXP D1301 47
HET KXS D1302 48
HETNAM KXP (2S)-1-{[(R)-HYDROXY{[(1R,2R,3S,4R,5R,6S)-2,3,6-
HETNAM 2 KXP TRIHYDROXY-4,5-BIS(PHOSPHONOOXY)
HETNAM 3 KXP CYCLOHEXYL]OXY}PHOSPHORYL]OXY}-3-(OCTADECANOYLOXY)
HETNAM 4 KXP PROPAN-2-YL ICOSA-5,8,11,14-TETRAENOATE
HETNAM KXS (1R,2S,5R)-N-(4-METHOXYPHENYL)-5-METHYL-2-(PROPAN-2-
HETNAM 2 KXS YL)CYCLOHEXANE-1-CARBOXAMIDE
FORMUL 5 KXP 4(C47 H85 O19 P3)
FORMUL 6 KXS 4(C18 H27 N O2)
HELIX 1 AA1 ASP A 125 HIS A 136 1 12
HELIX 2 AA2 ARG A 160 GLY A 176 1 17
HELIX 3 AA3 GLY A 187 ARG A 203 1 17
HELIX 4 AA4 VAL A 277 GLU A 287 1 11
HELIX 5 AA5 LYS A 310 SER A 322 1 13
HELIX 6 AA6 ARG A 334 VAL A 343 1 10
HELIX 7 AA7 CYS A 353 LEU A 362 1 10
HELIX 8 AA8 LEU A 362 LEU A 369 1 8
HELIX 9 AA9 SER A 370 LEU A 385 1 16
HELIX 10 AB1 ILE A 403 GLU A 420 1 18
HELIX 11 AB2 TRP A 426 TRP A 436 1 11
HELIX 12 AB3 GLN A 438 ILE A 446 1 9
HELIX 13 AB4 GLU A 454 LYS A 468 1 15
HELIX 14 AB5 PRO A 471 ASN A 480 1 10
HELIX 15 AB6 ASN A 483 LEU A 488 1 6
HELIX 16 AB7 THR A 489 ASN A 500 1 12
HELIX 17 AB8 SER A 502 TYR A 516 1 15
HELIX 18 AB9 ASP A 518 ARG A 533 1 16
HELIX 19 AC1 HIS A 559 GLN A 571 1 13
HELIX 20 AC2 LYS A 573 TRP A 581 1 9
HELIX 21 AC3 GLU A 582 THR A 584 5 3
HELIX 22 AC4 GLY A 586 LYS A 603 1 18
HELIX 23 AC5 ASP A 607 ASP A 636 1 30
HELIX 24 AC6 ASP A 636 THR A 645 1 10
HELIX 25 AC7 ASN A 655 ARG A 664 1 10
HELIX 26 AC8 GLN A 671 GLY A 684 1 14
HELIX 27 AC9 LYS A 691 PHE A 701 1 11
HELIX 28 AD1 PHE A 702 GLY A 708 1 7
HELIX 29 AD2 LYS A 722 THR A 732 1 11
HELIX 30 AD3 SER A 733 MET A 758 1 26
HELIX 31 AD4 THR A 765 GLY A 790 1 26
HELIX 32 AD5 GLY A 790 SER A 795 1 6
HELIX 33 AD6 ASP A 796 HIS A 818 1 23
HELIX 34 AD7 SER A 822 ARG A 850 1 29
HELIX 35 AD8 LYS A 855 ARG A 889 1 35
HELIX 36 AD9 ARG A 894 GLY A 912 1 19
HELIX 37 AE1 ILE A 954 PHE A 978 1 25
HELIX 38 AE2 ASN A 989 SER A 1006 1 18
HELIX 39 AE3 PRO A 1011 PRO A 1013 5 3
HELIX 40 AE4 PHE A 1014 LYS A 1026 1 13
HELIX 41 AE5 ARG A 1045 THR A 1068 1 24
HELIX 42 AE6 UNK A 1078 UNK A 1100 1 23
HELIX 43 AE7 ASP B 125 HIS B 136 1 12
HELIX 44 AE8 ARG B 160 GLY B 176 1 17
HELIX 45 AE9 GLY B 187 ARG B 203 1 17
HELIX 46 AF1 VAL B 277 GLU B 287 1 11
HELIX 47 AF2 LYS B 310 SER B 322 1 13
HELIX 48 AF3 ARG B 334 VAL B 343 1 10
HELIX 49 AF4 CYS B 353 LEU B 362 1 10
HELIX 50 AF5 LEU B 362 LEU B 369 1 8
HELIX 51 AF6 SER B 370 LEU B 385 1 16
HELIX 52 AF7 ILE B 403 GLU B 420 1 18
HELIX 53 AF8 TRP B 426 TRP B 436 1 11
HELIX 54 AF9 GLN B 438 ILE B 446 1 9
HELIX 55 AG1 GLU B 454 LYS B 468 1 15
HELIX 56 AG2 PRO B 471 ASN B 480 1 10
HELIX 57 AG3 ASN B 483 LEU B 488 1 6
HELIX 58 AG4 THR B 489 ASN B 500 1 12
HELIX 59 AG5 SER B 502 TYR B 516 1 15
HELIX 60 AG6 ASP B 518 ARG B 533 1 16
HELIX 61 AG7 HIS B 559 GLN B 571 1 13
HELIX 62 AG8 LYS B 573 TRP B 581 1 9
HELIX 63 AG9 GLU B 582 THR B 584 5 3
HELIX 64 AH1 GLY B 586 LYS B 603 1 18
HELIX 65 AH2 ASP B 607 ASP B 636 1 30
HELIX 66 AH3 ASP B 636 THR B 645 1 10
HELIX 67 AH4 ASN B 655 ARG B 664 1 10
HELIX 68 AH5 GLN B 671 GLY B 684 1 14
HELIX 69 AH6 LYS B 691 PHE B 701 1 11
HELIX 70 AH7 PHE B 702 GLY B 708 1 7
HELIX 71 AH8 LYS B 722 THR B 732 1 11
HELIX 72 AH9 SER B 733 MET B 758 1 26
HELIX 73 AI1 THR B 765 GLY B 790 1 26
HELIX 74 AI2 GLY B 790 SER B 795 1 6
HELIX 75 AI3 ASP B 796 HIS B 818 1 23
HELIX 76 AI4 SER B 822 ARG B 850 1 29
HELIX 77 AI5 LYS B 855 ARG B 889 1 35
HELIX 78 AI6 ARG B 894 GLY B 912 1 19
HELIX 79 AI7 ILE B 954 PHE B 978 1 25
HELIX 80 AI8 ASN B 989 SER B 1006 1 18
HELIX 81 AI9 PRO B 1011 PRO B 1013 5 3
HELIX 82 AJ1 PHE B 1014 LYS B 1026 1 13
HELIX 83 AJ2 ARG B 1045 THR B 1068 1 24
HELIX 84 AJ3 UNK B 1078 UNK B 1100 1 23
HELIX 85 AJ4 ASP C 125 HIS C 136 1 12
HELIX 86 AJ5 ARG C 160 GLY C 176 1 17
HELIX 87 AJ6 GLY C 187 ARG C 203 1 17
HELIX 88 AJ7 VAL C 277 GLU C 287 1 11
HELIX 89 AJ8 LYS C 310 SER C 322 1 13
HELIX 90 AJ9 ARG C 334 VAL C 343 1 10
HELIX 91 AK1 CYS C 353 LEU C 362 1 10
HELIX 92 AK2 LEU C 362 LEU C 369 1 8
HELIX 93 AK3 SER C 370 LEU C 385 1 16
HELIX 94 AK4 ILE C 403 GLU C 420 1 18
HELIX 95 AK5 TRP C 426 TRP C 436 1 11
HELIX 96 AK6 GLN C 438 ILE C 446 1 9
HELIX 97 AK7 GLU C 454 LYS C 468 1 15
HELIX 98 AK8 PRO C 471 ASN C 480 1 10
HELIX 99 AK9 ASN C 483 LEU C 488 1 6
HELIX 100 AL1 THR C 489 ASN C 500 1 12
HELIX 101 AL2 SER C 502 TYR C 516 1 15
HELIX 102 AL3 ASP C 518 ARG C 533 1 16
HELIX 103 AL4 HIS C 559 GLN C 571 1 13
HELIX 104 AL5 LYS C 573 TRP C 581 1 9
HELIX 105 AL6 GLU C 582 THR C 584 5 3
HELIX 106 AL7 GLY C 586 LYS C 603 1 18
HELIX 107 AL8 ASP C 607 ASP C 636 1 30
HELIX 108 AL9 ASP C 636 THR C 645 1 10
HELIX 109 AM1 ASN C 655 ARG C 664 1 10
HELIX 110 AM2 GLN C 671 GLY C 684 1 14
HELIX 111 AM3 LYS C 691 PHE C 701 1 11
HELIX 112 AM4 PHE C 702 GLY C 708 1 7
HELIX 113 AM5 LYS C 722 THR C 732 1 11
HELIX 114 AM6 SER C 733 MET C 758 1 26
HELIX 115 AM7 THR C 765 GLY C 790 1 26
HELIX 116 AM8 GLY C 790 SER C 795 1 6
HELIX 117 AM9 ASP C 796 HIS C 818 1 23
HELIX 118 AN1 SER C 822 ARG C 850 1 29
HELIX 119 AN2 LYS C 855 ARG C 889 1 35
HELIX 120 AN3 ARG C 894 GLY C 912 1 19
HELIX 121 AN4 ILE C 954 PHE C 978 1 25
HELIX 122 AN5 ASN C 989 SER C 1006 1 18
HELIX 123 AN6 PRO C 1011 PRO C 1013 5 3
HELIX 124 AN7 PHE C 1014 LYS C 1026 1 13
HELIX 125 AN8 ARG C 1045 THR C 1068 1 24
HELIX 126 AN9 UNK C 1078 UNK C 1100 1 23
HELIX 127 AO1 ASP D 125 HIS D 136 1 12
HELIX 128 AO2 ARG D 160 GLY D 176 1 17
HELIX 129 AO3 GLY D 187 ARG D 203 1 17
HELIX 130 AO4 VAL D 277 GLU D 287 1 11
HELIX 131 AO5 LYS D 310 SER D 322 1 13
HELIX 132 AO6 ARG D 334 VAL D 343 1 10
HELIX 133 AO7 CYS D 353 LEU D 362 1 10
HELIX 134 AO8 LEU D 362 LEU D 369 1 8
HELIX 135 AO9 SER D 370 LEU D 385 1 16
HELIX 136 AP1 ILE D 403 GLU D 420 1 18
HELIX 137 AP2 TRP D 426 TRP D 436 1 11
HELIX 138 AP3 GLN D 438 ILE D 446 1 9
HELIX 139 AP4 GLU D 454 LYS D 468 1 15
HELIX 140 AP5 PRO D 471 ASN D 480 1 10
HELIX 141 AP6 ASN D 483 LEU D 488 1 6
HELIX 142 AP7 THR D 489 ASN D 500 1 12
HELIX 143 AP8 SER D 502 TYR D 516 1 15
HELIX 144 AP9 ASP D 518 ARG D 533 1 16
HELIX 145 AQ1 HIS D 559 GLN D 571 1 13
HELIX 146 AQ2 LYS D 573 TRP D 581 1 9
HELIX 147 AQ3 GLU D 582 THR D 584 5 3
HELIX 148 AQ4 GLY D 586 LYS D 603 1 18
HELIX 149 AQ5 ASP D 607 ASP D 636 1 30
HELIX 150 AQ6 ASP D 636 THR D 645 1 10
HELIX 151 AQ7 ASN D 655 ARG D 664 1 10
HELIX 152 AQ8 GLN D 671 GLY D 684 1 14
HELIX 153 AQ9 LYS D 691 PHE D 701 1 11
HELIX 154 AR1 PHE D 702 GLY D 708 1 7
HELIX 155 AR2 LYS D 722 THR D 732 1 11
HELIX 156 AR3 SER D 733 MET D 758 1 26
HELIX 157 AR4 THR D 765 GLY D 790 1 26
HELIX 158 AR5 GLY D 790 SER D 795 1 6
HELIX 159 AR6 ASP D 796 HIS D 818 1 23
HELIX 160 AR7 SER D 822 ARG D 850 1 29
HELIX 161 AR8 LYS D 855 ARG D 889 1 35
HELIX 162 AR9 ARG D 894 GLY D 912 1 19
HELIX 163 AS1 ILE D 954 PHE D 978 1 25
HELIX 164 AS2 ASN D 989 SER D 1006 1 18
HELIX 165 AS3 PRO D 1011 PRO D 1013 5 3
HELIX 166 AS4 PHE D 1014 LYS D 1026 1 13
HELIX 167 AS5 ARG D 1045 THR D 1068 1 24
HELIX 168 AS6 UNK D 1078 UNK D 1100 1 23
SHEET 1 AA1 6 ASN A 208 ALA A 211 0
SHEET 2 AA1 6 ALA A 177 THR A 181 1 N ILE A 179 O VAL A 210
SHEET 3 AA1 6 ASN A 143 VAL A 148 1 N VAL A 145 O TRP A 178
SHEET 4 AA1 6 ILE A 301 ALA A 305 1 O VAL A 302 N ILE A 146
SHEET 5 AA1 6 CYS A 326 VAL A 329 1 O VAL A 327 N CYS A 303
SHEET 6 AA1 6 LEU A 391 ILE A 394 1 O THR A 392 N VAL A 328
SHEET 1 AA2 6 ASN B 208 ALA B 211 0
SHEET 2 AA2 6 ALA B 177 THR B 181 1 N ILE B 179 O VAL B 210
SHEET 3 AA2 6 ASN B 143 VAL B 148 1 N VAL B 145 O TRP B 178
SHEET 4 AA2 6 ILE B 301 ALA B 305 1 O VAL B 302 N ILE B 146
SHEET 5 AA2 6 CYS B 326 VAL B 329 1 O VAL B 327 N CYS B 303
SHEET 6 AA2 6 LEU B 391 ILE B 394 1 O THR B 392 N VAL B 328
SHEET 1 AA3 6 ASN C 208 ALA C 211 0
SHEET 2 AA3 6 ALA C 177 THR C 181 1 N ILE C 179 O VAL C 210
SHEET 3 AA3 6 ASN C 143 VAL C 148 1 N VAL C 145 O TRP C 178
SHEET 4 AA3 6 ILE C 301 ALA C 305 1 O VAL C 302 N ILE C 146
SHEET 5 AA3 6 CYS C 326 VAL C 329 1 O VAL C 327 N CYS C 303
SHEET 6 AA3 6 LEU C 391 ILE C 394 1 O THR C 392 N VAL C 328
SHEET 1 AA4 6 ASN D 208 ALA D 211 0
SHEET 2 AA4 6 ALA D 177 THR D 181 1 N ILE D 179 O VAL D 210
SHEET 3 AA4 6 ASN D 143 VAL D 148 1 N VAL D 145 O TRP D 178
SHEET 4 AA4 6 ILE D 301 ALA D 305 1 O VAL D 302 N ILE D 146
SHEET 5 AA4 6 CYS D 326 VAL D 329 1 O VAL D 327 N CYS D 303
SHEET 6 AA4 6 LEU D 391 ILE D 394 1 O THR D 392 N VAL D 328
SSBOND 1 CYS A 648 CYS A 1042 1555 1555 2.03
SSBOND 2 CYS B 648 CYS B 1042 1555 1555 2.03
SSBOND 3 CYS C 648 CYS C 1042 1555 1555 2.03
SSBOND 4 CYS D 648 CYS D 1042 1555 1555 2.03
SITE 1 AC1 3 ASN A 692 PHE A 735 LYS D 605
SITE 1 AC2 6 TYR A 745 ASP A 781 ARG A 841 ILE A 845
SITE 2 AC2 6 TYR A1004 ARG A1007
SITE 1 AC3 3 LYS A 605 ASN B 692 PHE B 735
SITE 1 AC4 6 TYR B 745 ASP B 781 ARG B 841 ILE B 845
SITE 2 AC4 6 TYR B1004 ARG B1007
SITE 1 AC5 3 LYS B 605 ASN C 692 PHE C 735
SITE 1 AC6 6 TYR C 745 ASP C 781 ARG C 841 ILE C 845
SITE 2 AC6 6 TYR C1004 ARG C1007
SITE 1 AC7 3 LYS C 605 ASN D 692 PHE D 735
SITE 1 AC8 6 TYR D 745 ASP D 781 ARG D 841 ILE D 845
SITE 2 AC8 6 TYR D1004 ARG D1007
CRYST1 1.000 1.000 1.000 90.00 90.00 90.00 P 1 1
ORIGX1 1.000000 0.000000 0.000000 0.00000
ORIGX2 0.000000 1.000000 0.000000 0.00000
ORIGX3 0.000000 0.000000 1.000000 0.00000
SCALE1 0.003617 0.000000 0.000000 0.00000
SCALE2 0.000000 0.003617 0.000000 0.00000
SCALE3 0.000000 0.000000 0.003617 0.00000
ATOM 1 N UNK A 53 193.811 146.338 115.537 1.00146.36 N
ATOM 2 CA UNK A 53 194.739 145.685 114.622 1.00146.36 C
ATOM 3 C UNK A 53 196.011 145.270 115.351 1.00146.36 C
ATOM 4 O UNK A 53 197.114 145.625 114.938 1.00146.36 O
ATOM 5 CB UNK A 53 195.079 146.610 113.452 1.00146.36 C
ATOM 6 N UNK A 54 195.851 144.514 116.431 1.00148.00 N
ATOM 7 CA UNK A 54 196.986 144.092 117.243 1.00148.00 C
ATOM 8 C UNK A 54 197.735 142.926 116.612 1.00148.00 C
ATOM 9 O UNK A 54 197.278 142.313 115.647 1.00148.00 O
ATOM 10 CB UNK A 54 196.523 143.704 118.648 1.00148.00 C
ATOM 11 N UNK A 55 198.899 142.625 117.176 1.00141.16 N
ATOM 12 CA UNK A 55 199.709 141.505 116.721 1.00141.16 C
ATOM 13 C UNK A 55 199.713 140.408 117.778 1.00141.16 C
ATOM 14 O UNK A 55 199.836 140.685 118.970 1.00141.16 O
ATOM 15 CB UNK A 55 201.138 141.958 116.415 1.00141.16 C
ATOM 16 N UNK A 56 199.581 139.165 117.336 1.00131.26 N
ATOM 17 CA UNK A 56 199.498 138.038 118.254 1.00131.26 C
ATOM 18 C UNK A 56 200.847 137.704 118.880 1.00131.26 C
ATOM 19 O UNK A 56 201.890 138.177 118.428 1.00131.26 O
ATOM 20 CB UNK A 56 198.943 136.812 117.531 1.00131.26 C
ATOM 21 N UNK A 57 200.810 136.878 119.921 1.00128.32 N
ATOM 22 CA UNK A 57 202.009 136.473 120.644 1.00128.32 C
ATOM 23 C UNK A 57 201.756 135.187 121.418 1.00128.32 C
ATOM 24 O UNK A 57 200.986 135.190 122.377 1.00128.32 O
ATOM 25 CB UNK A 57 202.458 137.576 121.606 1.00128.32 C
ATOM 26 N UNK A 58 202.399 134.097 121.011 1.00129.76 N
ATOM 27 CA UNK A 58 202.213 132.822 121.693 1.00129.76 C
ATOM 28 C UNK A 58 203.428 131.909 121.565 1.00129.76 C
ATOM 29 O UNK A 58 204.452 132.293 120.999 1.00129.76 O
ATOM 30 CB UNK A 58 200.975 132.108 121.154 1.00129.76 C
ATOM 31 N UNK A 59 203.295 130.694 122.091 1.00131.22 N
ATOM 32 CA UNK A 59 204.400 129.739 122.152 1.00131.22 C
ATOM 33 C UNK A 59 204.756 129.165 120.785 1.00131.22 C
ATOM 34 O UNK A 59 203.860 128.794 120.026 1.00131.22 O
ATOM 35 CB UNK A 59 204.058 128.600 123.112 1.00131.22 C
ATOM 36 N UNK A 60 206.062 129.103 120.506 1.00127.31 N
ATOM 37 CA UNK A 60 206.646 128.606 119.251 1.00127.31 C
ATOM 38 C UNK A 60 206.084 129.305 118.018 1.00127.31 C
ATOM 39 O UNK A 60 205.899 128.680 116.975 1.00127.31 O
ATOM 40 CB UNK A 60 206.451 127.091 119.122 1.00127.31 C
ATOM 41 N UNK A 61 205.825 130.602 118.140 1.00125.56 N
ATOM 42 CA UNK A 61 205.101 131.323 117.104 1.00125.56 C
ATOM 43 C UNK A 61 205.747 132.647 116.726 1.00125.56 C
ATOM 44 O UNK A 61 205.697 133.612 117.487 1.00125.56 O
ATOM 45 CB UNK A 61 203.665 131.574 117.559 1.00125.56 C
ATOM 46 N UNK A 62 206.344 132.688 115.542 1.00125.06 N
ATOM 47 CA UNK A 62 206.845 133.937 114.992 1.00125.06 C
ATOM 48 C UNK A 62 205.665 134.750 114.478 1.00125.06 C
ATOM 49 O UNK A 62 204.803 134.217 113.783 1.00125.06 O
ATOM 50 CB UNK A 62 207.851 133.675 113.872 1.00125.06 C
ATOM 51 N UNK A 63 205.617 136.031 114.821 1.00121.17 N
ATOM 52 CA UNK A 63 204.504 136.875 114.405 1.00121.17 C
ATOM 53 C UNK A 63 204.816 137.611 113.106 1.00121.17 C
ATOM 54 O UNK A 63 205.950 137.606 112.624 1.00121.17 O
ATOM 55 CB UNK A 63 204.152 137.878 115.503 1.00121.17 C
ATOM 56 N UNK A 64 203.792 138.239 112.541 1.00127.95 N
ATOM 57 CA UNK A 64 203.935 139.015 111.318 1.00127.95 C
ATOM 58 C UNK A 64 202.834 140.061 111.272 1.00127.95 C
ATOM 59 O UNK A 64 201.806 139.906 111.927 1.00127.95 O
ATOM 60 CB UNK A 64 203.873 138.115 110.085 1.00127.95 C
ATOM 61 N UNK A 65 203.045 141.119 110.500 1.00130.05 N
ATOM 62 CA UNK A 65 202.082 142.211 110.438 1.00130.05 C
ATOM 63 C UNK A 65 200.891 141.860 109.556 1.00130.05 C
ATOM 64 O UNK A 65 200.875 140.828 108.882 1.00130.05 O
ATOM 65 CB UNK A 65 202.752 143.487 109.925 1.00130.05 C
ATOM 66 N UNK A 66 199.890 142.732 109.571 1.00140.73 N
ATOM 67 CA UNK A 66 198.714 142.563 108.732 1.00140.73 C
ATOM 68 C UNK A 66 199.001 143.053 107.320 1.00140.73 C
ATOM 69 O UNK A 66 198.191 143.766 106.728 1.00140.73 O
ATOM 70 CB UNK A 66 197.520 143.316 109.318 1.00140.73 C
ATOM 71 N UNK A 105 195.123 137.964 121.890 1.00125.02 N
ATOM 72 CA UNK A 105 194.795 136.630 121.398 1.00125.02 C
ATOM 73 C UNK A 105 196.048 135.798 121.166 1.00125.02 C
ATOM 74 O UNK A 105 196.669 135.894 120.109 1.00125.02 O
ATOM 75 CB UNK A 105 193.992 136.722 120.102 1.00125.02 C
ATOM 76 N UNK A 106 196.410 134.982 122.151 1.00130.02 N
ATOM 77 CA UNK A 106 197.575 134.116 122.039 1.00130.02 C
ATOM 78 C UNK A 106 197.303 132.978 121.062 1.00130.02 C
ATOM 79 O UNK A 106 196.609 132.016 121.391 1.00130.02 O
ATOM 80 CB UNK A 106 197.964 133.560 123.407 1.00130.02 C
ATOM 81 N UNK A 107 197.855 133.097 119.860 1.00126.69 N
ATOM 82 CA UNK A 107 197.596 132.136 118.797 1.00126.69 C
ATOM 83 C UNK A 107 198.816 131.266 118.520 1.00126.69 C
ATOM 84 O UNK A 107 199.812 131.745 117.979 1.00126.69 O
ATOM 85 CB UNK A 107 197.170 132.866 117.523 1.00126.69 C
ATOM 86 N UNK A 108 198.734 129.991 118.886 1.00120.94 N
ATOM 87 CA UNK A 108 199.849 129.065 118.705 1.00120.94 C
ATOM 88 C UNK A 108 200.014 128.641 117.248 1.00120.94 C
ATOM 89 O UNK A 108 199.630 127.533 116.876 1.00120.94 O
ATOM 90 CB UNK A 108 199.658 127.828 119.583 1.00120.94 C
ATOM 91 N UNK A 109 200.607 129.511 116.436 1.00120.31 N
ATOM 92 CA UNK A 109 200.746 129.256 115.006 1.00120.31 C
ATOM 93 C UNK A 109 201.856 128.255 114.698 1.00120.31 C
ATOM 94 O UNK A 109 202.473 127.689 115.599 1.00120.31 O
ATOM 95 CB UNK A 109 201.007 130.563 114.257 1.00120.31 C
ATOM 96 N UNK A 110 202.102 128.035 113.411 1.00120.85 N
ATOM 97 CA UNK A 110 203.152 127.120 112.982 1.00120.85 C
ATOM 98 C UNK A 110 203.725 127.558 111.641 1.00120.85 C
ATOM 99 O UNK A 110 204.134 126.728 110.828 1.00120.85 O
ATOM 100 CB UNK A 110 202.621 125.689 112.888 1.00120.85 C
ATOM 101 N UNK A 111 203.752 128.868 111.422 1.00117.29 N
ATOM 102 CA UNK A 111 204.271 129.440 110.187 1.00117.29 C
ATOM 103 C UNK A 111 205.786 129.293 110.099 1.00117.29 C
ATOM 104 O UNK A 111 206.382 129.537 109.048 1.00117.29 O
ATOM 105 CB UNK A 111 203.883 130.915 110.081 1.00117.29 C
ATOM 106 N LYS A 116 193.839 127.753 119.295 1.00113.28 N
ATOM 107 CA LYS A 116 193.873 128.783 118.267 1.00113.28 C
ATOM 108 C LYS A 116 195.025 128.542 117.305 1.00113.28 C
ATOM 109 O LYS A 116 195.730 129.474 116.928 1.00113.28 O
ATOM 110 CB LYS A 116 193.994 130.168 118.900 1.00113.28 C
ATOM 111 N TYR A 117 195.201 127.281 116.916 1.00112.66 N
ATOM 112 CA TYR A 117 196.325 126.896 116.074 1.00112.66 C
ATOM 113 C TYR A 117 196.156 127.438 114.661 1.00112.66 C
ATOM 114 O TYR A 117 195.071 127.382 114.081 1.00112.66 O
ATOM 115 CB TYR A 117 196.458 125.375 116.038 1.00112.66 C
ATOM 116 N ILE A 118 197.240 127.973 114.112 1.00114.90 N
ATOM 117 CA ILE A 118 197.249 128.557 112.778 1.00114.90 C
ATOM 118 C ILE A 118 198.297 127.834 111.951 1.00114.90 C
ATOM 119 O ILE A 118 199.454 127.723 112.369 1.00114.90 O
ATOM 120 CB ILE A 118 197.546 130.066 112.821 1.00114.90 C
ATOM 121 CG1 ILE A 118 196.462 130.801 113.601 1.00114.90 C
ATOM 122 CG2 ILE A 118 197.655 130.633 111.417 1.00114.90 C
ATOM 123 CD1 ILE A 118 196.803 132.241 113.881 1.00114.90 C
ATOM 124 N ARG A 119 197.897 127.339 110.786 1.00118.68 N
ATOM 125 CA ARG A 119 198.824 126.735 109.842 1.00118.68 C
ATOM 126 C ARG A 119 198.714 127.452 108.507 1.00118.68 C
ATOM 127 O ARG A 119 197.623 127.541 107.935 1.00118.68 O
ATOM 128 CB ARG A 119 198.542 125.241 109.668 1.00118.68 C
ATOM 129 N LEU A 120 199.836 127.972 108.021 1.00128.32 N
ATOM 130 CA LEU A 120 199.901 128.479 106.659 1.00128.32 C
ATOM 131 C LEU A 120 200.253 127.326 105.732 1.00128.32 C
ATOM 132 O LEU A 120 201.080 126.477 106.078 1.00128.32 O
ATOM 133 CB LEU A 120 200.936 129.597 106.543 1.00128.32 C
ATOM 134 N SER A 121 199.624 127.286 104.561 1.00133.31 N
ATOM 135 CA SER A 121 199.727 126.102 103.723 1.00133.31 C
ATOM 136 C SER A 121 199.757 126.485 102.253 1.00133.31 C
ATOM 137 O SER A 121 199.162 127.480 101.834 1.00133.31 O
ATOM 138 CB SER A 121 198.565 125.139 103.989 1.00133.31 C
ATOM 139 OG SER A 121 197.332 125.723 103.607 1.00133.31 O
ATOM 140 N CYS A 122 200.468 125.676 101.474 1.00129.30 N
ATOM 141 CA CYS A 122 200.383 125.756 100.027 1.00129.30 C
ATOM 142 C CYS A 122 199.196 124.934 99.532 1.00129.30 C
ATOM 143 O CYS A 122 198.719 124.014 100.200 1.00129.30 O
ATOM 144 CB CYS A 122 201.678 125.263 99.384 1.00129.30 C
ATOM 145 N ASP A 123 198.723 125.273 98.333 1.00123.46 N
ATOM 146 CA ASP A 123 197.501 124.681 97.792 1.00123.46 C
ATOM 147 C ASP A 123 197.803 123.282 97.259 1.00123.46 C
ATOM 148 O ASP A 123 198.044 123.071 96.068 1.00123.46 O
ATOM 149 CB ASP A 123 196.915 125.575 96.708 1.00123.46 C
ATOM 150 N THR A 124 197.764 122.306 98.169 1.00132.57 N
ATOM 151 CA THR A 124 197.983 120.903 97.829 1.00132.57 C
ATOM 152 C THR A 124 197.417 120.021 98.937 1.00132.57 C
ATOM 153 O THR A 124 197.210 120.470 100.067 1.00132.57 O
ATOM 154 CB THR A 124 199.472 120.595 97.619 1.00132.57 C
ATOM 155 N ASP A 125 197.168 118.752 98.580 1.00134.63 N
ATOM 156 CA ASP A 125 196.954 117.638 99.521 1.00134.63 C
ATOM 157 C ASP A 125 195.753 117.846 100.446 1.00134.63 C
ATOM 158 O ASP A 125 195.896 118.001 101.660 1.00134.63 O
ATOM 159 CB ASP A 125 198.220 117.369 100.337 1.00134.63 C
ATOM 160 N SER A 126 194.556 117.855 99.853 1.00136.98 N
ATOM 161 CA SER A 126 193.333 118.045 100.631 1.00136.98 C
ATOM 162 C SER A 126 193.061 116.856 101.546 1.00136.98 C
ATOM 163 O SER A 126 192.609 117.027 102.686 1.00136.98 O
ATOM 164 CB SER A 126 192.149 118.270 99.692 1.00136.98 C
ATOM 165 OG SER A 126 192.315 119.454 98.936 1.00136.98 O
ATOM 166 N GLU A 127 193.322 115.641 101.056 1.00132.35 N
ATOM 167 CA GLU A 127 193.079 114.447 101.859 1.00132.35 C
ATOM 168 C GLU A 127 194.041 114.370 103.036 1.00132.35 C
ATOM 169 O GLU A 127 193.636 114.030 104.153 1.00132.35 O
ATOM 170 CB GLU A 127 193.194 113.196 100.988 1.00132.35 C
ATOM 171 N THR A 128 195.310 114.719 102.808 1.00131.45 N
ATOM 172 CA THR A 128 196.271 114.792 103.903 1.00131.45 C
ATOM 173 C THR A 128 195.917 115.913 104.869 1.00131.45 C
ATOM 174 O THR A 128 196.153 115.796 106.076 1.00131.45 O
ATOM 175 CB THR A 128 197.682 114.988 103.352 1.00131.45 C
ATOM 176 N LEU A 129 195.321 116.995 104.356 1.00130.87 N
ATOM 177 CA LEU A 129 194.889 118.103 105.205 1.00130.87 C
ATOM 178 C LEU A 129 193.767 117.688 106.146 1.00130.87 C
ATOM 179 O LEU A 129 193.810 117.982 107.350 1.00130.87 O
ATOM 180 CB LEU A 129 194.442 119.273 104.333 1.00130.87 C
ATOM 181 CG LEU A 129 193.913 120.495 105.071 1.00130.87 C
ATOM 182 CD1 LEU A 129 194.981 121.064 105.976 1.00130.87 C
ATOM 183 CD2 LEU A 129 193.443 121.532 104.074 1.00130.87 C
ATOM 184 N TYR A 130 192.752 117.003 105.614 1.00132.30 N
ATOM 185 CA TYR A 130 191.671 116.518 106.464 1.00132.30 C
ATOM 186 C TYR A 130 192.159 115.429 107.409 1.00132.30 C
ATOM 187 O TYR A 130 191.693 115.341 108.551 1.00132.30 O
ATOM 188 CB TYR A 130 190.509 116.015 105.610 1.00132.30 C
ATOM 189 CG TYR A 130 189.355 115.465 106.418 1.00132.30 C
ATOM 190 CD1 TYR A 130 188.518 116.311 107.132 1.00132.30 C
ATOM 191 CD2 TYR A 130 189.096 114.100 106.457 1.00132.30 C
ATOM 192 CE1 TYR A 130 187.464 115.812 107.872 1.00132.30 C
ATOM 193 CE2 TYR A 130 188.043 113.592 107.192 1.00132.30 C
ATOM 194 CZ TYR A 130 187.231 114.454 107.895 1.00132.30 C
ATOM 195 OH TYR A 130 186.184 113.955 108.630 1.00132.30 O
ATOM 196 N ASP A 131 193.117 114.608 106.962 1.00130.49 N
ATOM 197 CA ASP A 131 193.706 113.602 107.840 1.00130.49 C
ATOM 198 C ASP A 131 194.463 114.250 108.994 1.00130.49 C
ATOM 199 O ASP A 131 194.418 113.759 110.126 1.00130.49 O
ATOM 200 CB ASP A 131 194.630 112.686 107.040 1.00130.49 C
ATOM 201 N LEU A 132 195.133 115.373 108.728 1.00131.15 N
ATOM 202 CA LEU A 132 195.809 116.110 109.790 1.00131.15 C
ATOM 203 C LEU A 132 194.811 116.737 110.753 1.00131.15 C
ATOM 204 O LEU A 132 195.010 116.702 111.972 1.00131.15 O
ATOM 205 CB LEU A 132 196.716 117.183 109.190 1.00131.15 C
ATOM 206 N MET A 133 193.720 117.300 110.227 1.00132.58 N
ATOM 207 CA MET A 133 192.734 117.939 111.099 1.00132.58 C
ATOM 208 C MET A 133 191.967 116.912 111.926 1.00132.58 C
ATOM 209 O MET A 133 191.446 117.230 113.002 1.00132.58 O
ATOM 210 CB MET A 133 191.778 118.797 110.280 1.00132.58 C
ATOM 211 CG MET A 133 192.420 120.039 109.715 1.00132.58 C
ATOM 212 SD MET A 133 191.226 121.089 108.878 1.00132.58 S
ATOM 213 CE MET A 133 190.954 120.142 107.385 1.00132.58 C
ATOM 214 N THR A 134 191.878 115.674 111.439 1.00133.60 N
ATOM 215 CA THR A 134 191.261 114.622 112.242 1.00133.60 C
ATOM 216 C THR A 134 192.236 114.057 113.267 1.00133.60 C
ATOM 217 O THR A 134 191.876 113.851 114.431 1.00133.60 O
ATOM 218 CB THR A 134 190.727 113.506 111.348 1.00133.60 C
ATOM 219 OG1 THR A 134 191.764 113.054 110.470 1.00133.60 O
ATOM 220 CG2 THR A 134 189.519 113.973 110.554 1.00133.60 C
ATOM 221 N GLN A 135 193.476 113.787 112.851 1.00132.56 N
ATOM 222 CA GLN A 135 194.416 113.097 113.727 1.00132.56 C
ATOM 223 C GLN A 135 194.945 114.015 114.820 1.00132.56 C
ATOM 224 O GLN A 135 195.181 113.572 115.950 1.00132.56 O
ATOM 225 CB GLN A 135 195.570 112.527 112.905 1.00132.56 C
ATOM 226 N HIS A 136 195.144 115.296 114.508 1.00134.98 N
ATOM 227 CA HIS A 136 195.793 116.181 115.467 1.00134.98 C
ATOM 228 C HIS A 136 194.793 116.814 116.428 1.00134.98 C
ATOM 229 O HIS A 136 194.966 116.726 117.649 1.00134.98 O
ATOM 230 CB HIS A 136 196.599 117.246 114.727 1.00134.98 C
ATOM 231 CG HIS A 136 197.773 116.694 113.978 1.00134.98 C
ATOM 232 ND1 HIS A 136 198.916 116.256 114.610 1.00134.98 N
ATOM 233 CD2 HIS A 136 197.982 116.506 112.654 1.00134.98 C
ATOM 234 CE1 HIS A 136 199.777 115.821 113.708 1.00134.98 C
ATOM 235 NE2 HIS A 136 199.234 115.961 112.512 1.00134.98 N
ATOM 236 N TRP A 137 193.742 117.452 115.913 1.00132.91 N
ATOM 237 CA TRP A 137 192.872 118.212 116.804 1.00132.91 C
ATOM 238 C TRP A 137 191.457 117.656 116.940 1.00132.91 C
ATOM 239 O TRP A 137 191.023 117.325 118.049 1.00132.91 O
ATOM 240 CB TRP A 137 192.757 119.660 116.329 1.00132.91 C
ATOM 241 CG TRP A 137 194.017 120.455 116.344 1.00132.91 C
ATOM 242 CD1 TRP A 137 194.559 121.114 117.406 1.00132.91 C
ATOM 243 CD2 TRP A 137 194.854 120.745 115.221 1.00132.91 C
ATOM 244 NE1 TRP A 137 195.705 121.767 117.022 1.00132.91 N
ATOM 245 CE2 TRP A 137 195.904 121.558 115.683 1.00132.91 C
ATOM 246 CE3 TRP A 137 194.823 120.384 113.871 1.00132.91 C
ATOM 247 CZ2 TRP A 137 196.918 122.012 114.845 1.00132.91 C
ATOM 248 CZ3 TRP A 137 195.825 120.836 113.043 1.00132.91 C
ATOM 249 CH2 TRP A 137 196.858 121.642 113.531 1.00132.91 C
ATOM 250 N HIS A 138 190.733 117.540 115.830 1.00125.03 N
ATOM 251 CA HIS A 138 189.279 117.484 115.870 1.00125.03 C
ATOM 252 C HIS A 138 188.746 116.088 115.581 1.00125.03 C
ATOM 253 O HIS A 138 189.360 115.300 114.859 1.00125.03 O
ATOM 254 CB HIS A 138 188.675 118.470 114.871 1.00125.03 C
ATOM 255 N LEU A 139 187.579 115.799 116.153 1.00117.22 N
ATOM 256 CA LEU A 139 186.892 114.537 115.926 1.00117.22 C
ATOM 257 C LEU A 139 186.084 114.583 114.632 1.00117.22 C
ATOM 258 O LEU A 139 185.899 115.638 114.023 1.00117.22 O
ATOM 259 CB LEU A 139 186.004 114.204 117.129 1.00117.22 C
ATOM 260 CG LEU A 139 185.010 115.240 117.672 1.00117.22 C
ATOM 261 CD1 LEU A 139 183.634 115.149 117.045 1.00117.22 C
ATOM 262 CD2 LEU A 139 184.909 115.120 119.184 1.00117.22 C
ATOM 263 N LYS A 140 185.614 113.411 114.205 1.00114.05 N
ATOM 264 CA LYS A 140 184.807 113.328 112.995 1.00114.05 C
ATOM 265 C LYS A 140 183.434 113.933 113.240 1.00114.05 C
ATOM 266 O LYS A 140 182.782 113.642 114.245 1.00114.05 O
ATOM 267 CB LYS A 140 184.668 111.876 112.543 1.00114.05 C
ATOM 268 N THR A 141 182.985 114.769 112.306 1.00112.59 N
ATOM 269 CA THR A 141 181.810 115.569 112.631 1.00112.59 C
ATOM 270 C THR A 141 180.663 115.291 111.675 1.00112.59 C
ATOM 271 O THR A 141 180.878 115.208 110.458 1.00112.59 O
ATOM 272 CB THR A 141 182.156 117.049 112.602 1.00112.59 C
ATOM 273 OG1 THR A 141 182.772 117.370 111.351 1.00112.59 O
ATOM 274 CG2 THR A 141 183.084 117.391 113.753 1.00112.59 C
ATOM 275 N PRO A 142 179.441 115.167 112.200 1.00110.32 N
ATOM 276 CA PRO A 142 178.328 114.701 111.360 1.00110.32 C
ATOM 277 C PRO A 142 177.806 115.752 110.403 1.00110.32 C
ATOM 278 O PRO A 142 177.127 115.409 109.431 1.00110.32 O
ATOM 279 CB PRO A 142 177.257 114.314 112.389 1.00110.32 C
ATOM 280 CG PRO A 142 177.992 114.177 113.683 1.00110.32 C
ATOM 281 CD PRO A 142 179.082 115.178 113.625 1.00110.32 C
ATOM 282 N ASN A 143 178.083 117.026 110.654 1.00111.94 N
ATOM 283 CA ASN A 143 177.509 118.101 109.862 1.00111.94 C
ATOM 284 C ASN A 143 178.586 119.138 109.587 1.00111.94 C
ATOM 285 O ASN A 143 179.573 119.229 110.318 1.00111.94 O
ATOM 286 CB ASN A 143 176.319 118.738 110.591 1.00111.94 C
ATOM 287 CG ASN A 143 175.463 119.588 109.685 1.00111.94 C
ATOM 288 OD1 ASN A 143 175.731 119.709 108.493 1.00111.94 O
ATOM 289 ND2 ASN A 143 174.422 120.182 110.245 1.00111.94 N
ATOM 290 N LEU A 144 178.401 119.908 108.517 1.00107.67 N
ATOM 291 CA LEU A 144 179.259 121.050 108.232 1.00107.67 C
ATOM 292 C LEU A 144 178.490 122.077 107.415 1.00107.67 C
ATOM 293 O LEU A 144 177.831 121.733 106.430 1.00107.67 O
ATOM 294 CB LEU A 144 180.548 120.612 107.529 1.00107.67 C
ATOM 295 CG LEU A 144 180.561 119.895 106.188 1.00107.67 C
ATOM 296 CD1 LEU A 144 180.733 120.870 105.035 1.00107.67 C
ATOM 297 CD2 LEU A 144 181.670 118.880 106.212 1.00107.67 C
ATOM 298 N VAL A 145 178.562 123.332 107.842 1.00106.15 N
ATOM 299 CA VAL A 145 177.848 124.434 107.216 1.00106.15 C
ATOM 300 C VAL A 145 178.871 125.395 106.635 1.00106.15 C
ATOM 301 O VAL A 145 179.682 125.962 107.373 1.00106.15 O
ATOM 302 CB VAL A 145 176.944 125.154 108.231 1.00106.15 C
ATOM 303 CG1 VAL A 145 176.305 126.369 107.609 1.00106.15 C
ATOM 304 CG2 VAL A 145 175.887 124.216 108.755 1.00106.15 C
ATOM 305 N ILE A 146 178.833 125.585 105.322 1.00112.43 N
ATOM 306 CA ILE A 146 179.637 126.594 104.644 1.00112.43 C
ATOM 307 C ILE A 146 178.763 127.807 104.357 1.00112.43 C
ATOM 308 O ILE A 146 177.704 127.689 103.731 1.00112.43 O
ATOM 309 CB ILE A 146 180.284 126.044 103.357 1.00112.43 C
ATOM 310 CG1 ILE A 146 181.244 127.064 102.730 1.00112.43 C
ATOM 311 CG2 ILE A 146 179.248 125.543 102.385 1.00112.43 C
ATOM 312 CD1 ILE A 146 182.133 126.527 101.674 1.00112.43 C
ATOM 313 N SER A 147 179.198 128.966 104.839 1.00110.62 N
ATOM 314 CA SER A 147 178.499 130.220 104.624 1.00110.62 C
ATOM 315 C SER A 147 179.444 131.214 103.973 1.00110.62 C
ATOM 316 O SER A 147 180.617 131.302 104.345 1.00110.62 O
ATOM 317 CB SER A 147 177.973 130.787 105.938 1.00110.62 C
ATOM 318 OG SER A 147 179.044 131.151 106.785 1.00110.62 O
ATOM 319 N VAL A 148 178.931 131.951 102.997 1.00119.15 N
ATOM 320 CA VAL A 148 179.700 132.998 102.346 1.00119.15 C
ATOM 321 C VAL A 148 179.041 134.350 102.578 1.00119.15 C
ATOM 322 O VAL A 148 177.908 134.579 102.155 1.00119.15 O
ATOM 323 CB VAL A 148 179.855 132.724 100.847 1.00119.15 C
ATOM 324 CG1 VAL A 148 180.580 133.874 100.182 1.00119.15 C
ATOM 325 CG2 VAL A 148 180.600 131.423 100.625 1.00119.15 C
ATOM 326 N LYS A 153 183.362 144.413 101.690 1.00129.46 N
ATOM 327 CA LYS A 153 182.260 143.480 101.883 1.00129.46 C
ATOM 328 C LYS A 153 181.499 143.788 103.166 1.00129.46 C
ATOM 329 O LYS A 153 180.995 142.884 103.829 1.00129.46 O
ATOM 330 CB LYS A 153 182.776 142.041 101.914 1.00129.46 C
ATOM 331 N ASN A 154 181.422 145.070 103.511 1.00129.68 N
ATOM 332 CA ASN A 154 180.728 145.480 104.724 1.00129.68 C
ATOM 333 C ASN A 154 179.220 145.451 104.519 1.00129.68 C
ATOM 334 O ASN A 154 178.721 145.669 103.412 1.00129.68 O
ATOM 335 CB ASN A 154 181.173 146.879 105.145 1.00129.68 C
ATOM 336 N PHE A 155 178.493 145.175 105.599 1.00127.06 N
ATOM 337 CA PHE A 155 177.041 145.104 105.567 1.00127.06 C
ATOM 338 C PHE A 155 176.488 145.600 106.894 1.00127.06 C
ATOM 339 O PHE A 155 177.232 145.889 107.833 1.00127.06 O
ATOM 340 CB PHE A 155 176.546 143.680 105.284 1.00127.06 C
ATOM 341 N ALA A 156 175.164 145.699 106.958 1.00124.64 N
ATOM 342 CA ALA A 156 174.461 146.177 108.141 1.00124.64 C
ATOM 343 C ALA A 156 173.533 145.083 108.649 1.00124.64 C
ATOM 344 O ALA A 156 172.925 144.359 107.854 1.00124.64 O
ATOM 345 CB ALA A 156 173.675 147.450 107.834 1.00124.64 C
ATOM 346 N LEU A 157 173.431 144.963 109.969 1.00122.55 N
ATOM 347 CA LEU A 157 172.569 143.950 110.556 1.00122.55 C
ATOM 348 C LEU A 157 171.121 144.423 110.566 1.00122.55 C
ATOM 349 O LEU A 157 170.836 145.607 110.756 1.00122.55 O
ATOM 350 CB LEU A 157 173.039 143.611 111.976 1.00122.55 C
ATOM 351 CG LEU A 157 172.961 144.603 113.147 1.00122.55 C
ATOM 352 CD1 LEU A 157 171.695 144.417 113.990 1.00122.55 C
ATOM 353 CD2 LEU A 157 174.206 144.523 114.018 1.00122.55 C
ATOM 354 N LYS A 158 170.209 143.484 110.357 1.00129.76 N
ATOM 355 CA LYS A 158 168.782 143.721 110.518 1.00129.76 C
ATOM 356 C LYS A 158 168.391 143.220 111.903 1.00129.76 C
ATOM 357 O LYS A 158 169.148 142.451 112.506 1.00129.76 O
ATOM 358 CB LYS A 158 167.997 143.009 109.412 1.00129.76 C
ATOM 359 N PRO A 159 167.244 143.628 112.456 1.00128.04 N
ATOM 360 CA PRO A 159 166.834 143.035 113.741 1.00128.04 C
ATOM 361 C PRO A 159 166.330 141.604 113.626 1.00128.04 C
ATOM 362 O PRO A 159 166.208 140.921 114.649 1.00128.04 O
ATOM 363 CB PRO A 159 165.743 143.993 114.236 1.00128.04 C
ATOM 364 CG PRO A 159 165.234 144.655 113.013 1.00128.04 C
ATOM 365 CD PRO A 159 166.414 144.793 112.105 1.00128.04 C
ATOM 366 N ARG A 160 166.023 141.125 112.418 1.00128.62 N
ATOM 367 CA ARG A 160 165.588 139.741 112.240 1.00128.62 C
ATOM 368 C ARG A 160 166.767 138.805 111.987 1.00128.62 C
ATOM 369 O ARG A 160 166.808 137.695 112.527 1.00128.62 O
ATOM 370 CB ARG A 160 164.584 139.630 111.087 1.00128.62 C
ATOM 371 CG ARG A 160 163.962 138.248 110.980 1.00128.62 C
ATOM 372 CD ARG A 160 163.051 138.111 109.783 1.00128.62 C
ATOM 373 NE ARG A 160 163.805 138.110 108.536 1.00128.62 N
ATOM 374 CZ ARG A 160 163.248 138.139 107.332 1.00128.62 C
ATOM 375 NH1 ARG A 160 161.928 138.167 107.212 1.00128.62 N1+
ATOM 376 NH2 ARG A 160 164.009 138.135 106.246 1.00128.62 N
ATOM 377 N MET A 161 167.717 139.239 111.152 1.00128.49 N
ATOM 378 CA MET A 161 168.871 138.449 110.723 1.00128.49 C
ATOM 379 C MET A 161 169.744 137.981 111.882 1.00128.49 C
ATOM 380 O MET A 161 170.354 136.905 111.814 1.00128.49 O
ATOM 381 CB MET A 161 169.713 139.264 109.745 1.00128.49 C
ATOM 382 CG MET A 161 169.009 139.574 108.441 1.00128.49 C
ATOM 383 SD MET A 161 168.610 138.103 107.484 1.00128.49 S
ATOM 384 CE MET A 161 170.244 137.585 106.964 1.00128.49 C
ATOM 385 N ARG A 162 169.807 138.798 112.940 1.00126.55 N
ATOM 386 CA ARG A 162 170.532 138.427 114.152 1.00126.55 C
ATOM 387 C ARG A 162 169.936 137.185 114.800 1.00126.55 C
ATOM 388 O ARG A 162 170.671 136.277 115.214 1.00126.55 O
ATOM 389 CB ARG A 162 170.515 139.597 115.132 1.00126.55 C
ATOM 390 N LYS A 163 168.602 137.127 114.878 1.00128.67 N
ATOM 391 CA LYS A 163 167.912 135.941 115.379 1.00128.67 C
ATOM 392 C LYS A 163 168.170 134.731 114.491 1.00128.67 C
ATOM 393 O LYS A 163 168.344 133.614 114.992 1.00128.67 O
ATOM 394 CB LYS A 163 166.414 136.236 115.491 1.00128.67 C
ATOM 395 CG LYS A 163 165.529 135.088 115.960 1.00128.67 C
ATOM 396 CD LYS A 163 164.721 134.507 114.803 1.00128.67 C
ATOM 397 CE LYS A 163 163.771 133.428 115.278 1.00128.67 C
ATOM 398 NZ LYS A 163 162.729 133.982 116.183 1.00128.67 N1+
ATOM 399 N ILE A 164 168.242 134.945 113.174 1.00122.87 N
ATOM 400 CA ILE A 164 168.469 133.849 112.233 1.00122.87 C
ATOM 401 C ILE A 164 169.858 133.254 112.418 1.00122.87 C
ATOM 402 O ILE A 164 170.023 132.030 112.481 1.00122.87 O
ATOM 403 CB ILE A 164 168.254 134.346 110.794 1.00122.87 C
ATOM 404 CG1 ILE A 164 166.817 134.824 110.626 1.00122.87 C
ATOM 405 CG2 ILE A 164 168.560 133.252 109.792 1.00122.87 C
ATOM 406 CD1 ILE A 164 166.573 135.558 109.339 1.00122.87 C
ATOM 407 N PHE A 165 170.871 134.105 112.558 1.00123.24 N
ATOM 408 CA PHE A 165 172.230 133.586 112.666 1.00123.24 C
ATOM 409 C PHE A 165 172.509 133.020 114.054 1.00123.24 C
ATOM 410 O PHE A 165 173.271 132.050 114.189 1.00123.24 O
ATOM 411 CB PHE A 165 173.220 134.677 112.279 1.00123.24 C
ATOM 412 CG PHE A 165 173.213 134.979 110.812 1.00123.24 C
ATOM 413 CD1 PHE A 165 172.765 134.033 109.903 1.00123.24 C
ATOM 414 CD2 PHE A 165 173.600 136.219 110.341 1.00123.24 C
ATOM 415 CE1 PHE A 165 172.738 134.306 108.551 1.00123.24 C
ATOM 416 CE2 PHE A 165 173.568 136.499 108.985 1.00123.24 C
ATOM 417 CZ PHE A 165 173.140 135.539 108.091 1.00123.24 C
ATOM 418 N SER A 166 171.871 133.573 115.092 1.00123.57 N
ATOM 419 CA SER A 166 171.959 132.955 116.412 1.00123.57 C
ATOM 420 C SER A 166 171.274 131.594 116.424 1.00123.57 C
ATOM 421 O SER A 166 171.765 130.649 117.055 1.00123.57 O
ATOM 422 CB SER A 166 171.344 133.872 117.466 1.00123.57 C
ATOM 423 OG SER A 166 169.949 133.998 117.271 1.00123.57 O
ATOM 424 N ARG A 167 170.161 131.471 115.695 1.00118.92 N
ATOM 425 CA ARG A 167 169.490 130.187 115.540 1.00118.92 C
ATOM 426 C ARG A 167 170.376 129.185 114.812 1.00118.92 C
ATOM 427 O ARG A 167 170.435 128.007 115.189 1.00118.92 O
ATOM 428 CB ARG A 167 168.181 130.396 114.782 1.00118.92 C
ATOM 429 CG ARG A 167 167.372 129.145 114.570 1.00118.92 C
ATOM 430 CD ARG A 167 166.879 128.622 115.893 1.00118.92 C
ATOM 431 NE ARG A 167 165.982 129.574 116.532 1.00118.92 N
ATOM 432 CZ ARG A 167 165.581 129.488 117.794 1.00118.92 C
ATOM 433 NH1 ARG A 167 165.999 128.489 118.558 1.00118.92 N
ATOM 434 NH2 ARG A 167 164.762 130.402 118.292 1.00118.92 N
ATOM 435 N LEU A 168 171.091 129.648 113.783 1.00113.41 N
ATOM 436 CA LEU A 168 171.962 128.766 113.013 1.00113.41 C
ATOM 437 C LEU A 168 173.120 128.254 113.859 1.00113.41 C
ATOM 438 O LEU A 168 173.444 127.061 113.822 1.00113.41 O
ATOM 439 CB LEU A 168 172.474 129.503 111.777 1.00113.41 C
ATOM 440 CG LEU A 168 173.166 128.727 110.658 1.00113.41 C
ATOM 441 CD1 LEU A 168 172.825 129.395 109.354 1.00113.41 C
ATOM 442 CD2 LEU A 168 174.676 128.690 110.811 1.00113.41 C
ATOM 443 N ILE A 169 173.742 129.136 114.643 1.00113.49 N
ATOM 444 CA ILE A 169 174.855 128.701 115.484 1.00113.49 C
ATOM 445 C ILE A 169 174.353 127.821 116.629 1.00113.49 C
ATOM 446 O ILE A 169 175.044 126.886 117.061 1.00113.49 O
ATOM 447 CB ILE A 169 175.647 129.929 115.970 1.00113.49 C
ATOM 448 CG1 ILE A 169 176.246 130.645 114.767 1.00113.49 C
ATOM 449 CG2 ILE A 169 176.789 129.554 116.891 1.00113.49 C
ATOM 450 CD1 ILE A 169 176.890 131.955 115.102 1.00113.49 C
ATOM 451 N TYR A 170 173.116 128.047 117.083 1.00115.22 N
ATOM 452 CA TYR A 170 172.531 127.171 118.094 1.00115.22 C
ATOM 453 C TYR A 170 172.308 125.761 117.556 1.00115.22 C
ATOM 454 O TYR A 170 172.589 124.773 118.248 1.00115.22 O
ATOM 455 CB TYR A 170 171.219 127.765 118.596 1.00115.22 C
ATOM 456 CG TYR A 170 170.587 126.957 119.692 1.00115.22 C
ATOM 457 CD1 TYR A 170 171.119 126.964 120.975 1.00115.22 C
ATOM 458 CD2 TYR A 170 169.457 126.189 119.450 1.00115.22 C
ATOM 459 CE1 TYR A 170 170.549 126.227 121.988 1.00115.22 C
ATOM 460 CE2 TYR A 170 168.877 125.446 120.458 1.00115.22 C
ATOM 461 CZ TYR A 170 169.428 125.470 121.726 1.00115.22 C
ATOM 462 OH TYR A 170 168.859 124.734 122.740 1.00115.22 O
ATOM 463 N ILE A 171 171.819 125.653 116.316 1.00111.46 N
ATOM 464 CA ILE A 171 171.669 124.348 115.671 1.00111.46 C
ATOM 465 C ILE A 171 173.028 123.690 115.470 1.00111.46 C
ATOM 466 O ILE A 171 173.190 122.480 115.684 1.00111.46 O
ATOM 467 CB ILE A 171 170.905 124.502 114.343 1.00111.46 C
ATOM 468 CG1 ILE A 171 169.470 124.938 114.611 1.00111.46 C
ATOM 469 CG2 ILE A 171 170.892 123.215 113.545 1.00111.46 C
ATOM 470 CD1 ILE A 171 168.748 125.394 113.376 1.00111.46 C
ATOM 471 N ALA A 172 174.035 124.487 115.103 1.00107.79 N
ATOM 472 CA ALA A 172 175.372 123.950 114.865 1.00107.79 C
ATOM 473 C ALA A 172 176.010 123.429 116.146 1.00107.79 C
ATOM 474 O ALA A 172 176.814 122.491 116.111 1.00107.79 O
ATOM 475 CB ALA A 172 176.257 125.017 114.231 1.00107.79 C
ATOM 476 N GLN A 173 175.675 124.027 117.287 1.00113.29 N
ATOM 477 CA GLN A 173 176.179 123.492 118.547 1.00113.29 C
ATOM 478 C GLN A 173 175.378 122.274 118.986 1.00113.29 C
ATOM 479 O GLN A 173 175.934 121.341 119.577 1.00113.29 O
ATOM 480 CB GLN A 173 176.159 124.566 119.632 1.00113.29 C
ATOM 481 CG GLN A 173 176.801 124.137 120.942 1.00113.29 C
ATOM 482 CD GLN A 173 176.821 125.241 121.972 1.00113.29 C
ATOM 483 OE1 GLN A 173 176.342 126.347 121.724 1.00113.29 O
ATOM 484 NE2 GLN A 173 177.367 124.945 123.142 1.00113.29 N
ATOM 485 N SER A 174 174.071 122.264 118.705 1.00109.84 N
ATOM 486 CA SER A 174 173.229 121.155 119.146 1.00109.84 C
ATOM 487 C SER A 174 173.554 119.867 118.398 1.00109.84 C
ATOM 488 O SER A 174 173.681 118.805 119.014 1.00109.84 O
ATOM 489 CB SER A 174 171.758 121.511 118.967 1.00109.84 C
ATOM 490 OG SER A 174 171.437 121.620 117.594 1.00109.84 O
ATOM 491 N LYS A 175 173.695 119.936 117.075 1.00100.44 N
ATOM 492 CA LYS A 175 174.037 118.726 116.335 1.00100.44 C
ATOM 493 C LYS A 175 175.520 118.403 116.441 1.00100.44 C
ATOM 494 O LYS A 175 175.898 117.230 116.510 1.00100.44 O
ATOM 495 CB LYS A 175 173.647 118.867 114.868 1.00100.44 C
ATOM 496 CG LYS A 175 172.174 119.072 114.637 1.00100.44 C
ATOM 497 CD LYS A 175 171.389 117.845 115.024 1.00100.44 C
ATOM 498 CE LYS A 175 169.933 117.994 114.629 1.00100.44 C
ATOM 499 NZ LYS A 175 169.240 119.019 115.453 1.00100.44 N
ATOM 500 N GLY A 176 176.370 119.424 116.427 1.00106.52 N
ATOM 501 CA GLY A 176 177.802 119.221 116.378 1.00106.52 C
ATOM 502 C GLY A 176 178.259 119.338 114.941 1.00106.52 C
ATOM 503 O GLY A 176 178.070 118.402 114.159 1.00106.52 O
ATOM 504 N ALA A 177 178.849 120.467 114.574 1.00108.71 N
ATOM 505 CA ALA A 177 179.089 120.769 113.172 1.00108.71 C
ATOM 506 C ALA A 177 180.337 121.618 112.986 1.00108.71 C
ATOM 507 O ALA A 177 181.007 122.002 113.945 1.00108.71 O
ATOM 508 CB ALA A 177 177.891 121.492 112.554 1.00108.71 C
ATOM 509 N TRP A 178 180.635 121.901 111.725 1.00105.82 N
ATOM 510 CA TRP A 178 181.734 122.770 111.341 1.00105.82 C
ATOM 511 C TRP A 178 181.195 123.962 110.573 1.00105.82 C
ATOM 512 O TRP A 178 180.340 123.808 109.697 1.00105.82 O
ATOM 513 CB TRP A 178 182.756 122.026 110.491 1.00105.82 C
ATOM 514 CG TRP A 178 183.643 121.155 111.280 1.00105.82 C
ATOM 515 CD1 TRP A 178 183.713 121.088 112.630 1.00105.82 C
ATOM 516 CD2 TRP A 178 184.619 120.242 110.779 1.00105.82 C
ATOM 517 NE1 TRP A 178 184.671 120.188 113.008 1.00105.82 N
ATOM 518 CE2 TRP A 178 185.237 119.648 111.888 1.00105.82 C
ATOM 519 CE3 TRP A 178 185.027 119.865 109.497 1.00105.82 C
ATOM 520 CZ2 TRP A 178 186.239 118.693 111.760 1.00105.82 C
ATOM 521 CZ3 TRP A 178 186.021 118.918 109.370 1.00105.82 C
ATOM 522 CH2 TRP A 178 186.617 118.343 110.494 1.00105.82 C
ATOM 523 N ILE A 179 181.686 125.146 110.911 1.00103.75 N
ATOM 524 CA ILE A 179 181.362 126.366 110.191 1.00103.75 C
ATOM 525 C ILE A 179 182.588 126.776 109.389 1.00103.75 C
ATOM 526 O ILE A 179 183.680 126.924 109.947 1.00103.75 O
ATOM 527 CB ILE A 179 180.922 127.488 111.142 1.00103.75 C
ATOM 528 CG1 ILE A 179 179.611 127.130 111.837 1.00103.75 C
ATOM 529 CG2 ILE A 179 180.792 128.796 110.394 1.00103.75 C
ATOM 530 CD1 ILE A 179 179.231 128.099 112.924 1.00103.75 C
ATOM 531 N PHE A 180 182.415 126.941 108.081 1.00105.37 N
ATOM 532 CA PHE A 180 183.449 127.465 107.208 1.00105.37 C
ATOM 533 C PHE A 180 183.042 128.855 106.753 1.00105.37 C
ATOM 534 O PHE A 180 182.004 129.023 106.109 1.00105.37 O
ATOM 535 CB PHE A 180 183.673 126.545 106.014 1.00105.37 C
ATOM 536 CG PHE A 180 184.351 125.260 106.367 1.00105.37 C
ATOM 537 CD1 PHE A 180 185.725 125.198 106.458 1.00105.37 C
ATOM 538 CD2 PHE A 180 183.617 124.122 106.634 1.00105.37 C
ATOM 539 CE1 PHE A 180 186.360 124.021 106.792 1.00105.37 C
ATOM 540 CE2 PHE A 180 184.245 122.939 106.969 1.00105.37 C
ATOM 541 CZ PHE A 180 185.621 122.890 107.048 1.00105.37 C
ATOM 542 N THR A 181 183.848 129.850 107.105 1.00113.95 N
ATOM 543 CA THR A 181 183.496 131.235 106.852 1.00113.95 C
ATOM 544 C THR A 181 184.626 131.909 106.098 1.00113.95 C
ATOM 545 O THR A 181 185.667 131.307 105.829 1.00113.95 O
ATOM 546 CB THR A 181 183.208 131.996 108.148 1.00113.95 C
ATOM 547 N GLY A 182 184.406 133.181 105.765 1.00124.47 N
ATOM 548 CA GLY A 182 185.376 133.905 104.957 1.00124.47 C
ATOM 549 C GLY A 182 186.645 134.249 105.713 1.00124.47 C
ATOM 550 O GLY A 182 187.700 134.452 105.109 1.00124.47 O
ATOM 551 N GLY A 183 186.561 134.325 107.038 1.00125.75 N
ATOM 552 CA GLY A 183 187.720 134.711 107.825 1.00125.75 C
ATOM 553 C GLY A 183 188.087 136.168 107.677 1.00125.75 C
ATOM 554 O GLY A 183 189.262 136.525 107.802 1.00125.75 O
ATOM 555 N THR A 184 187.102 137.025 107.421 1.00132.79 N
ATOM 556 CA THR A 184 187.318 138.424 107.074 1.00132.79 C
ATOM 557 C THR A 184 187.757 139.208 108.301 1.00132.79 C
ATOM 558 O THR A 184 187.776 138.669 109.414 1.00132.79 O
ATOM 559 CB THR A 184 186.053 139.039 106.477 1.00132.79 C
ATOM 560 N HIS A 185 188.153 140.461 108.080 1.00136.89 N
ATOM 561 CA HIS A 185 188.545 141.389 109.142 1.00136.89 C
ATOM 562 C HIS A 185 187.346 141.584 110.067 1.00136.89 C
ATOM 563 O HIS A 185 187.362 141.052 111.184 1.00136.89 O
ATOM 564 CB HIS A 185 189.083 142.657 108.498 1.00136.89 C
ATOM 565 N TYR A 186 186.284 142.247 109.621 1.00134.27 N
ATOM 566 CA TYR A 186 185.082 142.478 110.408 1.00134.27 C
ATOM 567 C TYR A 186 183.919 142.667 109.451 1.00134.27 C
ATOM 568 O TYR A 186 184.100 143.159 108.333 1.00134.27 O
ATOM 569 CB TYR A 186 185.206 143.699 111.332 1.00134.27 C
ATOM 570 CG TYR A 186 186.134 143.490 112.502 1.00134.27 C
ATOM 571 CD1 TYR A 186 185.724 142.765 113.612 1.00134.27 C
ATOM 572 CD2 TYR A 186 187.427 143.996 112.490 1.00134.27 C
ATOM 573 CE1 TYR A 186 186.570 142.557 114.684 1.00134.27 C
ATOM 574 CE2 TYR A 186 188.284 143.794 113.559 1.00134.27 C
ATOM 575 CZ TYR A 186 187.849 143.074 114.652 1.00134.27 C
ATOM 576 OH TYR A 186 188.695 142.870 115.718 1.00134.27 O
ATOM 577 N GLY A 187 182.738 142.259 109.890 1.00133.71 N
ATOM 578 CA GLY A 187 181.540 142.342 109.088 1.00133.71 C
ATOM 579 C GLY A 187 180.523 141.337 109.578 1.00133.71 C
ATOM 580 O GLY A 187 180.220 141.269 110.773 1.00133.71 O
ATOM 581 N LEU A 188 179.999 140.539 108.650 1.00128.29 N
ATOM 582 CA LEU A 188 179.050 139.501 109.024 1.00128.29 C
ATOM 583 C LEU A 188 179.761 138.353 109.735 1.00128.29 C
ATOM 584 O LEU A 188 179.228 137.775 110.695 1.00128.29 O
ATOM 585 CB LEU A 188 178.316 139.031 107.768 1.00128.29 C
ATOM 586 N MET A 189 180.974 138.024 109.282 1.00123.61 N
ATOM 587 CA MET A 189 181.757 136.960 109.902 1.00123.61 C
ATOM 588 C MET A 189 182.182 137.343 111.313 1.00123.61 C
ATOM 589 O MET A 189 182.321 136.482 112.189 1.00123.61 O
ATOM 590 CB MET A 189 182.976 136.641 109.037 1.00123.61 C
ATOM 591 N LYS A 190 182.375 138.639 111.552 1.00121.53 N
ATOM 592 CA LYS A 190 182.633 139.156 112.889 1.00121.53 C
ATOM 593 C LYS A 190 181.454 138.897 113.813 1.00121.53 C
ATOM 594 O LYS A 190 181.639 138.505 114.969 1.00121.53 O
ATOM 595 CB LYS A 190 182.921 140.652 112.838 1.00121.53 C
ATOM 596 N TYR A 191 180.239 139.099 113.303 1.00118.93 N
ATOM 597 CA TYR A 191 179.054 138.868 114.120 1.00118.93 C
ATOM 598 C TYR A 191 178.861 137.383 114.398 1.00118.93 C
ATOM 599 O TYR A 191 178.439 136.997 115.496 1.00118.93 O
ATOM 600 CB TYR A 191 177.817 139.455 113.444 1.00118.93 C
ATOM 601 CG TYR A 191 176.592 139.311 114.300 1.00118.93 C
ATOM 602 CD1 TYR A 191 176.445 140.072 115.449 1.00118.93 C
ATOM 603 CD2 TYR A 191 175.589 138.414 113.969 1.00118.93 C
ATOM 604 CE1 TYR A 191 175.338 139.945 116.247 1.00118.93 C
ATOM 605 CE2 TYR A 191 174.471 138.281 114.761 1.00118.93 C
ATOM 606 CZ TYR A 191 174.353 139.051 115.899 1.00118.93 C
ATOM 607 OH TYR A 191 173.252 138.930 116.707 1.00118.93 O
ATOM 608 N ILE A 192 179.175 136.536 113.409 1.00119.23 N
ATOM 609 CA ILE A 192 179.128 135.090 113.624 1.00119.23 C
ATOM 610 C ILE A 192 180.138 134.671 114.686 1.00119.23 C
ATOM 611 O ILE A 192 179.812 133.890 115.586 1.00119.23 O
ATOM 612 CB ILE A 192 179.342 134.333 112.299 1.00119.23 C
ATOM 613 CG1 ILE A 192 178.148 134.528 111.371 1.00119.23 C
ATOM 614 CG2 ILE A 192 179.545 132.850 112.527 1.00119.23 C
ATOM 615 CD1 ILE A 192 178.342 133.889 110.018 1.00119.23 C
ATOM 616 N GLY A 193 181.356 135.218 114.629 1.00114.79 N
ATOM 617 CA GLY A 193 182.349 134.915 115.653 1.00114.79 C
ATOM 618 C GLY A 193 181.949 135.409 117.032 1.00114.79 C
ATOM 619 O GLY A 193 182.223 134.753 118.042 1.00114.79 O
ATOM 620 N GLU A 194 181.256 136.549 117.086 1.00110.99 N
ATOM 621 CA GLU A 194 180.763 137.068 118.359 1.00110.99 C
ATOM 622 C GLU A 194 179.696 136.158 118.957 1.00110.99 C
ATOM 623 O GLU A 194 179.726 135.863 120.160 1.00110.99 O
ATOM 624 CB GLU A 194 180.217 138.482 118.170 1.00110.99 C
ATOM 625 N VAL A 195 178.757 135.689 118.132 1.00108.66 N
ATOM 626 CA VAL A 195 177.705 134.806 118.637 1.00108.66 C
ATOM 627 C VAL A 195 178.285 133.440 119.007 1.00108.66 C
ATOM 628 O VAL A 195 177.828 132.792 119.959 1.00108.66 O
ATOM 629 CB VAL A 195 176.557 134.718 117.609 1.00108.66 C
ATOM 630 CG1 VAL A 195 175.465 133.761 118.043 1.00108.66 C
ATOM 631 CG2 VAL A 195 175.944 136.085 117.411 1.00108.66 C
ATOM 632 N VAL A 196 179.344 133.015 118.306 1.00108.66 N
ATOM 633 CA VAL A 196 180.072 131.802 118.683 1.00108.66 C
ATOM 634 C VAL A 196 180.695 131.947 120.064 1.00108.66 C
ATOM 635 O VAL A 196 180.556 131.055 120.911 1.00108.66 O
ATOM 636 CB VAL A 196 181.128 131.453 117.615 1.00108.66 C
ATOM 637 CG1 VAL A 196 182.151 130.477 118.152 1.00108.66 C
ATOM 638 CG2 VAL A 196 180.454 130.812 116.429 1.00108.66 C
ATOM 639 N ARG A 197 181.365 133.077 120.321 1.00106.04 N
ATOM 640 CA ARG A 197 181.960 133.308 121.637 1.00106.04 C
ATOM 641 C ARG A 197 180.896 133.370 122.724 1.00106.04 C
ATOM 642 O ARG A 197 181.080 132.817 123.818 1.00106.04 O
ATOM 643 CB ARG A 197 182.781 134.595 121.628 1.00106.04 C
ATOM 644 CG ARG A 197 183.491 134.888 122.941 1.00106.04 C
ATOM 645 CD ARG A 197 184.341 136.147 122.850 1.00106.04 C
ATOM 646 NE ARG A 197 183.547 137.347 122.600 1.00106.04 N
ATOM 647 CZ ARG A 197 182.955 138.064 123.549 1.00106.04 C
ATOM 648 NH1 ARG A 197 183.069 137.708 124.820 1.00106.04 N
ATOM 649 NH2 ARG A 197 182.254 139.142 123.227 1.00106.04 N
ATOM 650 N ASP A 198 179.751 133.981 122.404 1.00102.75 N
ATOM 651 CA ASP A 198 178.650 134.074 123.355 1.00102.75 C
ATOM 652 C ASP A 198 178.079 132.702 123.693 1.00102.75 C
ATOM 653 O ASP A 198 177.797 132.411 124.859 1.00102.75 O
ATOM 654 CB ASP A 198 177.560 134.985 122.794 1.00102.75 C
ATOM 655 N ASN A 199 177.923 131.835 122.694 1.00107.09 N
ATOM 656 CA ASN A 199 177.347 130.524 122.970 1.00107.09 C
ATOM 657 C ASN A 199 178.367 129.582 123.598 1.00107.09 C
ATOM 658 O ASN A 199 177.990 128.598 124.244 1.00107.09 O
ATOM 659 CB ASN A 199 176.757 129.926 121.696 1.00107.09 C
ATOM 660 CG ASN A 199 175.453 130.592 121.295 1.00107.09 C
ATOM 661 OD1 ASN A 199 174.609 130.880 122.139 1.00107.09 O
ATOM 662 ND2 ASN A 199 175.283 130.835 120.004 1.00107.09 N
ATOM 663 N THR A 200 179.662 129.853 123.422 1.00103.21 N
ATOM 664 CA THR A 200 180.651 129.080 124.167 1.00103.21 C
ATOM 665 C THR A 200 180.659 129.467 125.636 1.00103.21 C
ATOM 666 O THR A 200 180.802 128.601 126.506 1.00103.21 O
ATOM 667 CB THR A 200 182.053 129.241 123.587 1.00103.21 C
ATOM 668 OG1 THR A 200 182.387 130.629 123.500 1.00103.21 O
ATOM 669 CG2 THR A 200 182.172 128.563 122.238 1.00103.21 C
ATOM 670 N ILE A 201 180.519 130.759 125.945 1.00 96.25 N
ATOM 671 CA ILE A 201 180.497 131.129 127.359 1.00 96.25 C
ATOM 672 C ILE A 201 179.117 130.877 127.959 1.00 96.25 C
ATOM 673 O ILE A 201 178.947 130.893 129.183 1.00 96.25 O
ATOM 674 CB ILE A 201 180.982 132.580 127.569 1.00 96.25 C
ATOM 675 CG1 ILE A 201 180.149 133.614 126.809 1.00 96.25 C
ATOM 676 CG2 ILE A 201 182.444 132.706 127.182 1.00 96.25 C
ATOM 677 CD1 ILE A 201 179.066 134.299 127.617 1.00 96.25 C
ATOM 678 N SER A 202 178.112 130.638 127.115 1.00101.02 N
ATOM 679 CA SER A 202 176.781 130.333 127.627 1.00101.02 C
ATOM 680 C SER A 202 176.684 128.891 128.113 1.00101.02 C
ATOM 681 O SER A 202 176.387 128.646 129.288 1.00101.02 O
ATOM 682 CB SER A 202 175.735 130.604 126.549 1.00101.02 C
ATOM 683 OG SER A 202 174.440 130.264 127.005 1.00101.02 O
ATOM 684 N ARG A 203 176.940 127.925 127.229 1.00109.45 N
ATOM 685 CA ARG A 203 176.735 126.507 127.505 1.00109.45 C
ATOM 686 C ARG A 203 178.073 125.816 127.714 1.00109.45 C
ATOM 687 O ARG A 203 179.122 126.358 127.352 1.00109.45 O
ATOM 688 CB ARG A 203 175.984 125.820 126.360 1.00109.45 C
ATOM 689 CG ARG A 203 174.517 126.179 126.261 1.00109.45 C
ATOM 690 CD ARG A 203 173.835 125.378 125.165 1.00109.45 C
ATOM 691 N SER A 204 178.032 124.623 128.307 1.00115.41 N
ATOM 692 CA SER A 204 179.231 123.810 128.507 1.00115.41 C
ATOM 693 C SER A 204 179.264 122.685 127.469 1.00115.41 C
ATOM 694 O SER A 204 178.923 121.529 127.729 1.00115.41 O
ATOM 695 CB SER A 204 179.276 123.269 129.929 1.00115.41 C
ATOM 696 N SER A 205 179.683 123.053 126.261 1.00117.94 N
ATOM 697 CA SER A 205 179.869 122.096 125.180 1.00117.94 C
ATOM 698 C SER A 205 181.040 122.554 124.329 1.00117.94 C
ATOM 699 O SER A 205 181.602 123.632 124.543 1.00117.94 O
ATOM 700 CB SER A 205 178.609 121.942 124.322 1.00117.94 C
ATOM 701 N GLU A 206 181.407 121.726 123.359 1.00116.96 N
ATOM 702 CA GLU A 206 182.553 121.991 122.504 1.00116.96 C
ATOM 703 C GLU A 206 182.102 122.042 121.054 1.00116.96 C
ATOM 704 O GLU A 206 181.566 121.060 120.531 1.00116.96 O
ATOM 705 CB GLU A 206 183.633 120.925 122.690 1.00116.96 C
ATOM 706 N GLU A 207 182.318 123.185 120.411 1.00114.01 N
ATOM 707 CA GLU A 207 182.035 123.348 118.995 1.00114.01 C
ATOM 708 C GLU A 207 183.028 124.336 118.412 1.00114.01 C
ATOM 709 O GLU A 207 183.555 125.191 119.127 1.00114.01 O
ATOM 710 CB GLU A 207 180.592 123.806 118.757 1.00114.01 C
ATOM 711 CG GLU A 207 180.220 125.158 119.319 1.00114.01 C
ATOM 712 CD GLU A 207 180.395 126.257 118.309 1.00114.01 C
ATOM 713 OE1 GLU A 207 180.499 125.927 117.110 1.00114.01 O
ATOM 714 OE2 GLU A 207 180.422 127.436 118.708 1.00114.01 O1-
ATOM 715 N ASN A 208 183.271 124.224 117.112 1.00108.93 N
ATOM 716 CA ASN A 208 184.397 124.882 116.470 1.00108.93 C
ATOM 717 C ASN A 208 183.990 125.505 115.145 1.00108.93 C
ATOM 718 O ASN A 208 182.928 125.190 114.604 1.00108.93 O
ATOM 719 CB ASN A 208 185.527 123.881 116.266 1.00108.93 C
ATOM 720 CG ASN A 208 185.039 122.587 115.656 1.00108.93 C
ATOM 721 OD1 ASN A 208 183.852 122.435 115.373 1.00108.93 O
ATOM 722 ND2 ASN A 208 185.951 121.646 115.455 1.00108.93 N
ATOM 723 N VAL A 209 184.842 126.389 114.635 1.00106.98 N
ATOM 724 CA VAL A 209 184.628 127.086 113.372 1.00106.98 C
ATOM 725 C VAL A 209 185.980 127.258 112.685 1.00106.98 C
ATOM 726 O VAL A 209 186.936 127.789 113.262 1.00106.98 O
ATOM 727 CB VAL A 209 183.899 128.421 113.569 1.00106.98 C
ATOM 728 N VAL A 210 186.084 126.768 111.460 1.00106.10 N
ATOM 729 CA VAL A 210 187.310 126.909 110.691 1.00106.10 C
ATOM 730 C VAL A 210 187.129 128.037 109.687 1.00106.10 C
ATOM 731 O VAL A 210 186.326 127.928 108.756 1.00106.10 O
ATOM 732 CB VAL A 210 187.663 125.589 109.996 1.00106.10 C
ATOM 733 CG1 VAL A 210 188.909 125.752 109.154 1.00106.10 C
ATOM 734 CG2 VAL A 210 187.838 124.497 111.025 1.00106.10 C
ATOM 735 N ALA A 211 187.879 129.120 109.863 1.00113.62 N
ATOM 736 CA ALA A 211 187.732 130.319 109.045 1.00113.62 C
ATOM 737 C ALA A 211 188.913 130.450 108.095 1.00113.62 C
ATOM 738 O ALA A 211 189.936 131.043 108.450 1.00113.62 O
ATOM 739 CB ALA A 211 187.616 131.565 109.920 1.00113.62 C
ATOM 740 N ILE A 212 188.761 129.922 106.888 1.00117.96 N
ATOM 741 CA ILE A 212 189.812 129.977 105.884 1.00117.96 C
ATOM 742 C ILE A 212 189.915 131.368 105.281 1.00117.96 C
ATOM 743 O ILE A 212 188.955 131.869 104.703 1.00117.96 O
ATOM 744 CB ILE A 212 189.577 128.927 104.795 1.00117.96 C
ATOM 745 CG1 ILE A 212 189.733 127.524 105.377 1.00117.96 C
ATOM 746 CG2 ILE A 212 190.518 129.135 103.629 1.00117.96 C
ATOM 747 CD1 ILE A 212 189.267 126.429 104.451 1.00117.96 C
ATOM 748 N ARG A 247 202.067 133.668 104.744 1.00142.24 N
ATOM 749 CA ARG A 247 202.322 133.934 103.332 1.00142.24 C
ATOM 750 C ARG A 247 201.141 134.638 102.679 1.00142.24 C
ATOM 751 O ARG A 247 201.317 135.397 101.719 1.00142.24 O
ATOM 752 CB ARG A 247 202.641 132.630 102.600 1.00142.24 C
ATOM 753 N ASP A 248 199.935 134.392 103.172 1.00140.63 N
ATOM 754 CA ASP A 248 198.776 135.101 102.661 1.00140.63 C
ATOM 755 C ASP A 248 198.820 136.556 103.121 1.00140.63 C
ATOM 756 O ASP A 248 199.013 136.823 104.314 1.00140.63 O
ATOM 757 CB ASP A 248 197.484 134.436 103.141 1.00140.63 C
ATOM 758 N PRO A 249 198.667 137.515 102.216 1.00145.90 N
ATOM 759 CA PRO A 249 198.641 138.923 102.630 1.00145.90 C
ATOM 760 C PRO A 249 197.338 139.292 103.320 1.00145.90 C
ATOM 761 O PRO A 249 196.456 139.917 102.725 1.00145.90 O
ATOM 762 CB PRO A 249 198.820 139.679 101.309 1.00145.90 C
ATOM 763 CG PRO A 249 198.308 138.738 100.268 1.00145.90 C
ATOM 764 CD PRO A 249 198.640 137.360 100.752 1.00145.90 C
ATOM 765 N LEU A 250 197.216 138.913 104.586 1.00144.67 N
ATOM 766 CA LEU A 250 195.965 139.093 105.302 1.00144.67 C
ATOM 767 C LEU A 250 195.845 140.508 105.849 1.00144.67 C
ATOM 768 O LEU A 250 196.838 141.224 105.997 1.00144.67 O
ATOM 769 CB LEU A 250 195.860 138.085 106.445 1.00144.67 C
ATOM 770 N TYR A 251 194.615 140.901 106.155 1.00148.13 N
ATOM 771 CA TYR A 251 194.315 142.163 106.814 1.00148.13 C
ATOM 772 C TYR A 251 194.363 141.939 108.325 1.00148.13 C
ATOM 773 O TYR A 251 194.949 140.961 108.796 1.00148.13 O
ATOM 774 CB TYR A 251 192.962 142.689 106.335 1.00148.13 C
ATOM 775 CG TYR A 251 192.933 142.980 104.860 1.00148.13 C
ATOM 776 CD1 TYR A 251 193.513 144.134 104.351 1.00148.13 C
ATOM 777 CD2 TYR A 251 192.325 142.100 103.974 1.00148.13 C
ATOM 778 CE1 TYR A 251 193.493 144.403 102.996 1.00148.13 C
ATOM 779 CE2 TYR A 251 192.297 142.360 102.618 1.00148.13 C
ATOM 780 CZ TYR A 251 192.882 143.514 102.135 1.00148.13 C
ATOM 781 OH TYR A 251 192.856 143.781 100.785 1.00148.13 O
ATOM 782 N CYS A 252 193.799 142.860 109.104 1.00142.30 N
ATOM 783 CA CYS A 252 193.543 142.585 110.512 1.00142.30 C
ATOM 784 C CYS A 252 192.527 141.455 110.642 1.00142.30 C
ATOM 785 O CYS A 252 191.739 141.201 109.732 1.00142.30 O
ATOM 786 CB CYS A 252 193.038 143.842 111.219 1.00142.30 C
ATOM 787 SG CYS A 252 191.471 144.481 110.587 1.00142.30 S
ATOM 788 N LEU A 253 192.558 140.756 111.769 1.00131.86 N
ATOM 789 CA LEU A 253 191.768 139.545 111.940 1.00131.86 C
ATOM 790 C LEU A 253 190.706 139.755 113.006 1.00131.86 C
ATOM 791 O LEU A 253 190.893 140.554 113.929 1.00131.86 O
ATOM 792 CB LEU A 253 192.645 138.352 112.329 1.00131.86 C
ATOM 793 CG LEU A 253 193.387 137.539 111.267 1.00131.86 C
ATOM 794 CD1 LEU A 253 194.571 138.286 110.691 1.00131.86 C
ATOM 795 CD2 LEU A 253 193.843 136.232 111.879 1.00131.86 C
ATOM 796 N ASP A 254 189.596 139.036 112.873 1.00125.63 N
ATOM 797 CA ASP A 254 188.643 138.878 113.961 1.00125.63 C
ATOM 798 C ASP A 254 189.149 137.748 114.844 1.00125.63 C
ATOM 799 O ASP A 254 189.073 136.575 114.465 1.00125.63 O
ATOM 800 CB ASP A 254 187.244 138.574 113.432 1.00125.63 C
ATOM 801 N ASN A 255 189.666 138.101 116.015 1.00121.25 N
ATOM 802 CA ASN A 255 190.376 137.146 116.864 1.00121.25 C
ATOM 803 C ASN A 255 189.402 136.433 117.800 1.00121.25 C
ATOM 804 O ASN A 255 189.439 136.571 119.020 1.00121.25 O
ATOM 805 CB ASN A 255 191.478 137.855 117.640 1.00121.25 C
ATOM 806 N ASN A 256 188.508 135.655 117.192 1.00110.90 N
ATOM 807 CA ASN A 256 187.494 134.942 117.945 1.00110.90 C
ATOM 808 C ASN A 256 187.314 133.496 117.506 1.00110.90 C
ATOM 809 O ASN A 256 186.714 132.715 118.250 1.00110.90 O
ATOM 810 CB ASN A 256 186.152 135.672 117.830 1.00110.90 C
ATOM 811 CG ASN A 256 185.313 135.540 119.072 1.00110.90 C
ATOM 812 OD1 ASN A 256 184.348 136.275 119.252 1.00110.90 O
ATOM 813 ND2 ASN A 256 185.700 134.635 119.960 1.00110.90 N
ATOM 814 N HIS A 257 187.807 133.126 116.330 1.00109.22 N
ATOM 815 CA HIS A 257 187.641 131.783 115.808 1.00109.22 C
ATOM 816 C HIS A 257 188.556 130.798 116.531 1.00109.22 C
ATOM 817 O HIS A 257 189.469 131.180 117.264 1.00109.22 O
ATOM 818 CB HIS A 257 187.920 131.769 114.309 1.00109.22 C
ATOM 819 CG HIS A 257 186.930 132.553 113.504 1.00109.22 C
ATOM 820 ND1 HIS A 257 185.674 132.075 113.204 1.00109.22 N
ATOM 821 CD2 HIS A 257 187.008 133.782 112.942 1.00109.22 C
ATOM 822 CE1 HIS A 257 185.023 132.971 112.485 1.00109.22 C
ATOM 823 NE2 HIS A 257 185.810 134.017 112.313 1.00109.22 N
ATOM 824 N THR A 258 188.290 129.510 116.319 1.00106.75 N
ATOM 825 CA THR A 258 189.060 128.441 116.944 1.00106.75 C
ATOM 826 C THR A 258 190.196 127.954 116.050 1.00106.75 C
ATOM 827 O THR A 258 191.290 127.658 116.539 1.00106.75 O
ATOM 828 CB THR A 258 188.127 127.284 117.313 1.00106.75 C
ATOM 829 OG1 THR A 258 187.106 127.770 118.189 1.00106.75 O
ATOM 830 CG2 THR A 258 188.867 126.172 118.032 1.00106.75 C
ATOM 831 N HIS A 259 189.979 127.892 114.741 1.00109.10 N
ATOM 832 CA HIS A 259 191.031 127.517 113.801 1.00109.10 C
ATOM 833 C HIS A 259 190.888 128.404 112.578 1.00109.10 C
ATOM 834 O HIS A 259 189.769 128.653 112.125 1.00109.10 O
ATOM 835 CB HIS A 259 190.937 126.047 113.412 1.00109.10 C
ATOM 836 CG HIS A 259 191.099 125.111 114.565 1.00109.10 C
ATOM 837 ND1 HIS A 259 192.323 124.834 115.131 1.00109.10 N
ATOM 838 CD2 HIS A 259 190.188 124.400 115.268 1.00109.10 C
ATOM 839 CE1 HIS A 259 192.162 123.983 116.128 1.00109.10 C
ATOM 840 NE2 HIS A 259 190.875 123.705 116.233 1.00109.10 N
ATOM 841 N LEU A 260 192.004 128.896 112.056 1.00114.81 N
ATOM 842 CA LEU A 260 191.991 129.710 110.845 1.00114.81 C
ATOM 843 C LEU A 260 193.233 129.373 110.027 1.00114.81 C
ATOM 844 O LEU A 260 194.354 129.363 110.537 1.00114.81 O
ATOM 845 CB LEU A 260 191.876 131.195 111.204 1.00114.81 C
ATOM 846 CG LEU A 260 192.877 131.886 112.125 1.00114.81 C
ATOM 847 CD1 LEU A 260 194.004 132.531 111.335 1.00114.81 C
ATOM 848 CD2 LEU A 260 192.164 132.907 112.993 1.00114.81 C
ATOM 849 N LEU A 261 193.016 129.050 108.756 1.00122.61 N
ATOM 850 CA LEU A 261 194.065 128.554 107.867 1.00122.61 C
ATOM 851 C LEU A 261 194.054 129.405 106.602 1.00122.61 C
ATOM 852 O LEU A 261 193.068 129.442 105.869 1.00122.61 O
ATOM 853 CB LEU A 261 193.854 127.080 107.543 1.00122.61 C
ATOM 854 CG LEU A 261 194.285 126.003 108.542 1.00122.61 C
ATOM 855 CD1 LEU A 261 193.336 125.867 109.727 1.00122.61 C
ATOM 856 CD2 LEU A 261 194.431 124.674 107.828 1.00122.61 C
ATOM 857 N LEU A 262 195.166 130.085 106.335 1.00129.41 N
ATOM 858 CA LEU A 262 195.294 130.928 105.154 1.00129.41 C
ATOM 859 C LEU A 262 196.433 130.438 104.275 1.00129.41 C
ATOM 860 O LEU A 262 197.394 129.838 104.769 1.00129.41 O
ATOM 861 CB LEU A 262 195.508 132.388 105.542 1.00129.41 C
ATOM 862 CG LEU A 262 194.265 133.034 106.147 1.00129.41 C
ATOM 863 CD1 LEU A 262 194.582 134.427 106.650 1.00129.41 C
ATOM 864 CD2 LEU A 262 193.149 133.073 105.112 1.00129.41 C
ATOM 865 N VAL A 263 196.316 130.693 102.977 1.00131.01 N
ATOM 866 CA VAL A 263 197.296 130.236 102.002 1.00131.01 C
ATOM 867 C VAL A 263 198.131 131.401 101.487 1.00131.01 C
ATOM 868 O VAL A 263 198.156 131.679 100.288 1.00131.01 O
ATOM 869 CB VAL A 263 196.612 129.509 100.835 1.00131.01 C
ATOM 870 N ILE A 273 193.358 136.231 94.993 1.00140.28 N
ATOM 871 CA ILE A 273 192.254 136.001 95.911 1.00140.28 C
ATOM 872 C ILE A 273 191.371 134.883 95.385 1.00140.28 C
ATOM 873 O ILE A 273 190.170 135.065 95.202 1.00140.28 O
ATOM 874 CB ILE A 273 191.436 137.281 96.135 1.00140.28 C
ATOM 875 N GLU A 274 191.973 133.724 95.141 1.00144.47 N
ATOM 876 CA GLU A 274 191.259 132.546 94.669 1.00144.47 C
ATOM 877 C GLU A 274 191.097 131.571 95.825 1.00144.47 C
ATOM 878 O GLU A 274 192.052 131.339 96.575 1.00144.47 O
ATOM 879 CB GLU A 274 192.006 131.878 93.514 1.00144.47 C
ATOM 880 N ALA A 275 189.879 131.038 95.990 1.00140.89 N
ATOM 881 CA ALA A 275 189.627 130.088 97.070 1.00140.89 C
ATOM 882 C ALA A 275 190.418 128.802 96.877 1.00140.89 C
ATOM 883 O ALA A 275 191.326 128.505 97.662 1.00140.89 O
ATOM 884 CB ALA A 275 188.131 129.789 97.159 1.00140.89 C
ATOM 885 N LYS A 276 190.060 128.006 95.865 1.00140.90 N
ATOM 886 CA LYS A 276 190.880 126.959 95.248 1.00140.90 C
ATOM 887 C LYS A 276 191.279 125.787 96.148 1.00140.90 C
ATOM 888 O LYS A 276 191.889 124.828 95.667 1.00140.90 O
ATOM 889 CB LYS A 276 192.148 127.578 94.651 1.00140.90 C
ATOM 890 N VAL A 277 190.966 125.850 97.440 1.00134.46 N
ATOM 891 CA VAL A 277 191.087 124.718 98.350 1.00134.46 C
ATOM 892 C VAL A 277 189.815 124.535 99.164 1.00134.46 C
ATOM 893 O VAL A 277 189.564 123.453 99.695 1.00134.46 O
ATOM 894 CB VAL A 277 192.313 124.872 99.278 1.00134.46 C
ATOM 895 CG1 VAL A 277 193.615 124.732 98.509 1.00134.46 C
ATOM 896 CG2 VAL A 277 192.270 126.207 99.999 1.00134.46 C
ATOM 897 N ARG A 278 189.027 125.607 99.266 1.00130.43 N
ATOM 898 CA ARG A 278 187.739 125.661 99.942 1.00130.43 C
ATOM 899 C ARG A 278 186.799 124.654 99.298 1.00130.43 C
ATOM 900 O ARG A 278 186.358 123.683 99.930 1.00130.43 O
ATOM 901 CB ARG A 278 187.183 127.082 99.821 1.00130.43 C
ATOM 902 CG ARG A 278 186.006 127.466 100.693 1.00130.43 C
ATOM 903 CD ARG A 278 185.643 128.909 100.363 1.00130.43 C
ATOM 904 NE ARG A 278 184.593 129.481 101.199 1.00130.43 N
ATOM 905 CZ ARG A 278 184.833 130.182 102.302 1.00130.43 C
ATOM 906 NH1 ARG A 278 186.080 130.394 102.688 1.00130.43 N1+
ATOM 907 NH2 ARG A 278 183.835 130.686 103.011 1.00130.43 N
ATOM 908 N THR A 279 186.536 124.879 98.014 1.00131.97 N
ATOM 909 CA THR A 279 185.737 123.995 97.179 1.00131.97 C
ATOM 910 C THR A 279 186.355 122.609 97.072 1.00131.97 C
ATOM 911 O THR A 279 185.631 121.612 97.006 1.00131.97 O
ATOM 912 CB THR A 279 185.580 124.606 95.793 1.00131.97 C
ATOM 913 OG1 THR A 279 186.873 124.755 95.195 1.00131.97 O
ATOM 914 CG2 THR A 279 184.921 125.968 95.896 1.00131.97 C
ATOM 915 N GLN A 280 187.688 122.536 97.065 1.00132.45 N
ATOM 916 CA GLN A 280 188.357 121.242 96.971 1.00132.45 C
ATOM 917 C GLN A 280 188.160 120.422 98.239 1.00132.45 C
ATOM 918 O GLN A 280 187.901 119.214 98.171 1.00132.45 O
ATOM 919 CB GLN A 280 189.843 121.441 96.682 1.00132.45 C
ATOM 920 CG GLN A 280 190.119 122.081 95.336 1.00132.45 C
ATOM 921 CD GLN A 280 189.724 121.192 94.180 1.00132.45 C
ATOM 922 OE1 GLN A 280 189.911 119.978 94.227 1.00132.45 O
ATOM 923 NE2 GLN A 280 189.174 121.792 93.133 1.00132.45 N
ATOM 924 N LEU A 281 188.257 121.065 99.405 1.00129.02 N
ATOM 925 CA LEU A 281 187.961 120.390 100.664 1.00129.02 C
ATOM 926 C LEU A 281 186.504 119.958 100.749 1.00129.02 C
ATOM 927 O LEU A 281 186.215 118.848 101.221 1.00129.02 O
ATOM 928 CB LEU A 281 188.296 121.305 101.841 1.00129.02 C
ATOM 929 CG LEU A 281 188.065 120.743 103.243 1.00129.02 C
ATOM 930 CD1 LEU A 281 188.979 119.561 103.496 1.00129.02 C
ATOM 931 CD2 LEU A 281 188.263 121.820 104.293 1.00129.02 C
ATOM 932 N GLU A 282 185.586 120.805 100.277 1.00131.26 N
ATOM 933 CA GLU A 282 184.173 120.446 100.286 1.00131.26 C
ATOM 934 C GLU A 282 183.875 119.282 99.347 1.00131.26 C
ATOM 935 O GLU A 282 183.054 118.417 99.670 1.00131.26 O
ATOM 936 CB GLU A 282 183.336 121.666 99.922 1.00131.26 C
ATOM 937 CG GLU A 282 183.436 122.768 100.952 1.00131.26 C
ATOM 938 CD GLU A 282 183.013 122.319 102.331 1.00131.26 C
ATOM 939 OE1 GLU A 282 182.025 121.565 102.440 1.00131.26 O
ATOM 940 OE2 GLU A 282 183.664 122.731 103.310 1.00131.26 O1-
ATOM 941 N LYS A 283 184.551 119.226 98.197 1.00130.27 N
ATOM 942 CA LYS A 283 184.363 118.098 97.289 1.00130.27 C
ATOM 943 C LYS A 283 185.027 116.839 97.829 1.00130.27 C
ATOM 944 O LYS A 283 184.611 115.722 97.498 1.00130.27 O
ATOM 945 CB LYS A 283 184.904 118.441 95.902 1.00130.27 C
ATOM 946 N TYR A 284 186.066 116.995 98.657 1.00130.94 N
ATOM 947 CA TYR A 284 186.655 115.829 99.310 1.00130.94 C
ATOM 948 C TYR A 284 185.715 115.241 100.349 1.00130.94 C
ATOM 949 O TYR A 284 185.527 114.021 100.405 1.00130.94 O
ATOM 950 CB TYR A 284 187.985 116.181 99.967 1.00130.94 C
ATOM 951 CG TYR A 284 188.563 115.019 100.747 1.00130.94 C
ATOM 952 CD1 TYR A 284 189.088 113.913 100.094 1.00130.94 C
ATOM 953 CD2 TYR A 284 188.582 115.028 102.138 1.00130.94 C
ATOM 954 CE1 TYR A 284 189.611 112.846 100.802 1.00130.94 C
ATOM 955 CE2 TYR A 284 189.104 113.965 102.853 1.00130.94 C
ATOM 956 CZ TYR A 284 189.619 112.881 102.179 1.00130.94 C
ATOM 957 OH TYR A 284 190.141 111.826 102.889 1.00130.94 O
ATOM 958 N ILE A 285 185.125 116.091 101.188 1.00127.42 N
ATOM 959 CA ILE A 285 184.235 115.586 102.231 1.00127.42 C
ATOM 960 C ILE A 285 182.903 115.148 101.621 1.00127.42 C
ATOM 961 O ILE A 285 182.162 114.347 102.206 1.00127.42 O
ATOM 962 CB ILE A 285 184.069 116.648 103.334 1.00127.42 C
ATOM 963 CG1 ILE A 285 185.443 117.080 103.822 1.00127.42 C
ATOM 964 CG2 ILE A 285 183.414 116.074 104.562 1.00127.42 C
ATOM 965 CD1 ILE A 285 185.413 118.306 104.687 1.00127.42 C
ATOM 966 N SER A 286 182.598 115.635 100.411 1.00131.69 N
ATOM 967 CA SER A 286 181.502 115.073 99.625 1.00131.69 C
ATOM 968 C SER A 286 181.739 113.601 99.311 1.00131.69 C
ATOM 969 O SER A 286 180.793 112.806 99.280 1.00131.69 O
ATOM 970 CB SER A 286 181.327 115.862 98.329 1.00131.69 C
ATOM 971 OG SER A 286 180.961 117.204 98.585 1.00131.69 O
ATOM 972 N GLU A 287 182.991 113.221 99.077 1.00131.07 N
ATOM 973 CA GLU A 287 183.348 111.841 98.788 1.00131.07 C
ATOM 974 C GLU A 287 183.773 111.064 100.029 1.00131.07 C
ATOM 975 O GLU A 287 184.345 109.976 99.898 1.00131.07 O
ATOM 976 CB GLU A 287 184.461 111.799 97.739 1.00131.07 C
ATOM 977 N ARG A 288 183.512 111.587 101.221 1.00134.98 N
ATOM 978 CA ARG A 288 183.925 110.917 102.441 1.00134.98 C
ATOM 979 C ARG A 288 182.989 109.750 102.746 1.00134.98 C
ATOM 980 O ARG A 288 181.784 109.807 102.493 1.00134.98 O
ATOM 981 CB ARG A 288 183.945 111.915 103.601 1.00134.98 C
ATOM 982 CG ARG A 288 184.462 111.379 104.925 1.00134.98 C
ATOM 983 CD ARG A 288 185.933 111.037 104.843 1.00134.98 C
ATOM 984 NE ARG A 288 186.445 110.565 106.124 1.00134.98 N
ATOM 985 CZ ARG A 288 187.655 110.048 106.297 1.00134.98 C
ATOM 986 NH1 ARG A 288 188.479 109.936 105.266 1.00134.98 N1+
ATOM 987 NH2 ARG A 288 188.040 109.642 107.499 1.00134.98 N
ATOM 988 N VAL A 289 183.560 108.675 103.286 1.00138.91 N
ATOM 989 CA VAL A 289 182.804 107.493 103.683 1.00138.91 C
ATOM 990 C VAL A 289 182.826 107.387 105.207 1.00138.91 C
ATOM 991 O VAL A 289 183.843 107.680 105.846 1.00138.91 O
ATOM 992 CB VAL A 289 183.345 106.219 102.995 1.00138.91 C
ATOM 993 CG1 VAL A 289 184.805 105.940 103.346 1.00138.91 C
ATOM 994 CG2 VAL A 289 182.469 105.007 103.299 1.00138.91 C
ATOM 995 N ILE A 290 181.672 107.054 105.791 1.00143.82 N
ATOM 996 CA ILE A 290 181.552 106.779 107.214 1.00143.82 C
ATOM 997 C ILE A 290 180.749 105.493 107.361 1.00143.82 C
ATOM 998 O ILE A 290 179.695 105.352 106.734 1.00143.82 O
ATOM 999 CB ILE A 290 180.879 107.925 107.990 1.00143.82 C
ATOM 1000 CG1 ILE A 290 181.793 109.147 108.045 1.00143.82 C
ATOM 1001 CG2 ILE A 290 180.491 107.505 109.407 1.00143.82 C
ATOM 1002 CD1 ILE A 290 181.156 110.334 108.693 1.00143.82 C
ATOM 1003 N PRO A 291 181.216 104.512 108.145 1.00144.90 N
ATOM 1004 CA PRO A 291 180.452 103.260 108.285 1.00144.90 C
ATOM 1005 C PRO A 291 179.131 103.413 109.026 1.00144.90 C
ATOM 1006 O PRO A 291 178.094 102.971 108.516 1.00144.90 O
ATOM 1007 CB PRO A 291 181.430 102.345 109.036 1.00144.90 C
ATOM 1008 CG PRO A 291 182.357 103.276 109.751 1.00144.90 C
ATOM 1009 CD PRO A 291 182.502 104.469 108.864 1.00144.90 C
ATOM 1010 N GLU A 292 179.126 104.026 110.209 1.00141.32 N
ATOM 1011 CA GLU A 292 177.889 104.203 110.969 1.00141.32 C
ATOM 1012 C GLU A 292 177.324 105.600 110.710 1.00141.32 C
ATOM 1013 O GLU A 292 177.275 106.468 111.583 1.00141.32 O
ATOM 1014 CB GLU A 292 178.135 103.960 112.452 1.00141.32 C
ATOM 1015 N SER A 293 176.881 105.800 109.472 1.00137.20 N
ATOM 1016 CA SER A 293 176.341 107.077 109.026 1.00137.20 C
ATOM 1017 C SER A 293 174.856 106.930 108.737 1.00137.20 C
ATOM 1018 O SER A 293 174.456 106.083 107.931 1.00137.20 O
ATOM 1019 CB SER A 293 177.074 107.579 107.778 1.00137.20 C
ATOM 1020 N ASN A 294 174.044 107.758 109.388 1.00128.99 N
ATOM 1021 CA ASN A 294 172.605 107.771 109.169 1.00128.99 C
ATOM 1022 C ASN A 294 172.221 108.448 107.865 1.00128.99 C
ATOM 1023 O ASN A 294 171.089 108.280 107.403 1.00128.99 O
ATOM 1024 CB ASN A 294 171.899 108.470 110.334 1.00128.99 C
ATOM 1025 N TYR A 295 173.137 109.197 107.259 1.00126.32 N
ATOM 1026 CA TYR A 295 172.889 109.897 106.011 1.00126.32 C
ATOM 1027 C TYR A 295 173.108 108.998 104.801 1.00126.32 C
ATOM 1028 O TYR A 295 172.656 109.327 103.700 1.00126.32 O
ATOM 1029 CB TYR A 295 173.784 111.135 105.942 1.00126.32 C
ATOM 1030 CG TYR A 295 173.556 112.011 104.744 1.00126.32 C
ATOM 1031 CD1 TYR A 295 172.432 112.812 104.658 1.00126.32 C
ATOM 1032 CD2 TYR A 295 174.462 112.031 103.697 1.00126.32 C
ATOM 1033 CE1 TYR A 295 172.215 113.611 103.563 1.00126.32 C
ATOM 1034 CE2 TYR A 295 174.258 112.830 102.595 1.00126.32 C
ATOM 1035 CZ TYR A 295 173.131 113.620 102.534 1.00126.32 C
ATOM 1036 OH TYR A 295 172.916 114.423 101.439 1.00126.32 O
ATOM 1037 N GLY A 296 173.746 107.849 104.991 1.00132.07 N
ATOM 1038 CA GLY A 296 173.980 106.928 103.904 1.00132.07 C
ATOM 1039 C GLY A 296 175.430 106.698 103.556 1.00132.07 C
ATOM 1040 O GLY A 296 175.716 106.264 102.435 1.00132.07 O
ATOM 1041 N GLY A 297 176.355 106.985 104.466 1.00132.29 N
ATOM 1042 CA GLY A 297 177.759 106.775 104.186 1.00132.29 C
ATOM 1043 C GLY A 297 178.429 108.046 103.718 1.00132.29 C
ATOM 1044 O GLY A 297 179.525 108.014 103.151 1.00132.29 O
ATOM 1045 N LYS A 298 177.765 109.176 103.934 1.00126.85 N
ATOM 1046 CA LYS A 298 178.280 110.481 103.555 1.00126.85 C
ATOM 1047 C LYS A 298 178.056 111.456 104.701 1.00126.85 C
ATOM 1048 O LYS A 298 177.606 111.080 105.785 1.00126.85 O
ATOM 1049 CB LYS A 298 177.612 111.002 102.278 1.00126.85 C
ATOM 1050 CG LYS A 298 177.959 110.216 101.031 1.00126.85 C
ATOM 1051 CD LYS A 298 177.280 110.799 99.808 1.00126.85 C
ATOM 1052 CE LYS A 298 177.629 110.003 98.560 1.00126.85 C
ATOM 1053 NZ LYS A 298 177.007 110.570 97.332 1.00126.85 N
ATOM 1054 N ILE A 299 178.401 112.714 104.461 1.00117.09 N
ATOM 1055 CA ILE A 299 178.196 113.792 105.424 1.00117.09 C
ATOM 1056 C ILE A 299 177.373 114.880 104.745 1.00117.09 C
ATOM 1057 O ILE A 299 177.689 115.255 103.606 1.00117.09 O
ATOM 1058 CB ILE A 299 179.530 114.347 105.937 1.00117.09 C
ATOM 1059 CG1 ILE A 299 180.268 113.280 106.731 1.00117.09 C
ATOM 1060 CG2 ILE A 299 179.320 115.555 106.819 1.00117.09 C
ATOM 1061 CD1 ILE A 299 181.674 113.655 107.078 1.00117.09 C
ATOM 1062 N PRO A 300 176.317 115.387 105.379 1.00115.62 N
ATOM 1063 CA PRO A 300 175.569 116.510 104.811 1.00115.62 C
ATOM 1064 C PRO A 300 176.393 117.787 104.738 1.00115.62 C
ATOM 1065 O PRO A 300 177.160 118.112 105.645 1.00115.62 O
ATOM 1066 CB PRO A 300 174.392 116.664 105.777 1.00115.62 C
ATOM 1067 CG PRO A 300 174.835 116.007 107.037 1.00115.62 C
ATOM 1068 CD PRO A 300 175.689 114.869 106.601 1.00115.62 C
ATOM 1069 N ILE A 301 176.225 118.511 103.634 1.00117.59 N
ATOM 1070 CA ILE A 301 176.959 119.738 103.350 1.00117.59 C
ATOM 1071 C ILE A 301 175.959 120.782 102.875 1.00117.59 C
ATOM 1072 O ILE A 301 175.267 120.569 101.875 1.00117.59 O
ATOM 1073 CB ILE A 301 178.040 119.523 102.273 1.00117.59 C
ATOM 1074 CG1 ILE A 301 179.084 118.501 102.726 1.00117.59 C
ATOM 1075 CG2 ILE A 301 178.697 120.835 101.919 1.00117.59 C
ATOM 1076 CD1 ILE A 301 179.992 118.036 101.628 1.00117.59 C
ATOM 1077 N VAL A 302 175.885 121.909 103.575 1.00111.91 N
ATOM 1078 CA VAL A 302 174.901 122.942 103.280 1.00111.91 C
ATOM 1079 C VAL A 302 175.613 124.253 102.984 1.00111.91 C
ATOM 1080 O VAL A 302 176.294 124.808 103.853 1.00111.91 O
ATOM 1081 CB VAL A 302 173.908 123.129 104.443 1.00111.91 C
ATOM 1082 CG1 VAL A 302 172.970 124.276 104.142 1.00111.91 C
ATOM 1083 CG2 VAL A 302 173.132 121.859 104.691 1.00111.91 C
ATOM 1084 N CYS A 303 175.436 124.758 101.765 1.00115.18 N
ATOM 1085 CA CYS A 303 175.964 126.054 101.355 1.00115.18 C
ATOM 1086 C CYS A 303 174.937 127.126 101.669 1.00115.18 C
ATOM 1087 O CYS A 303 173.734 126.894 101.533 1.00115.18 O
ATOM 1088 CB CYS A 303 176.295 126.076 99.866 1.00115.18 C
ATOM 1089 SG CYS A 303 177.626 124.966 99.407 1.00115.18 S
ATOM 1090 N PHE A 304 175.410 128.294 102.077 1.00110.01 N
ATOM 1091 CA PHE A 304 174.552 129.328 102.628 1.00110.01 C
ATOM 1092 C PHE A 304 174.845 130.643 101.916 1.00110.01 C
ATOM 1093 O PHE A 304 176.007 130.949 101.634 1.00110.01 O
ATOM 1094 CB PHE A 304 174.804 129.456 104.126 1.00110.01 C
ATOM 1095 CG PHE A 304 173.706 130.121 104.873 1.00110.01 C
ATOM 1096 CD1 PHE A 304 172.611 129.389 105.292 1.00110.01 C
ATOM 1097 CD2 PHE A 304 173.756 131.473 105.153 1.00110.01 C
ATOM 1098 CE1 PHE A 304 171.590 129.986 105.990 1.00110.01 C
ATOM 1099 CE2 PHE A 304 172.732 132.084 105.849 1.00110.01 C
ATOM 1100 CZ PHE A 304 171.647 131.337 106.270 1.00110.01 C
ATOM 1101 N ALA A 305 173.798 131.418 101.616 1.00116.52 N
ATOM 1102 CA ALA A 305 173.950 132.670 100.875 1.00116.52 C
ATOM 1103 C ALA A 305 173.179 133.780 101.589 1.00116.52 C
ATOM 1104 O ALA A 305 171.948 133.782 101.631 1.00116.52 O
ATOM 1105 CB ALA A 305 173.490 132.512 99.429 1.00116.52 C
ATOM 1106 N GLN A 306 173.917 134.733 102.144 1.00118.98 N
ATOM 1107 CA GLN A 306 173.315 135.891 102.788 1.00118.98 C
ATOM 1108 C GLN A 306 174.222 137.111 102.682 1.00118.98 C
ATOM 1109 O GLN A 306 173.753 138.230 102.475 1.00118.98 O
ATOM 1110 CB GLN A 306 173.009 135.589 104.254 1.00118.98 C
ATOM 1111 N GLY A 309 177.800 138.288 95.568 1.00154.32 N
ATOM 1112 CA GLY A 309 179.080 138.659 94.998 1.00154.32 C
ATOM 1113 C GLY A 309 179.494 137.797 93.822 1.00154.32 C
ATOM 1114 O GLY A 309 178.863 136.781 93.528 1.00154.32 O
ATOM 1115 N LYS A 310 180.562 138.222 93.144 1.00157.96 N
ATOM 1116 CA LYS A 310 181.073 137.470 92.003 1.00157.96 C
ATOM 1117 C LYS A 310 181.717 136.165 92.447 1.00157.96 C
ATOM 1118 O LYS A 310 181.453 135.104 91.869 1.00157.96 O
ATOM 1119 CB LYS A 310 182.071 138.326 91.226 1.00157.96 C
ATOM 1120 CG LYS A 310 182.685 137.647 90.021 1.00157.96 C
ATOM 1121 CD LYS A 310 183.564 138.618 89.264 1.00157.96 C
ATOM 1122 CE LYS A 310 184.832 138.914 90.040 1.00157.96 C
ATOM 1123 NZ LYS A 310 185.757 139.786 89.272 1.00157.96 N
ATOM 1124 N GLU A 311 182.561 136.225 93.480 1.00156.81 N
ATOM 1125 CA GLU A 311 183.132 135.008 94.045 1.00156.81 C
ATOM 1126 C GLU A 311 182.061 134.176 94.736 1.00156.81 C
ATOM 1127 O GLU A 311 182.165 132.945 94.797 1.00156.81 O
ATOM 1128 CB GLU A 311 184.256 135.353 95.020 1.00156.81 C
ATOM 1129 N THR A 312 181.015 134.834 95.250 1.00154.00 N
ATOM 1130 CA THR A 312 179.873 134.117 95.807 1.00154.00 C
ATOM 1131 C THR A 312 179.162 133.302 94.739 1.00154.00 C
ATOM 1132 O THR A 312 178.856 132.124 94.950 1.00154.00 O
ATOM 1133 CB THR A 312 178.898 135.099 96.458 1.00154.00 C
ATOM 1134 N LEU A 313 178.919 133.904 93.573 1.00153.14 N
ATOM 1135 CA LEU A 313 178.289 133.172 92.481 1.00153.14 C
ATOM 1136 C LEU A 313 179.214 132.096 91.925 1.00153.14 C
ATOM 1137 O LEU A 313 178.747 131.040 91.477 1.00153.14 O
ATOM 1138 CB LEU A 313 177.850 134.149 91.388 1.00153.14 C
ATOM 1139 CG LEU A 313 177.081 133.618 90.175 1.00153.14 C
ATOM 1140 CD1 LEU A 313 175.993 134.583 89.790 1.00153.14 C
ATOM 1141 CD2 LEU A 313 178.009 133.443 88.987 1.00153.14 C
ATOM 1142 N LYS A 314 180.528 132.346 91.944 1.00151.42 N
ATOM 1143 CA LYS A 314 181.485 131.326 91.525 1.00151.42 C
ATOM 1144 C LYS A 314 181.443 130.118 92.453 1.00151.42 C
ATOM 1145 O LYS A 314 181.436 128.968 91.992 1.00151.42 O
ATOM 1146 CB LYS A 314 182.892 131.921 91.477 1.00151.42 C
ATOM 1147 N SER A 315 181.371 130.366 93.763 1.00148.54 N
ATOM 1148 CA SER A 315 181.258 129.280 94.730 1.00148.54 C
ATOM 1149 C SER A 315 179.920 128.562 94.603 1.00148.54 C
ATOM 1150 O SER A 315 179.847 127.346 94.799 1.00148.54 O
ATOM 1151 CB SER A 315 181.446 129.822 96.145 1.00148.54 C
ATOM 1152 OG SER A 315 181.305 128.795 97.108 1.00148.54 O
ATOM 1153 N ILE A 316 178.858 129.300 94.258 1.00142.81 N
ATOM 1154 CA ILE A 316 177.547 128.694 94.010 1.00142.81 C
ATOM 1155 C ILE A 316 177.613 127.736 92.825 1.00142.81 C
ATOM 1156 O ILE A 316 177.138 126.595 92.901 1.00142.81 O
ATOM 1157 CB ILE A 316 176.483 129.789 93.804 1.00142.81 C
ATOM 1158 CG1 ILE A 316 176.107 130.422 95.147 1.00142.81 C
ATOM 1159 CG2 ILE A 316 175.257 129.266 93.070 1.00142.81 C
ATOM 1160 CD1 ILE A 316 175.272 131.667 95.020 1.00142.81 C
ATOM 1161 N ASN A 317 178.232 128.183 91.727 1.00139.11 N
ATOM 1162 CA ASN A 317 178.347 127.351 90.531 1.00139.11 C
ATOM 1163 C ASN A 317 179.203 126.115 90.781 1.00139.11 C
ATOM 1164 O ASN A 317 178.859 125.015 90.333 1.00139.11 O
ATOM 1165 CB ASN A 317 178.926 128.170 89.378 1.00139.11 C
ATOM 1166 N VAL A 318 180.298 126.269 91.531 1.00138.64 N
ATOM 1167 CA VAL A 318 181.171 125.128 91.803 1.00138.64 C
ATOM 1168 C VAL A 318 180.504 124.155 92.774 1.00138.64 C
ATOM 1169 O VAL A 318 180.607 122.930 92.620 1.00138.64 O
ATOM 1170 CB VAL A 318 182.540 125.621 92.312 1.00138.64 C
ATOM 1171 CG1 VAL A 318 183.416 124.467 92.757 1.00138.64 C
ATOM 1172 CG2 VAL A 318 183.252 126.380 91.210 1.00138.64 C
ATOM 1173 N ALA A 319 179.770 124.679 93.759 1.00136.17 N
ATOM 1174 CA ALA A 319 179.148 123.821 94.759 1.00136.17 C
ATOM 1175 C ALA A 319 177.986 123.029 94.176 1.00136.17 C
ATOM 1176 O ALA A 319 177.853 121.828 94.440 1.00136.17 O
ATOM 1177 CB ALA A 319 178.680 124.665 95.940 1.00136.17 C
ATOM 1178 N ILE A 320 177.138 123.679 93.375 1.00134.82 N
ATOM 1179 CA ILE A 320 176.051 122.958 92.720 1.00134.82 C
ATOM 1180 C ILE A 320 176.614 122.031 91.647 1.00134.82 C
ATOM 1181 O ILE A 320 176.057 120.959 91.371 1.00134.82 O
ATOM 1182 CB ILE A 320 175.020 123.962 92.168 1.00134.82 C
ATOM 1183 CG1 ILE A 320 174.441 124.775 93.321 1.00134.82 C
ATOM 1184 CG2 ILE A 320 173.860 123.276 91.471 1.00134.82 C
ATOM 1185 CD1 ILE A 320 173.588 125.923 92.880 1.00134.82 C
ATOM 1186 N LYS A 321 177.766 122.400 91.074 1.00135.88 N
ATOM 1187 CA LYS A 321 178.472 121.519 90.150 1.00135.88 C
ATOM 1188 C LYS A 321 178.933 120.240 90.841 1.00135.88 C
ATOM 1189 O LYS A 321 178.981 119.172 90.220 1.00135.88 O
ATOM 1190 CB LYS A 321 179.658 122.270 89.542 1.00135.88 C
ATOM 1191 CG LYS A 321 180.433 121.523 88.477 1.00135.88 C
ATOM 1192 CD LYS A 321 181.520 122.408 87.905 1.00135.88 C
ATOM 1193 CE LYS A 321 182.328 121.686 86.850 1.00135.88 C
ATOM 1194 NZ LYS A 321 183.387 122.564 86.283 1.00135.88 N
ATOM 1195 N SER A 322 179.248 120.318 92.130 1.00134.09 N
ATOM 1196 CA SER A 322 179.631 119.132 92.879 1.00134.09 C
ATOM 1197 C SER A 322 178.463 118.494 93.629 1.00134.09 C
ATOM 1198 O SER A 322 178.716 117.713 94.556 1.00134.09 O
ATOM 1199 CB SER A 322 180.763 119.468 93.853 1.00134.09 C
ATOM 1200 OG SER A 322 181.165 118.318 94.578 1.00134.09 O
ATOM 1201 N LYS A 323 177.225 118.814 93.237 1.00131.83 N
ATOM 1202 CA LYS A 323 175.984 118.228 93.764 1.00131.83 C
ATOM 1203 C LYS A 323 175.852 118.437 95.277 1.00131.83 C
ATOM 1204 O LYS A 323 175.854 117.502 96.076 1.00131.83 O
ATOM 1205 CB LYS A 323 175.875 116.743 93.396 1.00131.83 C
ATOM 1206 N ILE A 324 175.749 119.709 95.645 1.00129.27 N
ATOM 1207 CA ILE A 324 175.554 120.118 97.034 1.00129.27 C
ATOM 1208 C ILE A 324 174.357 121.061 97.091 1.00129.27 C
ATOM 1209 O ILE A 324 174.269 121.990 96.275 1.00129.27 O
ATOM 1210 CB ILE A 324 176.828 120.769 97.599 1.00129.27 C
ATOM 1211 CG1 ILE A 324 177.933 119.726 97.777 1.00129.27 C
ATOM 1212 CG2 ILE A 324 176.565 121.481 98.909 1.00129.27 C
ATOM 1213 CD1 ILE A 324 179.273 120.317 98.140 1.00129.27 C
ATOM 1214 N PRO A 325 173.408 120.853 98.005 1.00124.94 N
ATOM 1215 CA PRO A 325 172.267 121.770 98.110 1.00124.94 C
ATOM 1216 C PRO A 325 172.686 123.134 98.639 1.00124.94 C
ATOM 1217 O PRO A 325 173.734 123.284 99.267 1.00124.94 O
ATOM 1218 CB PRO A 325 171.333 121.053 99.088 1.00124.94 C
ATOM 1219 CG PRO A 325 172.236 120.193 99.900 1.00124.94 C
ATOM 1220 CD PRO A 325 173.316 119.745 98.968 1.00124.94 C
ATOM 1221 N CYS A 326 171.855 124.139 98.381 1.00124.15 N
ATOM 1222 CA CYS A 326 172.158 125.506 98.771 1.00124.15 C
ATOM 1223 C CYS A 326 170.921 126.165 99.356 1.00124.15 C
ATOM 1224 O CYS A 326 169.792 125.827 98.997 1.00124.15 O
ATOM 1225 CB CYS A 326 172.657 126.321 97.586 1.00124.15 C
ATOM 1226 SG CYS A 326 174.190 125.716 96.861 1.00124.15 S
ATOM 1227 N VAL A 327 171.148 127.113 100.260 1.00120.59 N
ATOM 1228 CA VAL A 327 170.088 127.862 100.921 1.00120.59 C
ATOM 1229 C VAL A 327 170.338 129.342 100.675 1.00120.59 C
ATOM 1230 O VAL A 327 171.452 129.831 100.893 1.00120.59 O
ATOM 1231 CB VAL A 327 170.034 127.561 102.432 1.00120.59 C
ATOM 1232 CG1 VAL A 327 169.037 128.459 103.127 1.00120.59 C
ATOM 1233 CG2 VAL A 327 169.666 126.117 102.664 1.00120.59 C
ATOM 1234 N VAL A 328 169.313 130.044 100.199 1.00124.25 N
ATOM 1235 CA VAL A 328 169.398 131.462 99.870 1.00124.25 C
ATOM 1236 C VAL A 328 168.293 132.198 100.615 1.00124.25 C
ATOM 1237 O VAL A 328 167.124 131.799 100.554 1.00124.25 O
ATOM 1238 CB VAL A 328 169.284 131.689 98.351 1.00124.25 C
ATOM 1239 CG1 VAL A 328 169.212 133.168 98.027 1.00124.25 C
ATOM 1240 CG2 VAL A 328 170.457 131.052 97.627 1.00124.25 C
ATOM 1241 N VAL A 329 168.658 133.273 101.308 1.00126.99 N
ATOM 1242 CA VAL A 329 167.711 134.093 102.052 1.00126.99 C
ATOM 1243 C VAL A 329 167.195 135.185 101.124 1.00126.99 C
ATOM 1244 O VAL A 329 167.985 135.904 100.499 1.00126.99 O
ATOM 1245 CB VAL A 329 168.363 134.700 103.304 1.00126.99 C
ATOM 1246 CG1 VAL A 329 167.371 135.570 104.062 1.00126.99 C
ATOM 1247 CG2 VAL A 329 168.909 133.607 104.187 1.00126.99 C
ATOM 1248 N GLU A 330 165.874 135.311 101.028 1.00134.66 N
ATOM 1249 CA GLU A 330 165.281 136.374 100.230 1.00134.66 C
ATOM 1250 C GLU A 330 165.375 137.711 100.955 1.00134.66 C
ATOM 1251 O GLU A 330 165.180 137.801 102.170 1.00134.66 O
ATOM 1252 CB GLU A 330 163.818 136.060 99.917 1.00134.66 C
ATOM 1253 N GLY A 331 165.672 138.759 100.192 1.00144.13 N
ATOM 1254 CA GLY A 331 165.725 140.099 100.733 1.00144.13 C
ATOM 1255 C GLY A 331 167.071 140.536 101.266 1.00144.13 C
ATOM 1256 O GLY A 331 167.118 141.430 102.122 1.00144.13 O
ATOM 1257 N SER A 332 168.167 139.939 100.796 1.00148.30 N
ATOM 1258 CA SER A 332 169.485 140.329 101.286 1.00148.30 C
ATOM 1259 C SER A 332 169.939 141.649 100.673 1.00148.30 C
ATOM 1260 O SER A 332 170.875 142.283 101.172 1.00148.30 O
ATOM 1261 CB SER A 332 170.499 139.222 100.995 1.00148.30 C
ATOM 1262 OG SER A 332 171.791 139.576 101.456 1.00148.30 O
ATOM 1263 N GLY A 333 169.294 142.079 99.590 1.00151.53 N
ATOM 1264 CA GLY A 333 169.724 143.265 98.882 1.00151.53 C
ATOM 1265 C GLY A 333 170.866 143.036 97.923 1.00151.53 C
ATOM 1266 O GLY A 333 171.496 144.004 97.485 1.00151.53 O
ATOM 1267 N ARG A 334 171.147 141.783 97.580 1.00154.58 N
ATOM 1268 CA ARG A 334 172.306 141.436 96.772 1.00154.58 C
ATOM 1269 C ARG A 334 171.884 140.613 95.566 1.00154.58 C
ATOM 1270 O ARG A 334 170.697 140.545 95.235 1.00154.58 O
ATOM 1271 CB ARG A 334 173.332 140.670 97.609 1.00154.58 C
ATOM 1272 N ILE A 335 172.866 139.998 94.901 1.00156.76 N
ATOM 1273 CA ILE A 335 172.607 139.127 93.755 1.00156.76 C
ATOM 1274 C ILE A 335 171.785 137.905 94.169 1.00156.76 C
ATOM 1275 O ILE A 335 171.073 137.308 93.349 1.00156.76 O
ATOM 1276 CB ILE A 335 173.947 138.744 93.092 1.00156.76 C
ATOM 1277 CG1 ILE A 335 173.748 138.051 91.748 1.00156.76 C
ATOM 1278 CG2 ILE A 335 174.806 137.884 94.004 1.00156.76 C
ATOM 1279 CD1 ILE A 335 175.018 137.954 90.964 1.00156.76 C
ATOM 1280 N ALA A 336 171.845 137.534 95.455 1.00154.19 N
ATOM 1281 CA ALA A 336 171.047 136.426 95.968 1.00154.19 C
ATOM 1282 C ALA A 336 169.555 136.728 95.893 1.00154.19 C
ATOM 1283 O ALA A 336 168.742 135.819 95.688 1.00154.19 O
ATOM 1284 CB ALA A 336 171.461 136.113 97.404 1.00154.19 C
ATOM 1285 N ASP A 337 169.179 138.003 96.034 1.00152.33 N
ATOM 1286 CA ASP A 337 167.787 138.394 95.834 1.00152.33 C
ATOM 1287 C ASP A 337 167.371 138.186 94.382 1.00152.33 C
ATOM 1288 O ASP A 337 166.233 137.791 94.103 1.00152.33 O
ATOM 1289 CB ASP A 337 167.596 139.853 96.246 1.00152.33 C
ATOM 1290 CG ASP A 337 166.135 140.240 96.408 1.00152.33 C
ATOM 1291 OD1 ASP A 337 165.246 139.375 96.272 1.00152.33 O
ATOM 1292 OD2 ASP A 337 165.874 141.431 96.670 1.00152.33 O
ATOM 1293 N VAL A 338 168.293 138.417 93.446 1.00156.91 N
ATOM 1294 CA VAL A 338 167.992 138.198 92.035 1.00156.91 C
ATOM 1295 C VAL A 338 167.852 136.711 91.742 1.00156.91 C
ATOM 1296 O VAL A 338 167.015 136.301 90.928 1.00156.91 O
ATOM 1297 CB VAL A 338 169.071 138.850 91.151 1.00156.91 C
ATOM 1298 N ILE A 339 168.660 135.882 92.409 1.00157.72 N
ATOM 1299 CA ILE A 339 168.535 134.434 92.239 1.00157.72 C
ATOM 1300 C ILE A 339 167.232 133.942 92.860 1.00157.72 C
ATOM 1301 O ILE A 339 166.592 133.014 92.348 1.00157.72 O
ATOM 1302 CB ILE A 339 169.767 133.720 92.829 1.00157.72 C
ATOM 1303 CG1 ILE A 339 171.047 134.255 92.189 1.00157.72 C
ATOM 1304 CG2 ILE A 339 169.708 132.216 92.597 1.00157.72 C
ATOM 1305 CD1 ILE A 339 171.109 134.066 90.690 1.00157.72 C
ATOM 1306 N ALA A 340 166.796 134.588 93.945 1.00155.41 N
ATOM 1307 CA ALA A 340 165.531 134.220 94.574 1.00155.41 C
ATOM 1308 C ALA A 340 164.340 134.618 93.711 1.00155.41 C
ATOM 1309 O ALA A 340 163.352 133.879 93.624 1.00155.41 O
ATOM 1310 CB ALA A 340 165.428 134.866 95.954 1.00155.41 C
ATOM 1311 N SER A 341 164.412 135.786 93.070 1.00157.72 N
ATOM 1312 CA SER A 341 163.313 136.228 92.218 1.00157.72 C
ATOM 1313 C SER A 341 163.259 135.429 90.922 1.00157.72 C
ATOM 1314 O SER A 341 162.172 135.133 90.413 1.00157.72 O
ATOM 1315 CB SER A 341 163.446 137.721 91.922 1.00157.72 C
ATOM 1316 N LEU A 342 164.423 135.067 90.374 1.00161.90 N
ATOM 1317 CA LEU A 342 164.451 134.301 89.131 1.00161.90 C
ATOM 1318 C LEU A 342 164.016 132.857 89.352 1.00161.90 C
ATOM 1319 O LEU A 342 163.601 132.177 88.407 1.00161.90 O
ATOM 1320 CB LEU A 342 165.850 134.345 88.517 1.00161.90 C
ATOM 1321 N VAL A 343 164.113 132.370 90.585 1.00157.20 N
ATOM 1322 CA VAL A 343 163.732 130.997 90.900 1.00157.20 C
ATOM 1323 C VAL A 343 162.218 130.834 90.877 1.00157.20 C
ATOM 1324 O VAL A 343 161.704 129.802 90.446 1.00157.20 O
ATOM 1325 CB VAL A 343 164.297 130.563 92.260 1.00157.20 C
ATOM 1326 N SER A 351 168.815 134.630 80.675 1.00244.11 N
ATOM 1327 CA SER A 351 168.475 134.486 79.265 1.00244.11 C
ATOM 1328 C SER A 351 167.796 135.746 78.746 1.00244.11 C
ATOM 1329 O SER A 351 166.748 135.671 78.100 1.00244.11 O
ATOM 1330 CB SER A 351 167.572 133.270 79.053 1.00244.11 C
ATOM 1331 N SER A 352 168.378 136.896 79.116 1.00249.84 N
ATOM 1332 CA SER A 352 168.048 138.272 78.716 1.00249.84 C
ATOM 1333 C SER A 352 166.738 138.783 79.320 1.00249.84 C
ATOM 1334 O SER A 352 166.430 139.973 79.214 1.00249.84 O
ATOM 1335 CB SER A 352 168.018 138.436 77.188 1.00249.84 C
ATOM 1336 OG SER A 352 166.907 137.779 76.604 1.00249.84 O
ATOM 1337 N CYS A 353 165.966 137.904 79.961 1.00245.00 N
ATOM 1338 CA CYS A 353 164.992 138.356 80.944 1.00245.00 C
ATOM 1339 C CYS A 353 165.609 138.315 82.330 1.00245.00 C
ATOM 1340 O CYS A 353 165.256 139.112 83.208 1.00245.00 O
ATOM 1341 CB CYS A 353 163.734 137.493 80.882 1.00245.00 C
ATOM 1342 SG CYS A 353 162.807 137.644 79.342 1.00245.00 S
ATOM 1343 N VAL A 354 166.544 137.385 82.532 1.00247.09 N
ATOM 1344 CA VAL A 354 167.370 137.372 83.733 1.00247.09 C
ATOM 1345 C VAL A 354 168.242 138.620 83.782 1.00247.09 C
ATOM 1346 O VAL A 354 168.378 139.260 84.831 1.00247.09 O
ATOM 1347 CB VAL A 354 168.212 136.082 83.771 1.00247.09 C
ATOM 1348 CG1 VAL A 354 169.133 136.067 84.978 1.00247.09 C
ATOM 1349 CG2 VAL A 354 167.310 134.856 83.765 1.00247.09 C
ATOM 1350 N LYS A 355 168.826 138.996 82.639 1.00247.50 N
ATOM 1351 CA LYS A 355 169.645 140.203 82.575 1.00247.50 C
ATOM 1352 C LYS A 355 168.799 141.458 82.751 1.00247.50 C
ATOM 1353 O LYS A 355 169.285 142.475 83.258 1.00247.50 O
ATOM 1354 CB LYS A 355 170.403 140.253 81.250 1.00247.50 C
ATOM 1355 N GLU A 356 167.534 141.407 82.331 1.00247.92 N
ATOM 1356 CA GLU A 356 166.620 142.507 82.616 1.00247.92 C
ATOM 1357 C GLU A 356 166.261 142.546 84.096 1.00247.92 C
ATOM 1358 O GLU A 356 166.037 143.622 84.662 1.00247.92 O
ATOM 1359 CB GLU A 356 165.361 142.379 81.762 1.00247.92 C
ATOM 1360 N SER A 357 166.205 141.378 84.740 1.00243.04 N
ATOM 1361 CA SER A 357 165.881 141.326 86.161 1.00243.04 C
ATOM 1362 C SER A 357 167.071 141.741 87.018 1.00243.04 C
ATOM 1363 O SER A 357 166.901 142.102 88.189 1.00243.04 O
ATOM 1364 CB SER A 357 165.413 139.922 86.531 1.00243.04 C
ATOM 1365 OG SER A 357 165.126 139.836 87.913 1.00243.04 O
ATOM 1366 N LEU A 358 168.283 141.652 86.461 1.00249.57 N
ATOM 1367 CA LEU A 358 169.497 142.053 87.173 1.00249.57 C
ATOM 1368 C LEU A 358 169.476 143.532 87.544 1.00249.57 C
ATOM 1369 O LEU A 358 169.933 143.921 88.625 1.00249.57 O
ATOM 1370 CB LEU A 358 170.739 141.749 86.327 1.00249.57 C
ATOM 1371 CG LEU A 358 171.202 140.307 86.111 1.00249.57 C
ATOM 1372 CD1 LEU A 358 172.376 140.258 85.147 1.00249.57 C
ATOM 1373 CD2 LEU A 358 171.572 139.663 87.432 1.00249.57 C
ATOM 1374 N LEU A 359 168.966 144.371 86.642 1.00250.62 N
ATOM 1375 CA LEU A 359 168.921 145.817 86.838 1.00250.62 C
ATOM 1376 C LEU A 359 168.011 146.214 87.993 1.00250.62 C
ATOM 1377 O LEU A 359 168.255 147.225 88.661 1.00250.62 O
ATOM 1378 CB LEU A 359 168.466 146.507 85.552 1.00250.62 C
ATOM 1379 N ARG A 360 166.954 145.431 88.226 1.00248.23 N
ATOM 1380 CA ARG A 360 166.057 145.706 89.343 1.00248.23 C
ATOM 1381 C ARG A 360 166.738 145.436 90.679 1.00248.23 C
ATOM 1382 O ARG A 360 166.452 146.107 91.678 1.00248.23 O
ATOM 1383 CB ARG A 360 164.784 144.869 89.211 1.00248.23 C
ATOM 1384 N PHE A 361 167.645 144.458 90.716 1.00249.72 N
ATOM 1385 CA PHE A 361 168.308 144.114 91.969 1.00249.72 C
ATOM 1386 C PHE A 361 169.423 145.099 92.300 1.00249.72 C
ATOM 1387 O PHE A 361 169.386 145.763 93.344 1.00249.72 O
ATOM 1388 CB PHE A 361 168.855 142.689 91.893 1.00249.72 C
ATOM 1389 N LEU A 362 170.422 145.213 91.424 1.00260.28 N
ATOM 1390 CA LEU A 362 171.566 146.079 91.687 1.00260.28 C
ATOM 1391 C LEU A 362 172.102 146.671 90.388 1.00260.28 C
ATOM 1392 O LEU A 362 172.783 145.979 89.621 1.00260.28 O
ATOM 1393 CB LEU A 362 172.668 145.306 92.413 1.00260.28 C
ATOM 1394 N PRO A 363 171.819 147.944 90.108 1.00260.46 N
ATOM 1395 CA PRO A 363 172.315 148.557 88.870 1.00260.46 C
ATOM 1396 C PRO A 363 173.767 149.001 88.970 1.00260.46 C
ATOM 1397 O PRO A 363 174.406 149.275 87.950 1.00260.46 O
ATOM 1398 CB PRO A 363 171.377 149.753 88.677 1.00260.46 C
ATOM 1399 CG PRO A 363 170.970 150.119 90.060 1.00260.46 C
ATOM 1400 CD PRO A 363 170.891 148.831 90.832 1.00260.46 C
ATOM 1401 N ARG A 364 174.292 149.087 90.195 1.00260.49 N
ATOM 1402 CA ARG A 364 175.654 149.579 90.384 1.00260.49 C
ATOM 1403 C ARG A 364 176.684 148.552 89.934 1.00260.49 C
ATOM 1404 O ARG A 364 177.734 148.912 89.390 1.00260.49 O
ATOM 1405 CB ARG A 364 175.878 149.954 91.849 1.00260.49 C
ATOM 1406 N THR A 365 176.400 147.267 90.152 1.00259.44 N
ATOM 1407 CA THR A 365 177.360 146.228 89.795 1.00259.44 C
ATOM 1408 C THR A 365 177.387 145.986 88.291 1.00259.44 C
ATOM 1409 O THR A 365 178.446 145.703 87.719 1.00259.44 O
ATOM 1410 CB THR A 365 177.031 144.933 90.536 1.00259.44 C
ATOM 1411 N ILE A 366 176.232 146.094 87.632 1.00258.74 N
ATOM 1412 CA ILE A 366 176.173 145.844 86.194 1.00258.74 C
ATOM 1413 C ILE A 366 176.667 147.057 85.416 1.00258.74 C
ATOM 1414 O ILE A 366 176.882 146.984 84.199 1.00258.74 O
ATOM 1415 CB ILE A 366 174.746 145.449 85.775 1.00258.74 C
ATOM 1416 CG1 ILE A 366 173.782 146.615 85.989 1.00258.74 C
ATOM 1417 CG2 ILE A 366 174.281 144.241 86.566 1.00258.74 C
ATOM 1418 CD1 ILE A 366 172.413 146.392 85.385 1.00258.74 C
ATOM 1419 N SER A 367 176.841 148.192 86.098 1.00258.60 N
ATOM 1420 CA SER A 367 177.247 149.420 85.421 1.00258.60 C
ATOM 1421 C SER A 367 178.704 149.360 84.976 1.00258.60 C
ATOM 1422 O SER A 367 179.002 149.487 83.783 1.00258.60 O
ATOM 1423 CB SER A 367 177.018 150.620 86.340 1.00258.60 C
ATOM 1424 OG SER A 367 177.861 150.556 87.477 1.00258.60 O
ATOM 1425 N ARG A 368 179.624 149.147 85.919 1.00253.10 N
ATOM 1426 CA ARG A 368 181.043 149.137 85.575 1.00253.10 C
ATOM 1427 C ARG A 368 181.446 147.830 84.904 1.00253.10 C
ATOM 1428 O ARG A 368 182.545 147.724 84.349 1.00253.10 O
ATOM 1429 CB ARG A 368 181.886 149.377 86.826 1.00253.10 C
ATOM 1430 N LEU A 369 180.579 146.819 84.964 1.00249.95 N
ATOM 1431 CA LEU A 369 180.877 145.528 84.360 1.00249.95 C
ATOM 1432 C LEU A 369 180.881 145.629 82.840 1.00249.95 C
ATOM 1433 O LEU A 369 180.255 146.518 82.257 1.00249.95 O
ATOM 1434 CB LEU A 369 179.856 144.484 84.815 1.00249.95 C
ATOM 1435 N SER A 370 181.603 144.714 82.201 1.00240.71 N
ATOM 1436 CA SER A 370 181.705 144.682 80.752 1.00240.71 C
ATOM 1437 C SER A 370 180.594 143.802 80.177 1.00240.71 C
ATOM 1438 O SER A 370 179.767 143.245 80.905 1.00240.71 O
ATOM 1439 CB SER A 370 183.093 144.201 80.333 1.00240.71 C
ATOM 1440 N GLU A 371 180.565 143.674 78.849 1.00238.12 N
ATOM 1441 CA GLU A 371 179.548 142.849 78.206 1.00238.12 C
ATOM 1442 C GLU A 371 179.902 141.370 78.289 1.00238.12 C
ATOM 1443 O GLU A 371 179.011 140.519 78.402 1.00238.12 O
ATOM 1444 CB GLU A 371 179.368 143.280 76.751 1.00238.12 C
ATOM 1445 N GLU A 372 181.197 141.043 78.225 1.00233.16 N
ATOM 1446 CA GLU A 372 181.621 139.655 78.380 1.00233.16 C
ATOM 1447 C GLU A 372 181.382 139.164 79.802 1.00233.16 C
ATOM 1448 O GLU A 372 181.077 137.985 80.017 1.00233.16 O
ATOM 1449 CB GLU A 372 183.094 139.510 78.001 1.00233.16 C
ATOM 1450 N GLU A 373 181.487 140.064 80.785 1.00235.51 N
ATOM 1451 CA GLU A 373 181.158 139.707 82.162 1.00235.51 C
ATOM 1452 C GLU A 373 179.664 139.459 82.322 1.00235.51 C
ATOM 1453 O GLU A 373 179.252 138.560 83.065 1.00235.51 O
ATOM 1454 CB GLU A 373 181.625 140.805 83.117 1.00235.51 C
ATOM 1455 N THR A 374 178.838 140.240 81.618 1.00232.66 N
ATOM 1456 CA THR A 374 177.397 140.003 81.630 1.00232.66 C
ATOM 1457 C THR A 374 177.052 138.681 80.954 1.00232.66 C
ATOM 1458 O THR A 374 176.161 137.957 81.413 1.00232.66 O
ATOM 1459 CB THR A 374 176.666 141.160 80.949 1.00232.66 C
ATOM 1460 N GLU A 375 177.770 138.339 79.878 1.00229.64 N
ATOM 1461 CA GLU A 375 177.554 137.057 79.210 1.00229.64 C
ATOM 1462 C GLU A 375 177.980 135.892 80.096 1.00229.64 C
ATOM 1463 O GLU A 375 177.312 134.849 80.128 1.00229.64 O
ATOM 1464 CB GLU A 375 178.309 137.019 77.882 1.00229.64 C
ATOM 1465 N SER A 376 179.079 136.060 80.836 1.00226.41 N
ATOM 1466 CA SER A 376 179.513 135.027 81.771 1.00226.41 C
ATOM 1467 C SER A 376 178.526 134.870 82.922 1.00226.41 C
ATOM 1468 O SER A 376 178.268 133.747 83.372 1.00226.41 O
ATOM 1469 CB SER A 376 180.908 135.350 82.300 1.00226.41 C
ATOM 1470 OG SER A 376 181.334 134.373 83.234 1.00226.41 O
ATOM 1471 N TRP A 377 177.952 135.983 83.399 1.00225.01 N
ATOM 1472 CA TRP A 377 176.929 135.907 84.442 1.00225.01 C
ATOM 1473 C TRP A 377 175.676 135.200 83.950 1.00225.01 C
ATOM 1474 O TRP A 377 175.095 134.388 84.677 1.00225.01 O
ATOM 1475 CB TRP A 377 176.554 137.297 84.948 1.00225.01 C
ATOM 1476 CG TRP A 377 177.556 137.947 85.820 1.00225.01 C
ATOM 1477 CD1 TRP A 377 178.759 137.444 86.209 1.00225.01 C
ATOM 1478 CD2 TRP A 377 177.413 139.208 86.474 1.00225.01 C
ATOM 1479 NE1 TRP A 377 179.394 138.335 87.039 1.00225.01 N
ATOM 1480 CE2 TRP A 377 178.584 139.426 87.221 1.00225.01 C
ATOM 1481 CE3 TRP A 377 176.411 140.184 86.489 1.00225.01 C
ATOM 1482 CZ2 TRP A 377 178.783 140.582 87.978 1.00225.01 C
ATOM 1483 CZ3 TRP A 377 176.608 141.329 87.237 1.00225.01 C
ATOM 1484 CH2 TRP A 377 177.785 141.519 87.972 1.00225.01 C
ATOM 1485 N ILE A 378 175.237 135.508 82.727 1.00219.14 N
ATOM 1486 CA ILE A 378 174.068 134.840 82.160 1.00219.14 C
ATOM 1487 C ILE A 378 174.326 133.349 81.969 1.00219.14 C
ATOM 1488 O ILE A 378 173.469 132.524 82.316 1.00219.14 O
ATOM 1489 CB ILE A 378 173.656 135.528 80.845 1.00219.14 C
ATOM 1490 CG1 ILE A 378 173.099 136.922 81.129 1.00219.14 C
ATOM 1491 CG2 ILE A 378 172.624 134.710 80.078 1.00219.14 C
ATOM 1492 CD1 ILE A 378 172.915 137.760 79.887 1.00219.14 C
ATOM 1493 N LYS A 379 175.523 132.981 81.496 1.00210.68 N
ATOM 1494 CA LYS A 379 175.869 131.571 81.330 1.00210.68 C
ATOM 1495 C LYS A 379 175.935 130.844 82.670 1.00210.68 C
ATOM 1496 O LYS A 379 175.434 129.719 82.797 1.00210.68 O
ATOM 1497 CB LYS A 379 177.200 131.446 80.589 1.00210.68 C
ATOM 1498 N TRP A 380 176.498 131.487 83.695 1.00203.85 N
ATOM 1499 CA TRP A 380 176.645 130.824 84.986 1.00203.85 C
ATOM 1500 C TRP A 380 175.315 130.723 85.723 1.00203.85 C
ATOM 1501 O TRP A 380 175.069 129.741 86.429 1.00203.85 O
ATOM 1502 CB TRP A 380 177.678 131.560 85.837 1.00203.85 C
ATOM 1503 N ILE A 381 174.440 131.721 85.573 1.00196.74 N
ATOM 1504 CA ILE A 381 173.124 131.649 86.203 1.00196.74 C
ATOM 1505 C ILE A 381 172.245 130.629 85.485 1.00196.74 C
ATOM 1506 O ILE A 381 171.478 129.893 86.122 1.00196.74 O
ATOM 1507 CB ILE A 381 172.491 133.055 86.262 1.00196.74 C
ATOM 1508 CG1 ILE A 381 173.219 133.910 87.300 1.00196.74 C
ATOM 1509 CG2 ILE A 381 171.006 133.019 86.589 1.00196.74 C
ATOM 1510 CD1 ILE A 381 172.819 135.359 87.281 1.00196.74 C
ATOM 1511 N LYS A 382 172.385 130.521 84.158 1.00199.14 N
ATOM 1512 CA LYS A 382 171.658 129.489 83.421 1.00199.14 C
ATOM 1513 C LYS A 382 172.175 128.096 83.764 1.00199.14 C
ATOM 1514 O LYS A 382 171.416 127.120 83.742 1.00199.14 O
ATOM 1515 CB LYS A 382 171.762 129.748 81.918 1.00199.14 C
ATOM 1516 N GLU A 383 173.464 127.986 84.087 1.00191.88 N
ATOM 1517 CA GLU A 383 173.980 126.728 84.612 1.00191.88 C
ATOM 1518 C GLU A 383 173.508 126.495 86.045 1.00191.88 C
ATOM 1519 O GLU A 383 173.386 125.348 86.488 1.00191.88 O
ATOM 1520 CB GLU A 383 175.506 126.720 84.536 1.00191.88 C
ATOM 1521 N VAL A 384 173.234 127.573 86.780 1.00185.99 N
ATOM 1522 CA VAL A 384 172.837 127.496 88.182 1.00185.99 C
ATOM 1523 C VAL A 384 171.385 127.057 88.295 1.00185.99 C
ATOM 1524 O VAL A 384 171.055 126.158 89.076 1.00185.99 O
ATOM 1525 CB VAL A 384 173.049 128.842 88.896 1.00185.99 C
ATOM 1526 N LEU A 385 170.506 127.683 87.510 1.00177.88 N
ATOM 1527 CA LEU A 385 169.071 127.435 87.610 1.00177.88 C
ATOM 1528 C LEU A 385 168.668 126.270 86.703 1.00177.88 C
ATOM 1529 O LEU A 385 167.488 126.086 86.387 1.00177.88 O
ATOM 1530 CB LEU A 385 168.308 128.729 87.282 1.00177.88 C
ATOM 1531 CG LEU A 385 166.839 128.942 87.673 1.00177.88 C
ATOM 1532 CD1 LEU A 385 166.690 128.886 89.179 1.00177.88 C
ATOM 1533 CD2 LEU A 385 166.313 130.261 87.138 1.00177.88 C
ATOM 1534 N GLU A 386 169.652 125.472 86.276 1.00175.89 N
ATOM 1535 CA GLU A 386 169.358 124.255 85.527 1.00175.89 C
ATOM 1536 C GLU A 386 168.620 123.240 86.390 1.00175.89 C
ATOM 1537 O GLU A 386 167.760 122.501 85.896 1.00175.89 O
ATOM 1538 CB GLU A 386 170.653 123.654 84.978 1.00175.89 C
ATOM 1539 N SER A 387 168.939 123.191 87.679 1.00164.25 N
ATOM 1540 CA SER A 387 168.284 122.285 88.614 1.00164.25 C
ATOM 1541 C SER A 387 167.591 123.092 89.704 1.00164.25 C
ATOM 1542 O SER A 387 168.266 123.576 90.629 1.00164.25 O
ATOM 1543 CB SER A 387 169.301 121.323 89.227 1.00164.25 C
ATOM 1544 OG SER A 387 170.245 122.032 90.006 1.00164.25 O
ATOM 1545 N PRO A 388 166.267 123.271 89.646 1.00155.59 N
ATOM 1546 CA PRO A 388 165.598 124.053 90.699 1.00155.59 C
ATOM 1547 C PRO A 388 165.515 123.320 92.020 1.00155.59 C
ATOM 1548 O PRO A 388 165.441 123.963 93.075 1.00155.59 O
ATOM 1549 CB PRO A 388 164.202 124.308 90.112 1.00155.59 C
ATOM 1550 CG PRO A 388 164.351 124.093 88.650 1.00155.59 C
ATOM 1551 CD PRO A 388 165.372 123.009 88.510 1.00155.59 C
ATOM 1552 N HIS A 389 165.527 121.985 91.990 1.00143.01 N
ATOM 1553 CA HIS A 389 165.278 121.204 93.197 1.00143.01 C
ATOM 1554 C HIS A 389 166.443 121.284 94.174 1.00143.01 C
ATOM 1555 O HIS A 389 166.257 121.106 95.383 1.00143.01 O
ATOM 1556 CB HIS A 389 164.998 119.752 92.823 1.00143.01 C
ATOM 1557 CG HIS A 389 166.164 119.061 92.196 1.00143.01 C
ATOM 1558 ND1 HIS A 389 166.490 119.213 90.867 1.00143.01 N
ATOM 1559 CD2 HIS A 389 167.091 118.226 92.719 1.00143.01 C
ATOM 1560 CE1 HIS A 389 167.564 118.494 90.596 1.00143.01 C
ATOM 1561 NE2 HIS A 389 167.947 117.883 91.702 1.00143.01 N
ATOM 1562 N LEU A 390 167.651 121.551 93.675 1.00138.91 N
ATOM 1563 CA LEU A 390 168.815 121.546 94.554 1.00138.91 C
ATOM 1564 C LEU A 390 168.879 122.806 95.407 1.00138.91 C
ATOM 1565 O LEU A 390 169.338 122.760 96.553 1.00138.91 O
ATOM 1566 CB LEU A 390 170.094 121.376 93.740 1.00138.91 C
ATOM 1567 CG LEU A 390 170.254 120.002 93.088 1.00138.91 C
ATOM 1568 CD1 LEU A 390 171.509 119.947 92.243 1.00138.91 C
ATOM 1569 CD2 LEU A 390 170.281 118.917 94.142 1.00138.91 C
ATOM 1570 N LEU A 391 168.436 123.937 94.876 1.00134.92 N
ATOM 1571 CA LEU A 391 168.449 125.152 95.669 1.00134.92 C
ATOM 1572 C LEU A 391 167.174 125.258 96.494 1.00134.92 C
ATOM 1573 O LEU A 391 166.141 124.677 96.157 1.00134.92 O
ATOM 1574 CB LEU A 391 168.625 126.380 94.775 1.00134.92 C
ATOM 1575 CG LEU A 391 167.582 126.802 93.738 1.00134.92 C
ATOM 1576 CD1 LEU A 391 166.593 127.843 94.276 1.00134.92 C
ATOM 1577 CD2 LEU A 391 168.280 127.318 92.493 1.00134.92 C
ATOM 1578 N THR A 392 167.254 126.030 97.572 1.00128.06 N
ATOM 1579 CA THR A 392 166.120 126.254 98.457 1.00128.06 C
ATOM 1580 C THR A 392 166.169 127.685 98.971 1.00128.06 C
ATOM 1581 O THR A 392 167.224 128.167 99.383 1.00128.06 O
ATOM 1582 CB THR A 392 166.136 125.293 99.656 1.00128.06 C
ATOM 1583 OG1 THR A 392 166.114 123.939 99.187 1.00128.06 O
ATOM 1584 CG2 THR A 392 164.929 125.536 100.547 1.00128.06 C
ATOM 1585 N VAL A 393 165.031 128.369 98.945 1.00126.95 N
ATOM 1586 CA VAL A 393 164.982 129.751 99.405 1.00126.95 C
ATOM 1587 C VAL A 393 164.064 129.936 100.606 1.00126.95 C
ATOM 1588 O VAL A 393 162.912 129.505 100.594 1.00126.95 O
ATOM 1589 CB VAL A 393 164.536 130.700 98.281 1.00126.95 C
ATOM 1590 CG1 VAL A 393 164.506 132.135 98.785 1.00126.95 C
ATOM 1591 CG2 VAL A 393 165.463 130.569 97.084 1.00126.95 C
ATOM 1592 N ILE A 394 164.588 130.580 101.642 1.00124.36 N
ATOM 1593 CA ILE A 394 163.826 130.839 102.853 1.00124.36 C
ATOM 1594 C ILE A 394 162.699 131.827 102.576 1.00124.36 C
ATOM 1595 O ILE A 394 162.881 132.795 101.839 1.00124.36 O
ATOM 1596 CB ILE A 394 164.729 131.405 103.964 1.00124.36 C
ATOM 1597 CG1 ILE A 394 166.014 130.582 104.073 1.00124.36 C
ATOM 1598 CG2 ILE A 394 163.992 131.436 105.295 1.00124.36 C
ATOM 1599 CD1 ILE A 394 166.963 131.072 105.144 1.00124.36 C
ATOM 1600 N LYS A 395 161.538 131.581 103.171 1.00124.52 N
ATOM 1601 CA LYS A 395 160.388 132.458 102.995 1.00124.52 C
ATOM 1602 C LYS A 395 160.645 133.812 103.644 1.00124.52 C
ATOM 1603 O LYS A 395 161.297 133.898 104.684 1.00124.52 O
ATOM 1604 CB LYS A 395 159.130 131.821 103.586 1.00124.52 C
ATOM 1605 N ILE A 396 160.131 134.869 103.025 1.00130.70 N
ATOM 1606 CA ILE A 396 160.305 136.218 103.546 1.00130.70 C
ATOM 1607 C ILE A 396 159.652 136.362 104.917 1.00130.70 C
ATOM 1608 O ILE A 396 160.201 137.003 105.812 1.00130.70 O
ATOM 1609 CB ILE A 396 159.720 137.275 102.590 1.00130.70 C
ATOM 1610 N GLU A 397 158.476 135.763 105.075 1.00138.92 N
ATOM 1611 CA GLU A 397 157.749 135.822 106.337 1.00138.92 C
ATOM 1612 C GLU A 397 158.359 134.880 107.366 1.00138.92 C
ATOM 1613 O GLU A 397 157.673 134.020 107.917 1.00138.92 O
ATOM 1614 CB GLU A 397 156.275 135.476 106.123 1.00138.92 C
ATOM 1615 N GLU A 402 161.458 128.348 114.292 1.00127.89 N
ATOM 1616 CA GLU A 402 162.179 127.187 113.793 1.00127.89 C
ATOM 1617 C GLU A 402 162.241 127.129 112.274 1.00127.89 C
ATOM 1618 O GLU A 402 162.222 126.031 111.710 1.00127.89 O
ATOM 1619 CB GLU A 402 161.544 125.905 114.335 1.00127.89 C
ATOM 1620 N ILE A 403 162.301 128.278 111.599 1.00121.98 N
ATOM 1621 CA ILE A 403 162.347 128.271 110.140 1.00121.98 C
ATOM 1622 C ILE A 403 163.703 127.789 109.640 1.00121.98 C
ATOM 1623 O ILE A 403 163.808 127.241 108.536 1.00121.98 O
ATOM 1624 CB ILE A 403 162.000 129.664 109.583 1.00121.98 C
ATOM 1625 CG1 ILE A 403 162.941 130.728 110.152 1.00121.98 C
ATOM 1626 CG2 ILE A 403 160.549 129.998 109.867 1.00121.98 C
ATOM 1627 CD1 ILE A 403 162.823 132.067 109.474 1.00121.98 C
ATOM 1628 N VAL A 404 164.755 127.966 110.443 1.00117.38 N
ATOM 1629 CA VAL A 404 166.106 127.649 109.985 1.00117.38 C
ATOM 1630 C VAL A 404 166.302 126.143 109.912 1.00117.38 C
ATOM 1631 O VAL A 404 166.762 125.608 108.894 1.00117.38 O
ATOM 1632 CB VAL A 404 167.152 128.307 110.901 1.00117.38 C
ATOM 1633 CG1 VAL A 404 168.550 127.904 110.476 1.00117.38 C
ATOM 1634 CG2 VAL A 404 167.000 129.810 110.869 1.00117.38 C
ATOM 1635 N SER A 405 165.951 125.440 110.995 1.00114.77 N
ATOM 1636 CA SER A 405 166.054 123.985 111.015 1.00114.77 C
ATOM 1637 C SER A 405 165.118 123.358 109.999 1.00114.77 C
ATOM 1638 O SER A 405 165.472 122.368 109.348 1.00114.77 O
ATOM 1639 CB SER A 405 165.738 123.453 112.409 1.00114.77 C
ATOM 1640 OG SER A 405 164.375 123.666 112.717 1.00114.77 O
ATOM 1641 N ASN A 406 163.934 123.953 109.829 1.00113.60 N
ATOM 1642 CA ASN A 406 162.982 123.473 108.835 1.00113.60 C
ATOM 1643 C ASN A 406 163.546 123.608 107.427 1.00113.60 C
ATOM 1644 O ASN A 406 163.464 122.668 106.628 1.00113.60 O
ATOM 1645 CB ASN A 406 161.670 124.244 108.962 1.00113.60 C
ATOM 1646 CG ASN A 406 160.526 123.587 108.213 1.00113.60 C
ATOM 1647 OD1 ASN A 406 160.683 122.524 107.615 1.00113.60 O
ATOM 1648 ND2 ASN A 406 159.363 124.224 108.243 1.00113.60 N
ATOM 1649 N ALA A 407 164.170 124.750 107.128 1.00112.88 N
ATOM 1650 CA ALA A 407 164.708 124.978 105.793 1.00112.88 C
ATOM 1651 C ALA A 407 165.895 124.069 105.507 1.00112.88 C
ATOM 1652 O ALA A 407 165.989 123.490 104.416 1.00112.88 O
ATOM 1653 CB ALA A 407 165.105 126.443 105.638 1.00112.88 C
ATOM 1654 N ILE A 408 166.791 123.912 106.488 1.00109.06 N
ATOM 1655 CA ILE A 408 167.971 123.070 106.299 1.00109.06 C
ATOM 1656 C ILE A 408 167.569 121.614 106.120 1.00109.06 C
ATOM 1657 O ILE A 408 168.037 120.936 105.193 1.00109.06 O
ATOM 1658 CB ILE A 408 168.950 123.249 107.474 1.00109.06 C
ATOM 1659 CG1 ILE A 408 169.527 124.661 107.470 1.00109.06 C
ATOM 1660 CG2 ILE A 408 170.080 122.247 107.395 1.00109.06 C
ATOM 1661 CD1 ILE A 408 170.307 125.010 108.710 1.00109.06 C
ATOM 1662 N SER A 409 166.661 121.126 106.969 1.00107.06 N
ATOM 1663 CA SER A 409 166.239 119.736 106.887 1.00107.06 C
ATOM 1664 C SER A 409 165.437 119.470 105.625 1.00107.06 C
ATOM 1665 O SER A 409 165.563 118.400 105.024 1.00107.06 O
ATOM 1666 CB SER A 409 165.419 119.374 108.115 1.00107.06 C
ATOM 1667 OG SER A 409 164.231 120.136 108.151 1.00107.06 O
ATOM 1668 N PHE A 410 164.636 120.443 105.187 1.00109.65 N
ATOM 1669 CA PHE A 410 163.856 120.252 103.972 1.00109.65 C
ATOM 1670 C PHE A 410 164.747 120.234 102.740 1.00109.65 C
ATOM 1671 O PHE A 410 164.541 119.417 101.832 1.00109.65 O
ATOM 1672 CB PHE A 410 162.797 121.340 103.862 1.00109.65 C
ATOM 1673 CG PHE A 410 161.958 121.232 102.636 1.00109.65 C
ATOM 1674 CD1 PHE A 410 161.034 120.211 102.507 1.00109.65 C
ATOM 1675 CD2 PHE A 410 162.079 122.159 101.617 1.00109.65 C
ATOM 1676 CE1 PHE A 410 160.253 120.108 101.375 1.00109.65 C
ATOM 1677 CE2 PHE A 410 161.299 122.067 100.484 1.00109.65 C
ATOM 1678 CZ PHE A 410 160.386 121.038 100.362 1.00109.65 C
ATOM 1679 N ALA A 411 165.767 121.099 102.708 1.00109.54 N
ATOM 1680 CA ALA A 411 166.711 121.087 101.596 1.00109.54 C
ATOM 1681 C ALA A 411 167.523 119.801 101.577 1.00109.54 C
ATOM 1682 O ALA A 411 167.772 119.230 100.506 1.00109.54 O
ATOM 1683 CB ALA A 411 167.632 122.300 101.680 1.00109.54 C
ATOM 1684 N LEU A 412 167.912 119.311 102.755 1.00105.13 N
ATOM 1685 CA LEU A 412 168.708 118.094 102.813 1.00105.13 C
ATOM 1686 C LEU A 412 167.881 116.873 102.428 1.00105.13 C
ATOM 1687 O LEU A 412 168.381 115.959 101.759 1.00105.13 O
ATOM 1688 CB LEU A 412 169.295 117.934 104.208 1.00105.13 C
ATOM 1689 CG LEU A 412 170.305 116.806 104.344 1.00105.13 C
ATOM 1690 CD1 LEU A 412 171.487 117.118 103.464 1.00105.13 C
ATOM 1691 CD2 LEU A 412 170.720 116.666 105.787 1.00105.13 C
ATOM 1692 N TYR A 413 166.603 116.854 102.815 1.00108.06 N
ATOM 1693 CA TYR A 413 165.731 115.762 102.403 1.00108.06 C
ATOM 1694 C TYR A 413 165.457 115.811 100.911 1.00108.06 C
ATOM 1695 O TYR A 413 165.365 114.763 100.264 1.00108.06 O
ATOM 1696 CB TYR A 413 164.421 115.796 103.180 1.00108.06 C
ATOM 1697 CG TYR A 413 163.463 114.735 102.719 1.00108.06 C
ATOM 1698 CD1 TYR A 413 163.725 113.398 102.960 1.00108.06 C
ATOM 1699 CD2 TYR A 413 162.300 115.068 102.044 1.00108.06 C
ATOM 1700 CE1 TYR A 413 162.861 112.415 102.538 1.00108.06 C
ATOM 1701 CE2 TYR A 413 161.423 114.090 101.617 1.00108.06 C
ATOM 1702 CZ TYR A 413 161.711 112.763 101.868 1.00108.06 C
ATOM 1703 OH TYR A 413 160.848 111.775 101.450 1.00108.06 O
ATOM 1704 N LYS A 414 165.333 117.020 100.350 1.00110.58 N
ATOM 1705 CA LYS A 414 165.187 117.167 98.905 1.00110.58 C
ATOM 1706 C LYS A 414 166.399 116.619 98.167 1.00110.58 C
ATOM 1707 O LYS A 414 166.254 115.907 97.167 1.00110.58 O
ATOM 1708 CB LYS A 414 164.973 118.635 98.545 1.00110.58 C
ATOM 1709 CG LYS A 414 163.535 119.094 98.636 1.00110.58 C
ATOM 1710 CD LYS A 414 163.376 120.474 98.028 1.00110.58 C
ATOM 1711 N ALA A 415 167.597 116.916 98.668 1.00112.16 N
ATOM 1712 CA ALA A 415 168.832 116.419 98.073 1.00112.16 C
ATOM 1713 C ALA A 415 168.936 114.901 98.152 1.00112.16 C
ATOM 1714 O ALA A 415 169.276 114.244 97.159 1.00112.16 O
ATOM 1715 CB ALA A 415 170.041 117.057 98.751 1.00112.16 C
ATOM 1716 N PHE A 416 168.633 114.334 99.319 1.00112.60 N
ATOM 1717 CA PHE A 416 168.758 112.891 99.477 1.00112.60 C
ATOM 1718 C PHE A 416 167.667 112.138 98.726 1.00112.60 C
ATOM 1719 O PHE A 416 167.858 110.990 98.313 1.00112.60 O
ATOM 1720 CB PHE A 416 168.754 112.521 100.959 1.00112.60 C
ATOM 1721 CG PHE A 416 168.954 111.060 101.210 1.00112.60 C
ATOM 1722 CD1 PHE A 416 170.170 110.463 100.927 1.00112.60 C
ATOM 1723 CD2 PHE A 416 167.939 110.287 101.740 1.00112.60 C
ATOM 1724 CE1 PHE A 416 170.365 109.117 101.152 1.00112.60 C
ATOM 1725 CE2 PHE A 416 168.129 108.941 101.974 1.00112.60 C
ATOM 1726 CZ PHE A 416 169.345 108.357 101.680 1.00112.60 C
ATOM 1727 N SER A 417 166.515 112.776 98.522 1.00118.39 N
ATOM 1728 CA SER A 417 165.471 112.145 97.725 1.00118.39 C
ATOM 1729 C SER A 417 165.796 112.219 96.240 1.00118.39 C
ATOM 1730 O SER A 417 165.532 111.270 95.493 1.00118.39 O
ATOM 1731 CB SER A 417 164.125 112.799 98.019 1.00118.39 C
ATOM 1732 OG SER A 417 163.750 112.587 99.367 1.00118.39 O
ATOM 1733 N THR A 418 166.375 113.337 95.793 1.00128.95 N
ATOM 1734 CA THR A 418 166.739 113.470 94.386 1.00128.95 C
ATOM 1735 C THR A 418 167.957 112.623 94.042 1.00128.95 C
ATOM 1736 O THR A 418 168.217 112.359 92.862 1.00128.95 O
ATOM 1737 CB THR A 418 167.000 114.936 94.045 1.00128.95 C
ATOM 1738 N ASN A 419 168.740 112.230 95.053 1.00131.70 N
ATOM 1739 CA ASN A 419 169.803 111.252 94.834 1.00131.70 C
ATOM 1740 C ASN A 419 169.237 109.925 94.345 1.00131.70 C
ATOM 1741 O ASN A 419 169.754 109.332 93.391 1.00131.70 O
ATOM 1742 CB ASN A 419 170.609 111.051 96.117 1.00131.70 C
ATOM 1743 CG ASN A 419 171.566 112.190 96.386 1.00131.70 C
ATOM 1744 OD1 ASN A 419 172.260 112.652 95.483 1.00131.70 O
ATOM 1745 ND2 ASN A 419 171.602 112.656 97.627 1.00131.70 N
ATOM 1746 N GLU A 420 168.190 109.431 95.013 1.00135.64 N
ATOM 1747 CA GLU A 420 167.373 108.272 94.645 1.00135.64 C
ATOM 1748 C GLU A 420 168.141 106.957 94.560 1.00135.64 C
ATOM 1749 O GLU A 420 167.592 105.966 94.060 1.00135.64 O
ATOM 1750 CB GLU A 420 166.629 108.500 93.323 1.00135.64 C
ATOM 1751 N HIS A 421 169.394 106.910 95.021 1.00140.99 N
ATOM 1752 CA HIS A 421 170.087 105.632 95.132 1.00140.99 C
ATOM 1753 C HIS A 421 169.500 104.808 96.267 1.00140.99 C
ATOM 1754 O HIS A 421 169.474 103.573 96.208 1.00140.99 O
ATOM 1755 CB HIS A 421 171.584 105.862 95.341 1.00140.99 C
ATOM 1756 N ASP A 422 169.024 105.480 97.309 1.00140.01 N
ATOM 1757 CA ASP A 422 168.256 104.862 98.376 1.00140.01 C
ATOM 1758 C ASP A 422 166.763 105.132 98.247 1.00140.01 C
ATOM 1759 O ASP A 422 166.108 105.395 99.261 1.00140.01 O
ATOM 1760 CB ASP A 422 168.758 105.355 99.737 1.00140.01 C
ATOM 1761 N ARG A 423 166.222 105.112 97.026 1.00140.28 N
ATOM 1762 CA ARG A 423 164.793 105.341 96.834 1.00140.28 C
ATOM 1763 C ARG A 423 163.968 104.197 97.416 1.00140.28 C
ATOM 1764 O ARG A 423 162.942 104.425 98.069 1.00140.28 O
ATOM 1765 CB ARG A 423 164.490 105.526 95.347 1.00140.28 C
ATOM 1766 N ASP A 424 164.402 102.955 97.189 1.00130.40 N
ATOM 1767 CA ASP A 424 163.748 101.821 97.837 1.00130.40 C
ATOM 1768 C ASP A 424 164.065 101.788 99.326 1.00130.40 C
ATOM 1769 O ASP A 424 163.255 101.316 100.130 1.00130.40 O
ATOM 1770 CB ASP A 424 164.172 100.516 97.167 1.00130.40 C
ATOM 1771 N ASN A 425 165.237 102.295 99.709 1.00122.84 N
ATOM 1772 CA ASN A 425 165.646 102.358 101.111 1.00122.84 C
ATOM 1773 C ASN A 425 165.012 103.589 101.750 1.00122.84 C
ATOM 1774 O ASN A 425 165.651 104.615 101.994 1.00122.84 O
ATOM 1775 CB ASN A 425 167.163 102.378 101.233 1.00122.84 C
ATOM 1776 N TRP A 426 163.725 103.457 102.064 1.00117.08 N
ATOM 1777 CA TRP A 426 162.965 104.490 102.755 1.00117.08 C
ATOM 1778 C TRP A 426 163.382 104.592 104.214 1.00117.08 C
ATOM 1779 O TRP A 426 163.067 105.573 104.892 1.00117.08 O
ATOM 1780 CB TRP A 426 161.471 104.184 102.656 1.00117.08 C
ATOM 1781 CG TRP A 426 161.114 102.838 103.221 1.00117.08 C
ATOM 1782 CD1 TRP A 426 161.123 101.647 102.559 1.00117.08 C
ATOM 1783 CD2 TRP A 426 160.695 102.547 104.560 1.00117.08 C
ATOM 1784 NE1 TRP A 426 160.740 100.633 103.400 1.00117.08 N
ATOM 1785 CE2 TRP A 426 160.469 101.160 104.635 1.00117.08 C
ATOM 1786 CE3 TRP A 426 160.488 103.324 105.701 1.00117.08 C
ATOM 1787 CZ2 TRP A 426 160.047 100.534 105.805 1.00117.08 C
ATOM 1788 CZ3 TRP A 426 160.069 102.702 106.862 1.00117.08 C
ATOM 1789 CH2 TRP A 426 159.853 101.322 106.904 1.00117.08 C
ATOM 1790 N ASN A 427 164.094 103.574 104.691 1.00106.48 N
ATOM 1791 CA ASN A 427 164.591 103.480 106.051 1.00106.48 C
ATOM 1792 C ASN A 427 165.532 104.617 106.418 1.00106.48 C
ATOM 1793 O ASN A 427 165.523 105.071 107.565 1.00106.48 O
ATOM 1794 CB ASN A 427 165.315 102.140 106.223 1.00106.48 C
ATOM 1795 CG ASN A 427 165.505 101.750 107.667 1.00106.48 C
ATOM 1796 OD1 ASN A 427 165.052 102.434 108.579 1.00106.48 O
ATOM 1797 ND2 ASN A 427 166.189 100.637 107.883 1.00106.48 N
ATOM 1798 N GLY A 428 166.321 105.109 105.465 1.00103.21 N
ATOM 1799 CA GLY A 428 167.218 106.212 105.766 1.00103.21 C
ATOM 1800 C GLY A 428 166.496 107.540 105.880 1.00103.21 C
ATOM 1801 O GLY A 428 166.900 108.409 106.660 1.00103.21 O
ATOM 1802 N GLN A 429 165.419 107.716 105.106 1.00104.18 N
ATOM 1803 CA GLN A 429 164.668 108.967 105.149 1.00104.18 C
ATOM 1804 C GLN A 429 163.956 109.132 106.482 1.00104.18 C
ATOM 1805 O GLN A 429 163.768 110.256 106.962 1.00104.18 O
ATOM 1806 CB GLN A 429 163.657 109.023 104.006 1.00104.18 C
ATOM 1807 CG GLN A 429 164.272 109.037 102.624 1.00104.18 C
ATOM 1808 CD GLN A 429 163.230 109.159 101.528 1.00104.18 C
ATOM 1809 OE1 GLN A 429 162.035 109.233 101.800 1.00104.18 O
ATOM 1810 NE2 GLN A 429 163.680 109.173 100.281 1.00104.18 N
ATOM 1811 N LEU A 430 163.578 108.018 107.111 1.00 98.26 N
ATOM 1812 CA LEU A 430 162.917 108.098 108.405 1.00 98.26 C
ATOM 1813 C LEU A 430 163.897 108.512 109.490 1.00 98.26 C
ATOM 1814 O LEU A 430 163.565 109.328 110.353 1.00 98.26 O
ATOM 1815 CB LEU A 430 162.264 106.764 108.746 1.00 98.26 C
ATOM 1816 CG LEU A 430 161.328 106.818 109.943 1.00 98.26 C
ATOM 1817 CD1 LEU A 430 160.191 107.759 109.628 1.00 98.26 C
ATOM 1818 CD2 LEU A 430 160.802 105.439 110.223 1.00 98.26 C
ATOM 1819 N LYS A 431 165.126 107.994 109.439 1.00 93.07 N
ATOM 1820 CA LYS A 431 166.150 108.446 110.375 1.00 93.07 C
ATOM 1821 C LYS A 431 166.539 109.893 110.104 1.00 93.07 C
ATOM 1822 O LYS A 431 166.863 110.642 111.034 1.00 93.07 O
ATOM 1823 CB LYS A 431 167.373 107.539 110.295 1.00 93.07 C
ATOM 1824 CG LYS A 431 167.132 106.145 110.825 1.00 93.07 C
ATOM 1825 CD LYS A 431 168.399 105.325 110.785 1.00 93.07 C
ATOM 1826 CE LYS A 431 168.165 103.920 111.290 1.00 93.07 C
ATOM 1827 NZ LYS A 431 169.413 103.121 111.224 1.00 93.07 N
ATOM 1828 N LEU A 432 166.494 110.303 108.835 1.00 92.87 N
ATOM 1829 CA LEU A 432 166.798 111.684 108.485 1.00 92.87 C
ATOM 1830 C LEU A 432 165.751 112.640 109.041 1.00 92.87 C
ATOM 1831 O LEU A 432 166.091 113.694 109.586 1.00 92.87 O
ATOM 1832 CB LEU A 432 166.897 111.819 106.972 1.00 92.87 C
ATOM 1833 CG LEU A 432 167.319 113.202 106.505 1.00 92.87 C
ATOM 1834 CD1 LEU A 432 168.698 113.508 107.031 1.00 92.87 C
ATOM 1835 CD2 LEU A 432 167.298 113.254 104.997 1.00 92.87 C
ATOM 1836 N LEU A 433 164.472 112.273 108.940 1.00 91.27 N
ATOM 1837 CA LEU A 433 163.414 113.088 109.531 1.00 91.27 C
ATOM 1838 C LEU A 433 163.271 112.818 111.022 1.00 91.27 C
ATOM 1839 O LEU A 433 162.415 113.409 111.689 1.00 91.27 O
ATOM 1840 CB LEU A 433 162.096 112.830 108.811 1.00 91.27 C
ATOM 1841 CG LEU A 433 162.055 113.374 107.392 1.00 91.27 C
ATOM 1842 CD1 LEU A 433 160.848 112.855 106.651 1.00 91.27 C
ATOM 1843 CD2 LEU A 433 162.029 114.884 107.460 1.00 91.27 C
ATOM 1844 N LEU A 434 164.058 111.886 111.550 1.00 84.15 N
ATOM 1845 CA LEU A 434 164.130 111.719 112.994 1.00 84.15 C
ATOM 1846 C LEU A 434 165.190 112.625 113.606 1.00 84.15 C
ATOM 1847 O LEU A 434 165.006 113.137 114.717 1.00 84.15 O
ATOM 1848 CB LEU A 434 164.403 110.257 113.324 1.00 84.15 C
ATOM 1849 CG LEU A 434 164.639 109.899 114.788 1.00 84.15 C
ATOM 1850 CD1 LEU A 434 163.454 110.268 115.642 1.00 84.15 C
ATOM 1851 CD2 LEU A 434 164.923 108.421 114.907 1.00 84.15 C
ATOM 1852 N GLU A 435 166.304 112.840 112.898 1.00 95.18 N
ATOM 1853 CA GLU A 435 167.378 113.667 113.445 1.00 95.18 C
ATOM 1854 C GLU A 435 166.953 115.120 113.577 1.00 95.18 C
ATOM 1855 O GLU A 435 167.123 115.729 114.636 1.00 95.18 O
ATOM 1856 CB GLU A 435 168.630 113.559 112.580 1.00 95.18 C
ATOM 1857 CG GLU A 435 169.331 112.229 112.696 1.00 95.18 C
ATOM 1858 CD GLU A 435 169.947 112.033 114.060 1.00 95.18 C
ATOM 1859 OE1 GLU A 435 170.388 113.036 114.662 1.00 95.18 O
ATOM 1860 OE2 GLU A 435 169.985 110.879 114.535 1.00 95.18 O
ATOM 1861 N TRP A 436 166.387 115.686 112.523 1.00 88.30 N
ATOM 1862 CA TRP A 436 165.726 116.976 112.602 1.00 88.30 C
ATOM 1863 C TRP A 436 164.243 116.735 112.820 1.00 88.30 C
ATOM 1864 O TRP A 436 163.629 115.952 112.093 1.00 88.30 O
ATOM 1865 CB TRP A 436 165.958 117.786 111.333 1.00 88.30 C
ATOM 1866 CG TRP A 436 167.362 118.235 111.177 1.00 88.30 C
ATOM 1867 CD1 TRP A 436 167.889 119.427 111.564 1.00 88.30 C
ATOM 1868 CD2 TRP A 436 168.433 117.484 110.622 1.00 88.30 C
ATOM 1869 NE1 TRP A 436 169.226 119.472 111.268 1.00 88.30 N
ATOM 1870 CE2 TRP A 436 169.583 118.286 110.689 1.00 88.30 C
ATOM 1871 CE3 TRP A 436 168.533 116.210 110.068 1.00 88.30 C
ATOM 1872 CZ2 TRP A 436 170.813 117.857 110.224 1.00 88.30 C
ATOM 1873 CZ3 TRP A 436 169.754 115.786 109.609 1.00 88.30 C
ATOM 1874 CH2 TRP A 436 170.878 116.604 109.687 1.00 88.30 C
ATOM 1875 N ASN A 437 163.674 117.396 113.819 1.00 89.08 N
ATOM 1876 CA ASN A 437 162.297 117.132 114.226 1.00 89.08 C
ATOM 1877 C ASN A 437 161.356 117.743 113.197 1.00 89.08 C
ATOM 1878 O ASN A 437 161.148 118.956 113.170 1.00 89.08 O
ATOM 1879 CB ASN A 437 162.043 117.693 115.619 1.00 89.08 C
ATOM 1880 CG ASN A 437 160.743 117.202 116.228 1.00 89.08 C
ATOM 1881 OD1 ASN A 437 159.998 116.441 115.616 1.00 89.08 O
ATOM 1882 ND2 ASN A 437 160.468 117.641 117.448 1.00 89.08 N
ATOM 1883 N GLN A 438 160.788 116.898 112.335 1.00 99.66 N
ATOM 1884 CA GLN A 438 159.712 117.290 111.424 1.00 99.66 C
ATOM 1885 C GLN A 438 158.649 116.193 111.424 1.00 99.66 C
ATOM 1886 O GLN A 438 158.837 115.118 110.856 1.00 99.66 O
ATOM 1887 CB GLN A 438 160.221 117.555 110.019 1.00 99.66 C
ATOM 1888 CG GLN A 438 160.978 118.835 109.862 1.00 99.66 C
ATOM 1889 CD GLN A 438 161.303 119.097 108.422 1.00 99.66 C
ATOM 1890 OE1 GLN A 438 161.047 118.262 107.561 1.00 99.66 O
ATOM 1891 NE2 GLN A 438 161.846 120.271 108.142 1.00 99.66 N
ATOM 1892 N LEU A 439 157.523 116.472 112.078 1.00100.24 N
ATOM 1893 CA LEU A 439 156.457 115.482 112.143 1.00100.24 C
ATOM 1894 C LEU A 439 155.662 115.431 110.848 1.00100.24 C
ATOM 1895 O LEU A 439 155.464 114.350 110.280 1.00100.24 O
ATOM 1896 CB LEU A 439 155.527 115.782 113.313 1.00100.24 C
ATOM 1897 CG LEU A 439 154.377 114.786 113.431 1.00100.24 C
ATOM 1898 CD1 LEU A 439 154.907 113.401 113.735 1.00100.24 C
ATOM 1899 CD2 LEU A 439 153.375 115.231 114.478 1.00100.24 C
ATOM 1900 N ASP A 440 155.199 116.592 110.369 1.00101.82 N
ATOM 1901 CA ASP A 440 154.150 116.633 109.351 1.00101.82 C
ATOM 1902 C ASP A 440 154.651 116.147 108.001 1.00101.82 C
ATOM 1903 O ASP A 440 153.946 115.409 107.300 1.00101.82 O
ATOM 1904 CB ASP A 440 153.593 118.050 109.233 1.00101.82 C
ATOM 1905 N LEU A 441 155.866 116.545 107.621 1.00100.13 N
ATOM 1906 CA LEU A 441 156.443 116.070 106.371 1.00100.13 C
ATOM 1907 C LEU A 441 156.720 114.574 106.420 1.00100.13 C
ATOM 1908 O LEU A 441 156.566 113.882 105.406 1.00100.13 O
ATOM 1909 CB LEU A 441 157.715 116.855 106.061 1.00100.13 C
ATOM 1910 CG LEU A 441 158.424 116.558 104.743 1.00100.13 C
ATOM 1911 CD1 LEU A 441 157.495 116.823 103.583 1.00100.13 C
ATOM 1912 CD2 LEU A 441 159.666 117.412 104.620 1.00100.13 C
ATOM 1913 N ALA A 442 157.077 114.056 107.595 1.00 99.43 N
ATOM 1914 CA ALA A 442 157.290 112.624 107.751 1.00 99.43 C
ATOM 1915 C ALA A 442 155.992 111.841 107.666 1.00 99.43 C
ATOM 1916 O ALA A 442 155.975 110.738 107.109 1.00 99.43 O
ATOM 1917 CB ALA A 442 157.978 112.337 109.082 1.00 99.43 C
ATOM 1918 N SER A 443 154.903 112.385 108.207 1.00107.58 N
ATOM 1919 CA SER A 443 153.625 111.690 108.124 1.00107.58 C
ATOM 1920 C SER A 443 153.045 111.755 106.720 1.00107.58 C
ATOM 1921 O SER A 443 152.406 110.798 106.272 1.00107.58 O
ATOM 1922 CB SER A 443 152.634 112.280 109.123 1.00107.58 C
ATOM 1923 OG SER A 443 152.294 113.608 108.768 1.00107.58 O
ATOM 1924 N ASP A 444 153.263 112.862 106.013 1.00106.63 N
ATOM 1925 CA ASP A 444 152.719 113.000 104.669 1.00106.63 C
ATOM 1926 C ASP A 444 153.515 112.215 103.634 1.00106.63 C
ATOM 1927 O ASP A 444 152.923 111.575 102.759 1.00106.63 O
ATOM 1928 CB ASP A 444 152.662 114.477 104.274 1.00106.63 C
ATOM 1929 N GLU A 445 154.845 112.236 103.714 1.00102.00 N
ATOM 1930 CA GLU A 445 155.656 111.624 102.670 1.00102.00 C
ATOM 1931 C GLU A 445 155.730 110.107 102.790 1.00102.00 C
ATOM 1932 O GLU A 445 155.315 109.390 101.876 1.00102.00 O
ATOM 1933 CB GLU A 445 157.066 112.215 102.688 1.00102.00 C
ATOM 1934 N ILE A 446 156.248 109.606 103.913 1.00101.59 N
ATOM 1935 CA ILE A 446 156.622 108.196 103.989 1.00101.59 C
ATOM 1936 C ILE A 446 155.403 107.316 104.225 1.00101.59 C
ATOM 1937 O ILE A 446 155.238 106.274 103.580 1.00101.59 O
ATOM 1938 CB ILE A 446 157.680 107.985 105.086 1.00101.59 C
ATOM 1939 CG1 ILE A 446 158.908 108.840 104.816 1.00101.59 C
ATOM 1940 CG2 ILE A 446 158.104 106.539 105.144 1.00101.59 C
ATOM 1941 CD1 ILE A 446 159.894 108.839 105.961 1.00101.59 C
ATOM 1942 N PHE A 447 154.559 107.721 105.166 1.00103.32 N
ATOM 1943 CA PHE A 447 153.392 106.922 105.527 1.00103.32 C
ATOM 1944 C PHE A 447 152.157 107.030 104.633 1.00103.32 C
ATOM 1945 O PHE A 447 151.071 107.372 105.099 1.00103.32 O
ATOM 1946 CB PHE A 447 153.027 107.142 106.997 1.00103.32 C
ATOM 1947 CG PHE A 447 154.049 106.601 107.954 1.00103.32 C
ATOM 1948 CD1 PHE A 447 154.161 105.239 108.168 1.00103.32 C
ATOM 1949 CD2 PHE A 447 154.905 107.450 108.630 1.00103.32 C
ATOM 1950 CE1 PHE A 447 155.103 104.731 109.039 1.00103.32 C
ATOM 1951 CE2 PHE A 447 155.849 106.951 109.506 1.00103.32 C
ATOM 1952 CZ PHE A 447 155.949 105.589 109.711 1.00103.32 C
ATOM 1953 N THR A 448 152.332 106.733 103.349 1.00113.84 N
ATOM 1954 CA THR A 448 151.218 106.727 102.410 1.00113.84 C
ATOM 1955 C THR A 448 150.642 105.324 102.522 1.00113.84 C
ATOM 1956 O THR A 448 151.395 104.361 102.683 1.00113.84 O
ATOM 1957 CB THR A 448 151.684 106.975 100.968 1.00113.84 C
ATOM 1958 OG1 THR A 448 152.387 105.824 100.487 1.00113.84 O
ATOM 1959 CG2 THR A 448 152.596 108.191 100.907 1.00113.84 C
ATOM 1960 N ASN A 449 149.323 105.181 102.434 1.00113.05 N
ATOM 1961 CA ASN A 449 148.748 103.846 102.598 1.00113.05 C
ATOM 1962 C ASN A 449 149.271 102.847 101.568 1.00113.05 C
ATOM 1963 O ASN A 449 148.872 101.677 101.588 1.00113.05 O
ATOM 1964 CB ASN A 449 147.223 103.925 102.525 1.00113.05 C
ATOM 1965 N ASP A 450 150.152 103.281 100.663 1.00121.84 N
ATOM 1966 CA ASP A 450 150.681 102.374 99.652 1.00121.84 C
ATOM 1967 C ASP A 450 151.637 101.350 100.256 1.00121.84 C
ATOM 1968 O ASP A 450 151.361 100.146 100.227 1.00121.84 O
ATOM 1969 CB ASP A 450 151.379 103.176 98.554 1.00121.84 C
ATOM 1970 N ARG A 451 152.740 101.830 100.825 1.00126.81 N
ATOM 1971 CA ARG A 451 153.759 100.962 101.420 1.00126.81 C
ATOM 1972 C ARG A 451 153.276 100.089 102.583 1.00126.81 C
ATOM 1973 O ARG A 451 152.298 100.408 103.259 1.00126.81 O
ATOM 1974 CB ARG A 451 154.968 101.791 101.860 1.00126.81 C
ATOM 1975 N ASN A 452 153.989 98.987 102.807 1.00125.66 N
ATOM 1976 CA ASN A 452 153.671 98.045 103.878 1.00125.66 C
ATOM 1977 C ASN A 452 154.804 97.940 104.894 1.00125.66 C
ATOM 1978 O ASN A 452 155.970 97.801 104.524 1.00125.66 O
ATOM 1979 CB ASN A 452 153.348 96.666 103.304 1.00125.66 C
ATOM 1980 CG ASN A 452 152.065 96.657 102.499 1.00125.66 C
ATOM 1981 OD1 ASN A 452 151.257 97.581 102.585 1.00125.66 O
ATOM 1982 ND2 ASN A 452 151.870 95.607 101.710 1.00125.66 N
ATOM 1983 N TRP A 453 154.455 98.010 106.174 1.00122.59 N
ATOM 1984 CA TRP A 453 155.444 97.952 107.248 1.00122.59 C
ATOM 1985 C TRP A 453 155.067 96.997 108.382 1.00122.59 C
ATOM 1986 O TRP A 453 153.890 96.811 108.686 1.00122.59 O
ATOM 1987 CB TRP A 453 155.678 99.359 107.806 1.00122.59 C
ATOM 1988 CG TRP A 453 154.566 100.303 107.469 1.00122.59 C
ATOM 1989 CD1 TRP A 453 153.289 100.266 107.944 1.00122.59 C
ATOM 1990 CD2 TRP A 453 154.624 101.407 106.561 1.00122.59 C
ATOM 1991 NE1 TRP A 453 152.550 101.285 107.395 1.00122.59 N
ATOM 1992 CE2 TRP A 453 153.348 102.001 106.543 1.00122.59 C
ATOM 1993 CE3 TRP A 453 155.634 101.957 105.765 1.00122.59 C
ATOM 1994 CZ2 TRP A 453 153.053 103.115 105.760 1.00122.59 C
ATOM 1995 CZ3 TRP A 453 155.340 103.064 104.990 1.00122.59 C
ATOM 1996 CH2 TRP A 453 154.061 103.631 104.993 1.00122.59 C
ATOM 1997 N GLU A 454 156.081 96.397 109.001 1.00113.33 N
ATOM 1998 CA GLU A 454 155.881 95.474 110.115 1.00113.33 C
ATOM 1999 C GLU A 454 156.456 96.095 111.384 1.00113.33 C
ATOM 2000 O GLU A 454 156.884 97.248 111.366 1.00113.33 O
ATOM 2001 CB GLU A 454 156.553 94.131 109.830 1.00113.33 C
ATOM 2002 N SER A 455 156.474 95.344 112.482 1.00107.50 N
ATOM 2003 CA SER A 455 157.008 95.889 113.727 1.00107.50 C
ATOM 2004 C SER A 455 158.531 95.833 113.748 1.00107.50 C
ATOM 2005 O SER A 455 159.188 96.788 114.186 1.00107.50 O
ATOM 2006 CB SER A 455 156.432 95.127 114.919 1.00107.50 C
ATOM 2007 N ALA A 456 159.103 94.731 113.248 1.00104.56 N
ATOM 2008 CA ALA A 456 160.553 94.548 113.245 1.00104.56 C
ATOM 2009 C ALA A 456 161.241 95.539 112.318 1.00104.56 C
ATOM 2010 O ALA A 456 162.435 95.821 112.472 1.00104.56 O
ATOM 2011 CB ALA A 456 160.897 93.115 112.839 1.00104.56 C
ATOM 2012 N ASP A 457 160.509 96.061 111.336 1.00104.56 N
ATOM 2013 CA ASP A 457 161.007 97.194 110.571 1.00104.56 C
ATOM 2014 C ASP A 457 161.135 98.432 111.449 1.00104.56 C
ATOM 2015 O ASP A 457 162.075 99.218 111.292 1.00104.56 O
ATOM 2016 CB ASP A 457 160.083 97.468 109.387 1.00104.56 C
ATOM 2017 N LEU A 458 160.167 98.689 112.321 1.00 95.90 N
ATOM 2018 CA LEU A 458 160.196 99.935 113.104 1.00 95.90 C
ATOM 2019 C LEU A 458 160.913 99.935 114.449 1.00 95.90 C
ATOM 2020 O LEU A 458 161.148 100.990 115.031 1.00 95.90 O
ATOM 2021 CB LEU A 458 158.771 100.457 113.303 1.00 95.90 C
ATOM 2022 CG LEU A 458 158.060 100.928 112.037 1.00 95.90 C
ATOM 2023 CD1 LEU A 458 156.662 101.425 112.365 1.00 95.90 C
ATOM 2024 CD2 LEU A 458 158.871 102.018 111.357 1.00 95.90 C
ATOM 2025 N GLN A 459 161.276 98.760 114.928 1.00 90.48 N
ATOM 2026 CA GLN A 459 161.921 98.611 116.241 1.00 90.48 C
ATOM 2027 C GLN A 459 163.146 99.487 116.506 1.00 90.48 C
ATOM 2028 O GLN A 459 163.203 100.208 117.514 1.00 90.48 O
ATOM 2029 CB GLN A 459 162.315 97.146 116.439 1.00 30.00 C
ATOM 2030 CG GLN A 459 161.137 96.189 116.507 1.00 30.00 C
ATOM 2031 CD GLN A 459 161.566 94.742 116.630 1.00 30.00 C
ATOM 2032 OE1 GLN A 459 162.669 94.378 116.222 1.00 30.00 O
ATOM 2033 NE2 GLN A 459 160.696 93.911 117.196 1.00 30.00 N
ATOM 2034 N ASP A 460 164.126 99.426 115.605 1.00 81.09 N
ATOM 2035 CA ASP A 460 165.381 100.137 115.816 1.00 81.09 C
ATOM 2036 C ASP A 460 165.195 101.643 115.705 1.00 81.09 C
ATOM 2037 O ASP A 460 165.866 102.406 116.404 1.00 81.09 O
ATOM 2038 CB ASP A 460 166.432 99.651 114.821 1.00 81.09 C
ATOM 2039 N VAL A 461 164.284 102.082 114.838 1.00 78.89 N
ATOM 2040 CA VAL A 461 163.965 103.500 114.751 1.00 78.89 C
ATOM 2041 C VAL A 461 163.194 103.941 115.988 1.00 78.89 C
ATOM 2042 O VAL A 461 163.356 105.065 116.476 1.00 78.89 O
ATOM 2043 CB VAL A 461 163.177 103.766 113.460 1.00 78.89 C
ATOM 2044 CG1 VAL A 461 162.883 105.234 113.300 1.00 78.89 C
ATOM 2045 CG2 VAL A 461 163.944 103.235 112.273 1.00 78.89 C
ATOM 2046 N MET A 462 162.360 103.049 116.522 1.00 79.10 N
ATOM 2047 CA MET A 462 161.558 103.358 117.699 1.00 79.10 C
ATOM 2048 C MET A 462 162.432 103.569 118.921 1.00 79.10 C
ATOM 2049 O MET A 462 162.152 104.443 119.754 1.00 79.10 O
ATOM 2050 CB MET A 462 160.577 102.221 117.949 1.00 79.10 C
ATOM 2051 CG MET A 462 159.556 102.472 119.020 1.00 79.10 C
ATOM 2052 SD MET A 462 158.372 103.717 118.512 1.00 79.10 S
ATOM 2053 CE MET A 462 157.660 104.125 120.092 1.00 79.10 C
ATOM 2054 N PHE A 463 163.497 102.773 119.039 1.00 68.01 N
ATOM 2055 CA PHE A 463 164.374 102.872 120.204 1.00 68.01 C
ATOM 2056 C PHE A 463 165.081 104.220 120.271 1.00 68.01 C
ATOM 2057 O PHE A 463 165.134 104.850 121.335 1.00 68.01 O
ATOM 2058 CB PHE A 463 165.399 101.745 120.193 1.00 68.01 C
ATOM 2059 CG PHE A 463 166.348 101.801 121.341 1.00 68.01 C
ATOM 2060 CD1 PHE A 463 165.932 101.453 122.607 1.00 68.01 C
ATOM 2061 CD2 PHE A 463 167.655 102.206 121.155 1.00 68.01 C
ATOM 2062 CE1 PHE A 463 166.804 101.508 123.671 1.00 68.01 C
ATOM 2063 CE2 PHE A 463 168.530 102.265 122.214 1.00 68.01 C
ATOM 2064 CZ PHE A 463 168.105 101.914 123.472 1.00 68.01 C
ATOM 2065 N THR A 464 165.611 104.688 119.143 1.00 68.50 N
ATOM 2066 CA THR A 464 166.323 105.960 119.144 1.00 68.50 C
ATOM 2067 C THR A 464 165.368 107.127 119.338 1.00 68.50 C
ATOM 2068 O THR A 464 165.757 108.172 119.868 1.00 68.50 O
ATOM 2069 CB THR A 464 167.111 106.120 117.851 1.00 68.50 C
ATOM 2070 OG1 THR A 464 166.213 106.053 116.742 1.00 68.50 O
ATOM 2071 CG2 THR A 464 168.142 105.019 117.721 1.00 68.50 C
ATOM 2072 N ALA A 465 164.110 106.966 118.930 1.00 64.74 N
ATOM 2073 CA ALA A 465 163.124 108.006 119.197 1.00 64.74 C
ATOM 2074 C ALA A 465 162.728 108.011 120.664 1.00 64.74 C
ATOM 2075 O ALA A 465 162.303 109.037 121.203 1.00 64.74 O
ATOM 2076 CB ALA A 465 161.900 107.815 118.309 1.00 64.74 C
ATOM 2077 N LEU A 466 162.833 106.855 121.319 1.00 61.78 N
ATOM 2078 CA LEU A 466 162.704 106.829 122.772 1.00 61.78 C
ATOM 2079 C LEU A 466 163.907 107.459 123.455 1.00 61.78 C
ATOM 2080 O LEU A 466 163.798 107.925 124.594 1.00 61.78 O
ATOM 2081 CB LEU A 466 162.515 105.402 123.278 1.00 61.78 C
ATOM 2082 CG LEU A 466 161.114 104.961 123.667 1.00 61.78 C
ATOM 2083 CD1 LEU A 466 160.731 105.703 124.916 1.00 61.78 C
ATOM 2084 CD2 LEU A 466 160.141 105.268 122.575 1.00 61.78 C
ATOM 2085 N VAL A 467 165.071 107.444 122.797 1.00 66.75 N
ATOM 2086 CA VAL A 467 166.288 107.935 123.444 1.00 66.75 C
ATOM 2087 C VAL A 467 166.232 109.440 123.661 1.00 66.75 C
ATOM 2088 O VAL A 467 166.380 109.917 124.791 1.00 66.75 O
ATOM 2089 CB VAL A 467 167.536 107.532 122.641 1.00 66.75 C
ATOM 2090 CG1 VAL A 467 168.746 108.283 123.143 1.00 66.75 C
ATOM 2091 CG2 VAL A 467 167.790 106.054 122.794 1.00 66.75 C
ATOM 2092 N LYS A 468 165.997 110.214 122.608 1.00 68.74 N
ATOM 2093 CA LYS A 468 166.133 111.662 122.702 1.00 68.74 C
ATOM 2094 C LYS A 468 164.826 112.380 122.322 1.00 68.74 C
ATOM 2095 O LYS A 468 164.723 112.984 121.254 1.00 68.74 O
ATOM 2096 CB LYS A 468 167.323 112.106 121.846 1.00 68.74 C
ATOM 2097 CG LYS A 468 167.360 111.468 120.456 1.00 68.74 C
ATOM 2098 CD LYS A 468 168.524 111.963 119.640 1.00 68.74 C
ATOM 2099 CE LYS A 468 168.521 111.334 118.260 1.00 68.74 C
ATOM 2100 NZ LYS A 468 169.658 111.821 117.431 1.00 68.74 N
ATOM 2101 N ASP A 469 163.876 112.356 123.272 1.00 66.85 N
ATOM 2102 CA ASP A 469 162.739 113.286 123.437 1.00 66.85 C
ATOM 2103 C ASP A 469 162.021 113.676 122.142 1.00 66.85 C
ATOM 2104 O ASP A 469 161.974 114.845 121.765 1.00 66.85 O
ATOM 2105 CB ASP A 469 163.194 114.538 124.185 1.00 66.85 C
ATOM 2106 N ARG A 470 161.455 112.697 121.447 1.00 66.29 N
ATOM 2107 CA ARG A 470 160.702 112.958 120.220 1.00 66.29 C
ATOM 2108 C ARG A 470 159.273 112.458 120.380 1.00 66.29 C
ATOM 2109 O ARG A 470 158.888 111.445 119.786 1.00 66.29 O
ATOM 2110 CB ARG A 470 161.385 112.312 119.016 1.00 66.29 C
ATOM 2111 CG ARG A 470 162.719 112.933 118.685 1.00 66.29 C
ATOM 2112 CD ARG A 470 162.546 114.336 118.143 1.00 66.29 C
ATOM 2113 NE ARG A 470 163.815 114.920 117.726 1.00 66.29 N
ATOM 2114 CZ ARG A 470 164.583 115.664 118.510 1.00 66.29 C
ATOM 2115 NH1 ARG A 470 164.210 115.921 119.754 1.00 66.29 N
ATOM 2116 NH2 ARG A 470 165.722 116.157 118.051 1.00 66.29 N
ATOM 2117 N PRO A 471 158.446 113.175 121.146 1.00 59.39 N
ATOM 2118 CA PRO A 471 157.160 112.597 121.574 1.00 59.39 C
ATOM 2119 C PRO A 471 156.113 112.501 120.475 1.00 59.39 C
ATOM 2120 O PRO A 471 155.389 111.496 120.404 1.00 59.39 O
ATOM 2121 CB PRO A 471 156.726 113.545 122.695 1.00 59.39 C
ATOM 2122 CG PRO A 471 157.354 114.839 122.340 1.00 59.39 C
ATOM 2123 CD PRO A 471 158.655 114.526 121.691 1.00 59.39 C
ATOM 2124 N LYS A 472 156.004 113.524 119.622 1.00 64.17 N
ATOM 2125 CA LYS A 472 155.134 113.442 118.454 1.00 64.17 C
ATOM 2126 C LYS A 472 155.580 112.321 117.538 1.00 64.17 C
ATOM 2127 O LYS A 472 154.761 111.600 116.947 1.00 64.17 O
ATOM 2128 CB LYS A 472 155.161 114.765 117.702 1.00 64.17 C
ATOM 2129 CG LYS A 472 154.575 115.919 118.462 1.00 64.17 C
ATOM 2130 CD LYS A 472 154.662 117.181 117.637 1.00 64.17 C
ATOM 2131 CE LYS A 472 154.153 118.373 118.414 1.00 64.17 C
ATOM 2132 NZ LYS A 472 154.269 119.636 117.643 1.00 64.17 N
ATOM 2133 N PHE A 473 156.884 112.115 117.472 1.00 70.36 N
ATOM 2134 CA PHE A 473 157.425 111.056 116.659 1.00 70.36 C
ATOM 2135 C PHE A 473 157.343 109.714 117.371 1.00 70.36 C
ATOM 2136 O PHE A 473 157.785 108.714 116.818 1.00 70.36 O
ATOM 2137 CB PHE A 473 158.862 111.403 116.296 1.00 70.36 C
ATOM 2138 CG PHE A 473 159.290 110.884 114.967 1.00 70.36 C
ATOM 2139 CD1 PHE A 473 158.942 111.569 113.816 1.00 70.36 C
ATOM 2140 CD2 PHE A 473 160.034 109.726 114.856 1.00 70.36 C
ATOM 2141 CE1 PHE A 473 159.329 111.110 112.588 1.00 70.36 C
ATOM 2142 CE2 PHE A 473 160.429 109.264 113.622 1.00 70.36 C
ATOM 2143 CZ PHE A 473 160.073 109.954 112.489 1.00 70.36 C
ATOM 2144 N VAL A 474 156.808 109.676 118.594 1.00 62.84 N
ATOM 2145 CA VAL A 474 156.364 108.420 119.184 1.00 62.84 C
ATOM 2146 C VAL A 474 154.885 108.184 118.903 1.00 62.84 C
ATOM 2147 O VAL A 474 154.493 107.041 118.629 1.00 62.84 O
ATOM 2148 CB VAL A 474 156.673 108.412 120.691 1.00 62.84 C
ATOM 2149 CG1 VAL A 474 156.082 107.211 121.389 1.00 62.84 C
ATOM 2150 CG2 VAL A 474 158.155 108.406 120.904 1.00 62.84 C
ATOM 2151 N ARG A 475 154.063 109.249 118.933 1.00 66.40 N
ATOM 2152 CA ARG A 475 152.647 109.148 118.555 1.00 66.40 C
ATOM 2153 C ARG A 475 152.473 108.625 117.139 1.00 66.40 C
ATOM 2154 O ARG A 475 151.518 107.886 116.860 1.00 66.40 O
ATOM 2155 CB ARG A 475 151.961 110.508 118.660 1.00 66.40 C
ATOM 2156 CG ARG A 475 151.780 111.001 120.055 1.00 66.40 C
ATOM 2157 CD ARG A 475 150.643 110.297 120.754 1.00 66.40 C
ATOM 2158 NE ARG A 475 149.354 110.748 120.254 1.00 66.40 N
ATOM 2159 CZ ARG A 475 148.688 111.774 120.771 1.00 66.40 C
ATOM 2160 NH1 ARG A 475 149.193 112.432 121.803 1.00 66.40 N1+
ATOM 2161 NH2 ARG A 475 147.517 112.135 120.267 1.00 66.40 N
ATOM 2162 N LEU A 476 153.389 109.005 116.241 1.00 79.48 N
ATOM 2163 CA LEU A 476 153.298 108.571 114.850 1.00 79.48 C
ATOM 2164 C LEU A 476 153.400 107.055 114.713 1.00 79.48 C
ATOM 2165 O LEU A 476 152.624 106.444 113.970 1.00 79.48 O
ATOM 2166 CB LEU A 476 154.380 109.239 114.013 1.00 79.48 C
ATOM 2167 CG LEU A 476 154.265 108.909 112.531 1.00 79.48 C
ATOM 2168 CD1 LEU A 476 152.956 109.453 112.013 1.00 79.48 C
ATOM 2169 CD2 LEU A 476 155.426 109.468 111.750 1.00 79.48 C
ATOM 2170 N PHE A 477 154.312 106.420 115.451 1.00 82.08 N
ATOM 2171 CA PHE A 477 154.451 104.976 115.294 1.00 82.08 C
ATOM 2172 C PHE A 477 153.320 104.210 115.962 1.00 82.08 C
ATOM 2173 O PHE A 477 152.948 103.132 115.487 1.00 82.08 O
ATOM 2174 CB PHE A 477 155.784 104.488 115.835 1.00 82.08 C
ATOM 2175 CG PHE A 477 156.956 104.968 115.058 1.00 82.08 C
ATOM 2176 CD1 PHE A 477 157.236 104.449 113.808 1.00 82.08 C
ATOM 2177 CD2 PHE A 477 157.804 105.903 115.591 1.00 82.08 C
ATOM 2178 CE1 PHE A 477 158.330 104.892 113.092 1.00 82.08 C
ATOM 2179 CE2 PHE A 477 158.896 106.352 114.886 1.00 82.08 C
ATOM 2180 CZ PHE A 477 159.163 105.847 113.639 1.00 82.08 C
ATOM 2181 N LEU A 478 152.761 104.734 117.052 1.00 77.73 N
ATOM 2182 CA LEU A 478 151.616 104.062 117.657 1.00 77.73 C
ATOM 2183 C LEU A 478 150.380 104.177 116.779 1.00 77.73 C
ATOM 2184 O LEU A 478 149.572 103.245 116.720 1.00 77.73 O
ATOM 2185 CB LEU A 478 151.339 104.613 119.048 1.00 77.73 C
ATOM 2186 CG LEU A 478 152.390 104.216 120.075 1.00 77.73 C
ATOM 2187 CD1 LEU A 478 152.076 104.835 121.418 1.00 77.73 C
ATOM 2188 CD2 LEU A 478 152.463 102.710 120.182 1.00 77.73 C
ATOM 2189 N GLU A 479 150.219 105.299 116.073 1.00 88.95 N
ATOM 2190 CA GLU A 479 149.102 105.389 115.139 1.00 88.95 C
ATOM 2191 C GLU A 479 149.359 104.576 113.876 1.00 88.95 C
ATOM 2192 O GLU A 479 148.414 104.142 113.210 1.00 88.95 O
ATOM 2193 CB GLU A 479 148.802 106.844 114.797 1.00 88.95 C
ATOM 2194 CG GLU A 479 148.198 107.598 115.957 1.00 88.95 C
ATOM 2195 CD GLU A 479 147.815 109.007 115.596 1.00 88.95 C
ATOM 2196 OE1 GLU A 479 148.131 109.430 114.468 1.00 88.95 O
ATOM 2197 OE2 GLU A 479 147.189 109.688 116.435 1.00 88.95 O
ATOM 2198 N ASN A 480 150.628 104.345 113.563 1.00 91.42 N
ATOM 2199 CA ASN A 480 150.977 103.563 112.388 1.00 91.42 C
ATOM 2200 C ASN A 480 151.035 102.076 112.702 1.00 91.42 C
ATOM 2201 O ASN A 480 151.294 101.254 111.826 1.00 91.42 O
ATOM 2202 CB ASN A 480 152.285 104.053 111.775 1.00 91.42 C
ATOM 2203 CG ASN A 480 152.106 105.336 110.991 1.00 91.42 C
ATOM 2204 OD1 ASN A 480 151.099 105.518 110.308 1.00 91.42 O
ATOM 2205 ND2 ASN A 480 153.078 106.234 111.089 1.00 91.42 N
ATOM 2206 N GLY A 481 150.798 101.741 113.965 1.00 86.81 N
ATOM 2207 CA GLY A 481 150.779 100.356 114.393 1.00 86.81 C
ATOM 2208 C GLY A 481 152.066 99.754 114.920 1.00 86.81 C
ATOM 2209 O GLY A 481 153.029 99.567 114.181 1.00 86.81 O
ATOM 2210 N LEU A 482 152.067 99.445 116.212 1.00 83.42 N
ATOM 2211 CA LEU A 482 153.199 98.819 116.870 1.00 83.42 C
ATOM 2212 C LEU A 482 152.726 98.205 118.176 1.00 83.42 C
ATOM 2213 O LEU A 482 151.984 98.836 118.933 1.00 83.42 O
ATOM 2214 CB LEU A 482 154.317 99.832 117.119 1.00 83.42 C
ATOM 2215 CG LEU A 482 155.563 99.352 117.848 1.00 83.42 C
ATOM 2216 CD1 LEU A 482 156.193 98.194 117.118 1.00 83.42 C
ATOM 2217 CD2 LEU A 482 156.532 100.503 117.939 1.00 83.42 C
ATOM 2218 N ASN A 483 153.155 96.977 118.434 1.00 78.64 N
ATOM 2219 CA ASN A 483 152.747 96.243 119.624 1.00 78.64 C
ATOM 2220 C ASN A 483 153.708 96.583 120.752 1.00 78.64 C
ATOM 2221 O ASN A 483 154.798 96.010 120.836 1.00 78.64 O
ATOM 2222 CB ASN A 483 152.731 94.743 119.350 1.00 78.64 C
ATOM 2223 CG ASN A 483 151.652 94.345 118.369 1.00 78.64 C
ATOM 2224 OD1 ASN A 483 150.526 94.838 118.435 1.00 78.64 O
ATOM 2225 ND2 ASN A 483 151.991 93.453 117.446 1.00 78.64 N
ATOM 2226 N LEU A 484 153.293 97.508 121.617 1.00 68.25 N
ATOM 2227 CA LEU A 484 154.230 98.127 122.546 1.00 68.25 C
ATOM 2228 C LEU A 484 154.614 97.175 123.669 1.00 68.25 C
ATOM 2229 O LEU A 484 155.743 97.220 124.168 1.00 68.25 O
ATOM 2230 CB LEU A 484 153.630 99.416 123.098 1.00 68.25 C
ATOM 2231 CG LEU A 484 154.558 100.287 123.939 1.00 68.25 C
ATOM 2232 CD1 LEU A 484 155.752 100.677 123.116 1.00 68.25 C
ATOM 2233 CD2 LEU A 484 153.834 101.522 124.381 1.00 68.25 C
ATOM 2234 N ARG A 485 153.701 96.292 124.068 1.00 72.37 N
ATOM 2235 CA ARG A 485 154.046 95.286 125.065 1.00 72.37 C
ATOM 2236 C ARG A 485 154.959 94.224 124.463 1.00 72.37 C
ATOM 2237 O ARG A 485 155.794 93.637 125.159 1.00 72.37 O
ATOM 2238 CB ARG A 485 152.775 94.662 125.636 1.00 72.37 C
ATOM 2239 CG ARG A 485 153.001 93.750 126.819 1.00 72.37 C
ATOM 2240 CD ARG A 485 151.692 93.219 127.356 1.00 72.37 C
ATOM 2241 NE ARG A 485 151.909 92.261 128.433 1.00 72.37 N
ATOM 2242 CZ ARG A 485 152.028 92.594 129.712 1.00 72.37 C
ATOM 2243 NH1 ARG A 485 151.940 93.864 130.075 1.00 72.37 N
ATOM 2244 NH2 ARG A 485 152.226 91.658 130.630 1.00 72.37 N
ATOM 2245 N LYS A 486 154.825 93.980 123.159 1.00 73.93 N
ATOM 2246 CA LYS A 486 155.704 93.028 122.488 1.00 73.93 C
ATOM 2247 C LYS A 486 157.088 93.628 122.271 1.00 73.93 C
ATOM 2248 O LYS A 486 158.080 92.903 122.135 1.00 73.93 O
ATOM 2249 CB LYS A 486 155.068 92.604 121.164 1.00 73.93 C
ATOM 2250 CG LYS A 486 155.743 91.462 120.429 1.00 73.93 C
ATOM 2251 CD LYS A 486 154.961 91.093 119.182 1.00 73.93 C
ATOM 2252 CE LYS A 486 155.631 89.967 118.423 1.00 73.93 C
ATOM 2253 NZ LYS A 486 154.870 89.616 117.196 1.00 73.93 N
ATOM 2254 N PHE A 487 157.175 94.957 122.263 1.00 71.78 N
ATOM 2255 CA PHE A 487 158.448 95.625 122.024 1.00 71.78 C
ATOM 2256 C PHE A 487 159.371 95.529 123.231 1.00 71.78 C
ATOM 2257 O PHE A 487 160.534 95.134 123.099 1.00 71.78 O
ATOM 2258 CB PHE A 487 158.188 97.084 121.664 1.00 71.78 C
ATOM 2259 CG PHE A 487 159.426 97.884 121.435 1.00 71.78 C
ATOM 2260 CD1 PHE A 487 160.152 97.734 120.272 1.00 71.78 C
ATOM 2261 CD2 PHE A 487 159.847 98.807 122.374 1.00 71.78 C
ATOM 2262 CE1 PHE A 487 161.284 98.478 120.057 1.00 71.78 C
ATOM 2263 CE2 PHE A 487 160.976 99.552 122.167 1.00 71.78 C
ATOM 2264 CZ PHE A 487 161.696 99.390 121.008 1.00 71.78 C
ATOM 2265 N LEU A 488 158.874 95.892 124.409 1.00 62.95 N
ATOM 2266 CA LEU A 488 159.727 96.045 125.580 1.00 62.95 C
ATOM 2267 C LEU A 488 160.186 94.695 126.116 1.00 62.95 C
ATOM 2268 O LEU A 488 159.386 93.913 126.632 1.00 62.95 O
ATOM 2269 CB LEU A 488 158.981 96.804 126.670 1.00 62.95 C
ATOM 2270 CG LEU A 488 158.566 98.222 126.306 1.00 62.95 C
ATOM 2271 CD1 LEU A 488 157.766 98.824 127.432 1.00 62.95 C
ATOM 2272 CD2 LEU A 488 159.773 99.060 126.002 1.00 62.95 C
ATOM 2273 N THR A 489 161.481 94.431 126.003 1.00 66.09 N
ATOM 2274 CA THR A 489 162.097 93.245 126.573 1.00 66.09 C
ATOM 2275 C THR A 489 163.096 93.702 127.619 1.00 66.09 C
ATOM 2276 O THR A 489 163.531 94.856 127.593 1.00 66.09 O
ATOM 2277 CB THR A 489 162.808 92.416 125.512 1.00 66.09 C
ATOM 2278 OG1 THR A 489 163.906 93.171 124.990 1.00 66.09 O
ATOM 2279 CG2 THR A 489 161.859 92.091 124.381 1.00 66.09 C
ATOM 2280 N THR A 490 163.470 92.796 128.524 1.00 66.36 N
ATOM 2281 CA THR A 490 164.367 93.121 129.630 1.00 66.36 C
ATOM 2282 C THR A 490 165.767 93.519 129.177 1.00 66.36 C
ATOM 2283 O THR A 490 166.496 94.178 129.924 1.00 66.36 O
ATOM 2284 CB THR A 490 164.459 91.945 130.593 1.00 66.36 C
ATOM 2285 OG1 THR A 490 164.964 90.804 129.895 1.00 66.36 O
ATOM 2286 CG2 THR A 490 163.095 91.631 131.150 1.00 66.36 C
ATOM 2287 N GLU A 491 166.160 93.113 127.968 1.00 67.43 N
ATOM 2288 CA GLU A 491 167.391 93.630 127.380 1.00 67.43 C
ATOM 2289 C GLU A 491 167.270 95.119 127.084 1.00 67.43 C
ATOM 2290 O GLU A 491 168.190 95.896 127.369 1.00 67.43 O
ATOM 2291 CB GLU A 491 167.728 92.859 126.105 1.00 67.43 C
ATOM 2292 N VAL A 492 166.126 95.532 126.533 1.00 61.52 N
ATOM 2293 CA VAL A 492 165.922 96.925 126.151 1.00 61.52 C
ATOM 2294 C VAL A 492 165.841 97.814 127.382 1.00 61.52 C
ATOM 2295 O VAL A 492 166.374 98.928 127.395 1.00 61.52 O
ATOM 2296 CB VAL A 492 164.665 97.042 125.274 1.00 61.52 C
ATOM 2297 CG1 VAL A 492 164.372 98.482 124.909 1.00 61.52 C
ATOM 2298 CG2 VAL A 492 164.847 96.219 124.030 1.00 61.52 C
ATOM 2299 N LEU A 493 165.230 97.320 128.458 1.00 61.18 N
ATOM 2300 CA LEU A 493 165.115 98.144 129.654 1.00 61.18 C
ATOM 2301 C LEU A 493 166.443 98.256 130.390 1.00 61.18 C
ATOM 2302 O LEU A 493 166.723 99.285 131.015 1.00 61.18 O
ATOM 2303 CB LEU A 493 164.038 97.592 130.572 1.00 61.18 C
ATOM 2304 CG LEU A 493 162.642 97.717 129.990 1.00 61.18 C
ATOM 2305 CD1 LEU A 493 161.663 97.080 130.933 1.00 61.18 C
ATOM 2306 CD2 LEU A 493 162.306 99.169 129.758 1.00 61.18 C
ATOM 2307 N ARG A 494 167.282 97.222 130.319 1.00 67.49 N
ATOM 2308 CA ARG A 494 168.637 97.365 130.838 1.00 67.49 C
ATOM 2309 C ARG A 494 169.442 98.354 130.006 1.00 67.49 C
ATOM 2310 O ARG A 494 170.148 99.208 130.559 1.00 67.49 O
ATOM 2311 CB ARG A 494 169.333 96.008 130.893 1.00 67.49 C
ATOM 2312 CG ARG A 494 168.854 95.138 132.032 1.00 67.49 C
ATOM 2313 CD ARG A 494 169.545 93.796 132.030 1.00 67.49 C
ATOM 2314 NE ARG A 494 169.109 92.984 133.159 1.00 67.49 N
ATOM 2315 CZ ARG A 494 169.463 91.720 133.353 1.00 67.49 C
ATOM 2316 NH1 ARG A 494 170.254 91.111 132.483 1.00 67.49 N
ATOM 2317 NH2 ARG A 494 169.016 91.062 134.412 1.00 67.49 N
ATOM 2318 N GLU A 495 169.298 98.294 128.678 1.00 58.70 N
ATOM 2319 CA GLU A 495 169.990 99.243 127.813 1.00 58.70 C
ATOM 2320 C GLU A 495 169.457 100.657 127.994 1.00 58.70 C
ATOM 2321 O GLU A 495 170.139 101.633 127.667 1.00 58.70 O
ATOM 2322 CB GLU A 495 169.863 98.811 126.354 1.00 58.70 C
ATOM 2323 N LEU A 496 168.235 100.788 128.506 1.00 55.20 N
ATOM 2324 CA LEU A 496 167.664 102.110 128.708 1.00 55.20 C
ATOM 2325 C LEU A 496 168.058 102.687 130.062 1.00 55.20 C
ATOM 2326 O LEU A 496 168.443 103.858 130.154 1.00 55.20 O
ATOM 2327 CB LEU A 496 166.148 102.046 128.578 1.00 55.20 C
ATOM 2328 CG LEU A 496 165.482 103.414 128.583 1.00 55.20 C
ATOM 2329 CD1 LEU A 496 165.922 104.181 127.369 1.00 55.20 C
ATOM 2330 CD2 LEU A 496 163.996 103.269 128.589 1.00 55.20 C
ATOM 2331 N TYR A 497 167.973 101.884 131.126 1.00 59.15 N
ATOM 2332 CA TYR A 497 168.279 102.393 132.461 1.00 59.15 C
ATOM 2333 C TYR A 497 169.776 102.561 132.693 1.00 59.15 C
ATOM 2334 O TYR A 497 170.188 103.481 133.406 1.00 59.15 O
ATOM 2335 CB TYR A 497 167.689 101.479 133.532 1.00 59.15 C
ATOM 2336 CG TYR A 497 166.267 101.787 133.914 1.00 59.15 C
ATOM 2337 CD1 TYR A 497 165.995 102.748 134.869 1.00 59.15 C
ATOM 2338 CD2 TYR A 497 165.204 101.124 133.335 1.00 59.15 C
ATOM 2339 CE1 TYR A 497 164.707 103.038 135.238 1.00 59.15 C
ATOM 2340 CE2 TYR A 497 163.906 101.413 133.703 1.00 59.15 C
ATOM 2341 CZ TYR A 497 163.671 102.375 134.652 1.00 59.15 C
ATOM 2342 OH TYR A 497 162.388 102.675 135.025 1.00 59.15 O
ATOM 2343 N THR A 498 170.611 101.678 132.142 1.00 60.49 N
ATOM 2344 CA THR A 498 172.035 101.792 132.445 1.00 60.49 C
ATOM 2345 C THR A 498 172.694 102.904 131.644 1.00 60.49 C
ATOM 2346 O THR A 498 173.614 103.566 132.134 1.00 60.49 O
ATOM 2347 CB THR A 498 172.744 100.471 132.190 1.00 60.49 C
ATOM 2348 OG1 THR A 498 172.542 100.080 130.827 1.00 60.49 O
ATOM 2349 CG2 THR A 498 172.215 99.402 133.119 1.00 60.49 C
ATOM 2350 N ASN A 499 172.240 103.133 130.417 1.00 60.84 N
ATOM 2351 CA ASN A 499 172.852 104.134 129.558 1.00 60.84 C
ATOM 2352 C ASN A 499 172.167 105.489 129.620 1.00 60.84 C
ATOM 2353 O ASN A 499 172.808 106.486 129.956 1.00 60.84 O
ATOM 2354 CB ASN A 499 172.873 103.639 128.112 1.00 60.84 C
ATOM 2355 CG ASN A 499 173.848 102.514 127.909 1.00 60.84 C
ATOM 2356 OD1 ASN A 499 174.938 102.521 128.474 1.00 60.84 O
ATOM 2357 ND2 ASN A 499 173.471 101.542 127.094 1.00 60.84 N
ATOM 2358 N ASN A 500 170.873 105.554 129.311 1.00 57.11 N
ATOM 2359 CA ASN A 500 170.208 106.819 129.033 1.00 57.11 C
ATOM 2360 C ASN A 500 169.542 107.431 130.254 1.00 57.11 C
ATOM 2361 O ASN A 500 168.580 108.192 130.111 1.00 57.11 O
ATOM 2362 CB ASN A 500 169.189 106.629 127.916 1.00 57.11 C
ATOM 2363 CG ASN A 500 169.837 106.300 126.608 1.00 57.11 C
ATOM 2364 OD1 ASN A 500 170.869 106.863 126.264 1.00 57.11 O
ATOM 2365 ND2 ASN A 500 169.246 105.379 125.867 1.00 57.11 N
ATOM 2366 N PHE A 501 170.023 107.133 131.449 1.00 49.60 N
ATOM 2367 CA PHE A 501 169.466 107.690 132.671 1.00 49.60 C
ATOM 2368 C PHE A 501 170.538 108.569 133.295 1.00 49.60 C
ATOM 2369 O PHE A 501 171.596 108.070 133.691 1.00 49.60 O
ATOM 2370 CB PHE A 501 169.034 106.562 133.603 1.00 49.60 C
ATOM 2371 CG PHE A 501 168.236 107.004 134.784 1.00 49.60 C
ATOM 2372 CD1 PHE A 501 166.926 107.399 134.632 1.00 49.60 C
ATOM 2373 CD2 PHE A 501 168.774 106.968 136.053 1.00 49.60 C
ATOM 2374 CE1 PHE A 501 166.181 107.789 135.719 1.00 49.60 C
ATOM 2375 CE2 PHE A 501 168.031 107.352 137.144 1.00 49.60 C
ATOM 2376 CZ PHE A 501 166.733 107.763 136.974 1.00 49.60 C
ATOM 2377 N SER A 502 170.273 109.874 133.359 1.00 54.36 N
ATOM 2378 CA SER A 502 171.294 110.843 133.741 1.00 54.36 C
ATOM 2379 C SER A 502 171.633 110.731 135.219 1.00 54.36 C
ATOM 2380 O SER A 502 170.746 110.670 136.072 1.00 54.36 O
ATOM 2381 CB SER A 502 170.817 112.255 133.434 1.00 54.36 C
ATOM 2382 OG SER A 502 169.732 112.590 134.270 1.00 54.36 O
ATOM 2383 N SER A 503 172.935 110.748 135.516 1.00 55.77 N
ATOM 2384 CA SER A 503 173.410 110.380 136.847 1.00 55.77 C
ATOM 2385 C SER A 503 173.084 111.444 137.884 1.00 55.77 C
ATOM 2386 O SER A 503 173.120 111.172 139.090 1.00 55.77 O
ATOM 2387 CB SER A 503 174.911 110.121 136.812 1.00 55.77 C
ATOM 2388 OG SER A 503 175.200 109.006 135.994 1.00 55.77 O
ATOM 2389 N LEU A 504 172.778 112.663 137.437 1.00 54.28 N
ATOM 2390 CA LEU A 504 172.313 113.696 138.357 1.00 54.28 C
ATOM 2391 C LEU A 504 170.975 113.321 138.981 1.00 54.28 C
ATOM 2392 O LEU A 504 170.788 113.451 140.198 1.00 54.28 O
ATOM 2393 CB LEU A 504 172.205 115.026 137.622 1.00 54.28 C
ATOM 2394 CG LEU A 504 171.719 116.178 138.488 1.00 54.28 C
ATOM 2395 CD1 LEU A 504 172.690 116.411 139.625 1.00 54.28 C
ATOM 2396 CD2 LEU A 504 171.570 117.418 137.642 1.00 54.28 C
ATOM 2397 N VAL A 505 170.044 112.825 138.161 1.00 52.09 N
ATOM 2398 CA VAL A 505 168.741 112.402 138.660 1.00 52.09 C
ATOM 2399 C VAL A 505 168.892 111.185 139.561 1.00 52.09 C
ATOM 2400 O VAL A 505 168.189 111.047 140.568 1.00 52.09 O
ATOM 2401 CB VAL A 505 167.793 112.142 137.474 1.00 52.09 C
ATOM 2402 CG1 VAL A 505 166.444 111.661 137.941 1.00 52.09 C
ATOM 2403 CG2 VAL A 505 167.625 113.401 136.664 1.00 52.09 C
ATOM 2404 N PHE A 506 169.861 110.320 139.252 1.00 54.21 N
ATOM 2405 CA PHE A 506 170.107 109.156 140.094 1.00 54.21 C
ATOM 2406 C PHE A 506 170.672 109.550 141.448 1.00 54.21 C
ATOM 2407 O PHE A 506 170.278 108.985 142.472 1.00 54.21 O
ATOM 2408 CB PHE A 506 171.049 108.182 139.399 1.00 54.21 C
ATOM 2409 CG PHE A 506 171.414 107.006 140.244 1.00 54.21 C
ATOM 2410 CD1 PHE A 506 170.480 106.029 140.521 1.00 54.21 C
ATOM 2411 CD2 PHE A 506 172.688 106.876 140.759 1.00 54.21 C
ATOM 2412 CE1 PHE A 506 170.806 104.944 141.304 1.00 54.21 C
ATOM 2413 CE2 PHE A 506 173.022 105.792 141.540 1.00 54.21 C
ATOM 2414 CZ PHE A 506 172.078 104.824 141.811 1.00 54.21 C
ATOM 2415 N LYS A 507 171.588 110.520 141.478 1.00 57.06 N
ATOM 2416 CA LYS A 507 172.102 111.002 142.757 1.00 57.06 C
ATOM 2417 C LYS A 507 171.011 111.704 143.553 1.00 57.06 C
ATOM 2418 O LYS A 507 170.948 111.588 144.785 1.00 57.06 O
ATOM 2419 CB LYS A 507 173.287 111.938 142.532 1.00 57.06 C
ATOM 2420 N ASN A 508 170.110 112.393 142.854 1.00 52.59 N
ATOM 2421 CA ASN A 508 169.028 113.089 143.535 1.00 52.59 C
ATOM 2422 C ASN A 508 168.034 112.099 144.132 1.00 52.59 C
ATOM 2423 O ASN A 508 167.563 112.281 145.262 1.00 52.59 O
ATOM 2424 CB ASN A 508 168.347 114.033 142.552 1.00 52.59 C
ATOM 2425 CG ASN A 508 167.548 115.089 143.238 1.00 52.59 C
ATOM 2426 OD1 ASN A 508 167.481 115.119 144.457 1.00 52.59 O
ATOM 2427 ND2 ASN A 508 166.956 115.982 142.462 1.00 52.59 N
ATOM 2428 N LEU A 509 167.730 111.029 143.397 1.00 53.44 N
ATOM 2429 CA LEU A 509 166.873 109.973 143.921 1.00 53.44 C
ATOM 2430 C LEU A 509 167.546 109.244 145.074 1.00 53.44 C
ATOM 2431 O LEU A 509 166.881 108.844 146.038 1.00 53.44 O
ATOM 2432 CB LEU A 509 166.518 108.999 142.803 1.00 53.44 C
ATOM 2433 CG LEU A 509 165.619 107.838 143.200 1.00 53.44 C
ATOM 2434 CD1 LEU A 509 164.293 108.363 143.665 1.00 53.44 C
ATOM 2435 CD2 LEU A 509 165.442 106.886 142.050 1.00 53.44 C
ATOM 2436 N GLN A 510 168.868 109.076 144.993 1.00 57.21 N
ATOM 2437 CA GLN A 510 169.640 108.485 146.079 1.00 57.21 C
ATOM 2438 C GLN A 510 169.525 109.302 147.355 1.00 57.21 C
ATOM 2439 O GLN A 510 169.418 108.742 148.452 1.00 57.21 O
ATOM 2440 CB GLN A 510 171.101 108.363 145.653 1.00 57.21 C
ATOM 2441 CG GLN A 510 172.024 107.820 146.712 1.00 57.21 C
ATOM 2442 CD GLN A 510 171.643 106.433 147.138 1.00 57.21 C
ATOM 2443 OE1 GLN A 510 171.083 106.234 148.214 1.00 57.21 O
ATOM 2444 NE2 GLN A 510 171.940 105.457 146.295 1.00 57.21 N
ATOM 2445 N ILE A 511 169.528 110.627 147.228 1.00 55.78 N
ATOM 2446 CA ILE A 511 169.308 111.478 148.395 1.00 55.78 C
ATOM 2447 C ILE A 511 167.874 111.348 148.901 1.00 55.78 C
ATOM 2448 O ILE A 511 167.637 111.214 150.111 1.00 55.78 O
ATOM 2449 CB ILE A 511 169.659 112.937 148.058 1.00 55.78 C
ATOM 2450 CG1 ILE A 511 171.144 113.062 147.738 1.00 55.78 C
ATOM 2451 CG2 ILE A 511 169.323 113.855 149.207 1.00 55.78 C
ATOM 2452 CD1 ILE A 511 171.527 114.397 147.153 1.00 55.78 C
ATOM 2453 N ALA A 512 166.907 111.349 147.977 1.00 55.29 N
ATOM 2454 CA ALA A 512 165.498 111.393 148.362 1.00 55.29 C
ATOM 2455 C ALA A 512 165.040 110.087 148.990 1.00 55.29 C
ATOM 2456 O ALA A 512 164.047 110.060 149.723 1.00 55.29 O
ATOM 2457 CB ALA A 512 164.634 111.719 147.150 1.00 55.29 C
ATOM 2458 N LYS A 513 165.735 108.990 148.697 1.00 59.27 N
ATOM 2459 CA LYS A 513 165.385 107.720 149.317 1.00 59.27 C
ATOM 2460 C LYS A 513 165.780 107.707 150.786 1.00 59.27 C
ATOM 2461 O LYS A 513 164.996 107.292 151.645 1.00 59.27 O
ATOM 2462 CB LYS A 513 166.064 106.578 148.565 1.00 59.27 C
ATOM 2463 CG LYS A 513 165.644 105.155 148.945 1.00 59.27 C
ATOM 2464 CD LYS A 513 166.577 104.521 149.968 1.00 59.27 C
ATOM 2465 CE LYS A 513 167.988 104.528 149.454 1.00 59.27 C
ATOM 2466 NZ LYS A 513 168.946 103.864 150.384 1.00 59.27 N1+
ATOM 2467 N ASN A 514 167.008 108.129 151.087 1.00 60.39 N
ATOM 2468 CA ASN A 514 167.504 108.055 152.456 1.00 60.39 C
ATOM 2469 C ASN A 514 166.873 109.124 153.331 1.00 60.39 C
ATOM 2470 O ASN A 514 166.560 108.875 154.499 1.00 60.39 O
ATOM 2471 CB ASN A 514 169.023 108.186 152.471 1.00 60.39 C
ATOM 2472 CG ASN A 514 169.711 106.963 151.929 1.00 60.39 C
ATOM 2473 OD1 ASN A 514 169.325 105.839 152.232 1.00 60.39 O
ATOM 2474 ND2 ASN A 514 170.733 107.171 151.113 1.00 60.39 N
ATOM 2475 N SER A 515 166.675 110.321 152.789 1.00 64.03 N
ATOM 2476 CA SER A 515 166.204 111.403 153.641 1.00 64.03 C
ATOM 2477 C SER A 515 164.700 111.336 153.887 1.00 64.03 C
ATOM 2478 O SER A 515 164.256 111.451 155.032 1.00 64.03 O
ATOM 2479 CB SER A 515 166.582 112.742 153.025 1.00 64.03 C
ATOM 2480 OG SER A 515 165.929 112.898 151.782 1.00 64.03 O
ATOM 2481 N TYR A 516 163.899 111.144 152.839 1.00 61.76 N
ATOM 2482 CA TYR A 516 162.440 111.170 152.949 1.00 61.76 C
ATOM 2483 C TYR A 516 161.889 109.827 152.464 1.00 61.76 C
ATOM 2484 O TYR A 516 161.596 109.647 151.283 1.00 61.76 O
ATOM 2485 CB TYR A 516 161.849 112.322 152.151 1.00 61.76 C
ATOM 2486 CG TYR A 516 162.340 113.677 152.579 1.00 61.76 C
ATOM 2487 CD1 TYR A 516 161.942 114.226 153.786 1.00 61.76 C
ATOM 2488 CD2 TYR A 516 163.160 114.428 151.754 1.00 61.76 C
ATOM 2489 CE1 TYR A 516 162.379 115.470 154.179 1.00 61.76 C
ATOM 2490 CE2 TYR A 516 163.602 115.673 152.133 1.00 61.76 C
ATOM 2491 CZ TYR A 516 163.206 116.190 153.347 1.00 61.76 C
ATOM 2492 OH TYR A 516 163.637 117.434 153.739 1.00 61.76 O
ATOM 2493 N ASN A 517 161.724 108.890 153.387 1.00 61.48 N
ATOM 2494 CA ASN A 517 161.440 107.520 152.993 1.00 61.48 C
ATOM 2495 C ASN A 517 159.952 107.213 153.104 1.00 61.48 C
ATOM 2496 O ASN A 517 159.257 107.726 153.982 1.00 61.48 O
ATOM 2497 CB ASN A 517 162.254 106.562 153.855 1.00 61.48 C
ATOM 2498 CG ASN A 517 162.347 105.176 153.264 1.00 61.48 C
ATOM 2499 OD1 ASN A 517 161.769 104.889 152.220 1.00 61.48 O
ATOM 2500 ND2 ASN A 517 163.102 104.308 153.922 1.00 61.48 N
ATOM 2501 N ASP A 518 159.466 106.370 152.192 1.00 56.04 N
ATOM 2502 CA ASP A 518 158.080 105.923 152.163 1.00 56.04 C
ATOM 2503 C ASP A 518 158.024 104.549 151.510 1.00 56.04 C
ATOM 2504 O ASP A 518 159.054 103.952 151.197 1.00 56.04 O
ATOM 2505 CB ASP A 518 157.177 106.905 151.411 1.00 56.04 C
ATOM 2506 N ALA A 519 156.807 104.044 151.309 1.00 54.90 N
ATOM 2507 CA ALA A 519 156.652 102.696 150.772 1.00 54.90 C
ATOM 2508 C ALA A 519 156.921 102.662 149.274 1.00 54.90 C
ATOM 2509 O ALA A 519 157.733 101.857 148.787 1.00 54.90 O
ATOM 2510 CB ALA A 519 155.251 102.172 151.077 1.00 54.90 C
ATOM 2511 N LEU A 520 156.227 103.531 148.529 1.00 46.52 N
ATOM 2512 CA LEU A 520 156.332 103.557 147.071 1.00 46.52 C
ATOM 2513 C LEU A 520 157.741 103.883 146.620 1.00 46.52 C
ATOM 2514 O LEU A 520 158.259 103.257 145.690 1.00 46.52 O
ATOM 2515 CB LEU A 520 155.358 104.577 146.496 1.00 46.52 C
ATOM 2516 CG LEU A 520 155.453 104.721 144.983 1.00 46.52 C
ATOM 2517 CD1 LEU A 520 155.102 103.419 144.325 1.00 46.52 C
ATOM 2518 CD2 LEU A 520 154.543 105.801 144.498 1.00 46.52 C
ATOM 2519 N LEU A 521 158.385 104.837 147.290 1.00 49.90 N
ATOM 2520 CA LEU A 521 159.720 105.246 146.883 1.00 49.90 C
ATOM 2521 C LEU A 521 160.732 104.138 147.140 1.00 49.90 C
ATOM 2522 O LEU A 521 161.657 103.935 146.343 1.00 49.90 O
ATOM 2523 CB LEU A 521 160.113 106.519 147.620 1.00 49.90 C
ATOM 2524 CG LEU A 521 161.354 107.151 147.020 1.00 49.90 C
ATOM 2525 CD1 LEU A 521 161.024 107.630 145.630 1.00 49.90 C
ATOM 2526 CD2 LEU A 521 161.838 108.284 147.880 1.00 49.90 C
ATOM 2527 N THR A 522 160.529 103.375 148.216 1.00 52.24 N
ATOM 2528 CA THR A 522 161.371 102.217 148.490 1.00 52.24 C
ATOM 2529 C THR A 522 161.211 101.159 147.414 1.00 52.24 C
ATOM 2530 O THR A 522 162.207 100.607 146.924 1.00 52.24 O
ATOM 2531 CB THR A 522 161.029 101.633 149.856 1.00 52.24 C
ATOM 2532 OG1 THR A 522 161.229 102.630 150.861 1.00 52.24 O
ATOM 2533 CG2 THR A 522 161.911 100.445 150.166 1.00 52.24 C
ATOM 2534 N PHE A 523 159.968 100.891 147.004 1.00 51.62 N
ATOM 2535 CA PHE A 523 159.747 99.891 145.963 1.00 51.62 C
ATOM 2536 C PHE A 523 160.319 100.337 144.622 1.00 51.62 C
ATOM 2537 O PHE A 523 160.857 99.519 143.864 1.00 51.62 O
ATOM 2538 CB PHE A 523 158.262 99.595 145.830 1.00 51.62 C
ATOM 2539 CG PHE A 523 157.958 98.557 144.813 1.00 51.62 C
ATOM 2540 CD1 PHE A 523 158.191 97.226 145.087 1.00 51.62 C
ATOM 2541 CD2 PHE A 523 157.456 98.910 143.576 1.00 51.62 C
ATOM 2542 CE1 PHE A 523 157.919 96.260 144.151 1.00 51.62 C
ATOM 2543 CE2 PHE A 523 157.185 97.953 142.634 1.00 51.62 C
ATOM 2544 CZ PHE A 523 157.417 96.623 142.920 1.00 51.62 C
ATOM 2545 N VAL A 524 160.239 101.634 144.325 1.00 51.15 N
ATOM 2546 CA VAL A 524 160.788 102.136 143.070 1.00 51.15 C
ATOM 2547 C VAL A 524 162.308 102.057 143.082 1.00 51.15 C
ATOM 2548 O VAL A 524 162.926 101.676 142.080 1.00 51.15 O
ATOM 2549 CB VAL A 524 160.276 103.560 142.792 1.00 51.15 C
ATOM 2550 CG1 VAL A 524 160.988 104.178 141.622 1.00 51.15 C
ATOM 2551 CG2 VAL A 524 158.810 103.501 142.478 1.00 51.15 C
ATOM 2552 N TRP A 525 162.931 102.346 144.228 1.00 58.40 N
ATOM 2553 CA TRP A 525 164.384 102.242 144.307 1.00 58.40 C
ATOM 2554 C TRP A 525 164.849 100.798 144.195 1.00 58.40 C
ATOM 2555 O TRP A 525 165.885 100.527 143.572 1.00 58.40 O
ATOM 2556 CB TRP A 525 164.886 102.871 145.602 1.00 58.40 C
ATOM 2557 CG TRP A 525 166.367 102.882 145.735 1.00 58.40 C
ATOM 2558 CD1 TRP A 525 167.258 103.510 144.925 1.00 58.40 C
ATOM 2559 CD2 TRP A 525 167.127 102.269 146.768 1.00 58.40 C
ATOM 2560 NE1 TRP A 525 168.535 103.305 145.375 1.00 58.40 N
ATOM 2561 CE2 TRP A 525 168.478 102.542 146.510 1.00 58.40 C
ATOM 2562 CE3 TRP A 525 166.796 101.495 147.881 1.00 58.40 C
ATOM 2563 CZ2 TRP A 525 169.499 102.073 147.327 1.00 58.40 C
ATOM 2564 CZ3 TRP A 525 167.804 101.032 148.691 1.00 58.40 C
ATOM 2565 CH2 TRP A 525 169.144 101.322 148.412 1.00 58.40 C
ATOM 2566 N LYS A 526 164.072 99.856 144.736 1.00 59.36 N
ATOM 2567 CA LYS A 526 164.436 98.452 144.577 1.00 59.36 C
ATOM 2568 C LYS A 526 164.281 97.999 143.133 1.00 59.36 C
ATOM 2569 O LYS A 526 165.106 97.226 142.636 1.00 59.36 O
ATOM 2570 CB LYS A 526 163.616 97.571 145.514 1.00 59.36 C
ATOM 2571 CG LYS A 526 163.920 97.810 146.979 1.00 59.36 C
ATOM 2572 CD LYS A 526 165.377 97.533 147.282 1.00 59.36 C
ATOM 2573 CE LYS A 526 165.678 96.049 147.216 1.00 59.36 C
ATOM 2574 NZ LYS A 526 167.096 95.754 147.568 1.00 59.36 N
ATOM 2575 N MET A 527 163.261 98.502 142.431 1.00 61.83 N
ATOM 2576 CA MET A 527 163.123 98.188 141.008 1.00 61.83 C
ATOM 2577 C MET A 527 164.271 98.766 140.188 1.00 61.83 C
ATOM 2578 O MET A 527 164.773 98.121 139.256 1.00 61.83 O
ATOM 2579 CB MET A 527 161.796 98.716 140.473 1.00 61.83 C
ATOM 2580 CG MET A 527 161.545 98.345 139.019 1.00 61.83 C
ATOM 2581 SD MET A 527 160.095 99.131 138.301 1.00 61.83 S
ATOM 2582 CE MET A 527 158.760 98.258 139.122 1.00 61.83 C
ATOM 2583 N VAL A 528 164.706 99.979 140.522 1.00 62.61 N
ATOM 2584 CA VAL A 528 165.772 100.614 139.752 1.00 62.61 C
ATOM 2585 C VAL A 528 167.098 99.908 139.990 1.00 62.61 C
ATOM 2586 O VAL A 528 167.861 99.668 139.048 1.00 62.61 O
ATOM 2587 CB VAL A 528 165.843 102.116 140.077 1.00 62.61 C
ATOM 2588 CG1 VAL A 528 167.073 102.743 139.474 1.00 62.61 C
ATOM 2589 CG2 VAL A 528 164.638 102.805 139.508 1.00 62.61 C
ATOM 2590 N GLU A 529 167.374 99.505 141.230 1.00 69.39 N
ATOM 2591 CA GLU A 529 168.618 98.775 141.456 1.00 69.39 C
ATOM 2592 C GLU A 529 168.523 97.333 140.983 1.00 69.39 C
ATOM 2593 O GLU A 529 169.550 96.675 140.793 1.00 69.39 O
ATOM 2594 CB GLU A 529 169.047 98.842 142.914 1.00 69.39 C
ATOM 2595 CG GLU A 529 169.684 100.164 143.235 1.00 69.39 C
ATOM 2596 CD GLU A 529 170.392 100.163 144.557 1.00 69.39 C
ATOM 2597 OE1 GLU A 529 170.230 99.191 145.321 1.00 69.39 O
ATOM 2598 OE2 GLU A 529 171.150 101.121 144.807 1.00 69.39 O
ATOM 2599 N ASP A 530 167.312 96.817 140.781 1.00 69.08 N
ATOM 2600 CA ASP A 530 167.203 95.522 140.123 1.00 69.08 C
ATOM 2601 C ASP A 530 167.521 95.640 138.640 1.00 69.08 C
ATOM 2602 O ASP A 530 168.220 94.792 138.078 1.00 69.08 O
ATOM 2603 CB ASP A 530 165.808 94.939 140.330 1.00 69.08 C
ATOM 2604 N PHE A 531 167.030 96.695 137.992 1.00 68.61 N
ATOM 2605 CA PHE A 531 167.331 96.881 136.575 1.00 68.61 C
ATOM 2606 C PHE A 531 168.753 97.360 136.332 1.00 68.61 C
ATOM 2607 O PHE A 531 169.270 97.200 135.222 1.00 68.61 O
ATOM 2608 CB PHE A 531 166.372 97.873 135.936 1.00 68.61 C
ATOM 2609 CG PHE A 531 165.098 97.271 135.457 1.00 68.61 C
ATOM 2610 CD1 PHE A 531 165.063 96.623 134.236 1.00 68.61 C
ATOM 2611 CD2 PHE A 531 163.932 97.383 136.186 1.00 68.61 C
ATOM 2612 CE1 PHE A 531 163.897 96.074 133.763 1.00 68.61 C
ATOM 2613 CE2 PHE A 531 162.756 96.836 135.705 1.00 68.61 C
ATOM 2614 CZ PHE A 531 162.738 96.195 134.497 1.00 68.61 C
ATOM 2615 N ARG A 532 169.390 97.962 137.336 1.00 66.79 N
ATOM 2616 CA ARG A 532 170.629 98.694 137.095 1.00 66.79 C
ATOM 2617 C ARG A 532 171.807 97.752 136.858 1.00 66.79 C
ATOM 2618 O ARG A 532 172.726 98.079 136.100 1.00 66.79 O
ATOM 2619 CB ARG A 532 170.888 99.648 138.265 1.00 66.79 C
ATOM 2620 CG ARG A 532 172.147 100.476 138.136 1.00 66.79 C
ATOM 2621 CD ARG A 532 172.127 101.350 136.894 1.00 66.79 C
ATOM 2622 NE ARG A 532 171.186 102.456 136.976 1.00 66.79 N
ATOM 2623 CZ ARG A 532 171.483 103.629 137.522 1.00 66.79 C
ATOM 2624 NH1 ARG A 532 172.683 103.837 138.037 1.00 66.79 N1+
ATOM 2625 NH2 ARG A 532 170.581 104.594 137.557 1.00 66.79 N
ATOM 2626 N ARG A 533 171.777 96.566 137.453 1.00 81.11 N
ATOM 2627 CA ARG A 533 172.852 95.596 137.269 1.00 81.11 C
ATOM 2628 C ARG A 533 172.845 95.010 135.862 1.00 81.11 C
ATOM 2629 O ARG A 533 173.039 93.811 135.679 1.00 81.11 O
ATOM 2630 CB ARG A 533 172.729 94.478 138.294 1.00 81.11 C
ATOM 2631 CG ARG A 533 172.902 94.950 139.708 1.00 81.11 C
ATOM 2632 CD ARG A 533 172.631 93.820 140.667 1.00 81.11 C
ATOM 2633 NE ARG A 533 172.698 94.260 142.053 1.00 81.11 N
ATOM 2634 CZ ARG A 533 172.391 93.492 143.093 1.00 81.11 C
ATOM 2635 NH1 ARG A 533 171.990 92.244 142.901 1.00 81.11 N
ATOM 2636 NH2 ARG A 533 172.481 93.973 144.324 1.00 81.11 N
ATOM 2637 N PRO A 555 160.082 88.122 134.006 1.00 96.04 N
ATOM 2638 CA PRO A 555 161.154 87.396 134.693 1.00 96.04 C
ATOM 2639 C PRO A 555 161.615 88.080 135.980 1.00 96.04 C
ATOM 2640 O PRO A 555 161.471 87.489 137.049 1.00 96.04 O
ATOM 2641 CB PRO A 555 162.273 87.347 133.647 1.00 96.04 C
ATOM 2642 CG PRO A 555 161.972 88.447 132.697 1.00 96.04 C
ATOM 2643 CD PRO A 555 160.485 88.567 132.663 1.00 96.04 C
ATOM 2644 N ILE A 556 162.162 89.294 135.888 1.00 86.43 N
ATOM 2645 CA ILE A 556 162.491 90.032 137.101 1.00 86.43 C
ATOM 2646 C ILE A 556 161.343 90.957 137.483 1.00 86.43 C
ATOM 2647 O ILE A 556 161.174 91.304 138.657 1.00 86.43 O
ATOM 2648 CB ILE A 556 163.834 90.774 136.938 1.00 86.43 C
ATOM 2649 CG1 ILE A 556 163.835 91.731 135.745 1.00 86.43 C
ATOM 2650 CG2 ILE A 556 164.973 89.781 136.779 1.00 86.43 C
ATOM 2651 CD1 ILE A 556 163.571 93.155 136.100 1.00 86.43 C
ATOM 2652 N THR A 557 160.546 91.376 136.501 1.00 77.11 N
ATOM 2653 CA THR A 557 159.279 92.039 136.772 1.00 77.11 C
ATOM 2654 C THR A 557 158.315 91.767 135.628 1.00 77.11 C
ATOM 2655 O THR A 557 158.715 91.507 134.490 1.00 77.11 O
ATOM 2656 CB THR A 557 159.436 93.552 136.981 1.00 77.11 C
ATOM 2657 OG1 THR A 557 158.168 94.115 137.336 1.00 77.11 O
ATOM 2658 CG2 THR A 557 159.941 94.235 135.729 1.00 77.11 C
ATOM 2659 N ARG A 558 157.038 91.778 135.969 1.00 69.36 N
ATOM 2660 CA ARG A 558 155.968 91.932 135.007 1.00 69.36 C
ATOM 2661 C ARG A 558 155.563 93.403 135.029 1.00 69.36 C
ATOM 2662 O ARG A 558 156.214 94.216 135.696 1.00 69.36 O
ATOM 2663 CB ARG A 558 154.847 90.940 135.328 1.00 69.36 C
ATOM 2664 CG ARG A 558 154.286 91.049 136.733 1.00 69.36 C
ATOM 2665 CD ARG A 558 153.351 89.886 137.060 1.00 69.36 C
ATOM 2666 NE ARG A 558 152.136 89.903 136.256 1.00 69.36 N
ATOM 2667 CZ ARG A 558 151.291 88.884 136.165 1.00 69.36 C
ATOM 2668 NH1 ARG A 558 151.531 87.769 136.834 1.00 69.36 N
ATOM 2669 NH2 ARG A 558 150.205 88.982 135.412 1.00 69.36 N
ATOM 2670 N HIS A 559 154.494 93.740 134.309 1.00 60.32 N
ATOM 2671 CA HIS A 559 154.106 95.118 134.016 1.00 60.32 C
ATOM 2672 C HIS A 559 155.243 95.949 133.426 1.00 60.32 C
ATOM 2673 O HIS A 559 155.837 96.787 134.135 1.00 60.32 O
ATOM 2674 CB HIS A 559 153.530 95.803 135.248 1.00 60.32 C
ATOM 2675 CG HIS A 559 152.287 95.173 135.785 1.00 60.32 C
ATOM 2676 ND1 HIS A 559 151.067 95.283 135.156 1.00 60.32 N
ATOM 2677 CD2 HIS A 559 152.063 94.475 136.923 1.00 60.32 C
ATOM 2678 CE1 HIS A 559 150.148 94.659 135.870 1.00 60.32 C
ATOM 2679 NE2 HIS A 559 150.727 94.161 136.947 1.00 60.32 N
ATOM 2680 N PRO A 560 155.611 95.745 132.161 1.00 53.22 N
ATOM 2681 CA PRO A 560 156.682 96.573 131.585 1.00 53.22 C
ATOM 2682 C PRO A 560 156.270 98.007 131.322 1.00 53.22 C
ATOM 2683 O PRO A 560 157.122 98.911 131.329 1.00 53.22 O
ATOM 2684 CB PRO A 560 157.013 95.850 130.277 1.00 53.22 C
ATOM 2685 CG PRO A 560 156.501 94.485 130.454 1.00 53.22 C
ATOM 2686 CD PRO A 560 155.263 94.640 131.259 1.00 53.22 C
ATOM 2687 N LEU A 561 154.984 98.234 131.060 1.00 44.27 N
ATOM 2688 CA LEU A 561 154.525 99.565 130.683 1.00 44.27 C
ATOM 2689 C LEU A 561 154.654 100.546 131.836 1.00 44.27 C
ATOM 2690 O LEU A 561 155.021 101.707 131.629 1.00 44.27 O
ATOM 2691 CB LEU A 561 153.088 99.510 130.184 1.00 44.27 C
ATOM 2692 CG LEU A 561 152.894 99.345 128.680 1.00 44.27 C
ATOM 2693 CD1 LEU A 561 153.517 100.523 127.987 1.00 44.27 C
ATOM 2694 CD2 LEU A 561 153.458 98.056 128.135 1.00 44.27 C
ATOM 2695 N GLN A 562 154.416 100.085 133.065 1.00 43.36 N
ATOM 2696 CA GLN A 562 154.669 100.935 134.222 1.00 43.36 C
ATOM 2697 C GLN A 562 156.155 101.197 134.419 1.00 43.36 C
ATOM 2698 O GLN A 562 156.535 102.249 134.940 1.00 43.36 O
ATOM 2699 CB GLN A 562 154.062 100.325 135.481 1.00 43.36 C
ATOM 2700 CG GLN A 562 152.585 100.608 135.657 1.00 43.36 C
ATOM 2701 CD GLN A 562 151.718 99.759 134.781 1.00 43.36 C
ATOM 2702 OE1 GLN A 562 152.164 98.756 134.234 1.00 43.36 O
ATOM 2703 NE2 GLN A 562 150.466 100.158 134.634 1.00 43.36 N
ATOM 2704 N ALA A 563 157.013 100.275 133.984 1.00 40.51 N
ATOM 2705 CA ALA A 563 158.445 100.517 134.104 1.00 40.51 C
ATOM 2706 C ALA A 563 158.893 101.617 133.156 1.00 40.51 C
ATOM 2707 O ALA A 563 159.627 102.531 133.559 1.00 40.51 O
ATOM 2708 CB ALA A 563 159.225 99.235 133.848 1.00 40.51 C
ATOM 2709 N LEU A 564 158.423 101.576 131.908 1.00 37.66 N
ATOM 2710 CA LEU A 564 158.750 102.653 130.977 1.00 37.66 C
ATOM 2711 C LEU A 564 158.112 103.967 131.405 1.00 37.66 C
ATOM 2712 O LEU A 564 158.714 105.039 131.256 1.00 37.66 O
ATOM 2713 CB LEU A 564 158.316 102.278 129.569 1.00 37.66 C
ATOM 2714 CG LEU A 564 158.595 103.302 128.481 1.00 37.66 C
ATOM 2715 CD1 LEU A 564 160.053 103.582 128.431 1.00 37.66 C
ATOM 2716 CD2 LEU A 564 158.141 102.755 127.162 1.00 37.66 C
ATOM 2717 N PHE A 565 156.922 103.899 132.002 1.00 32.66 N
ATOM 2718 CA PHE A 565 156.255 105.107 132.467 1.00 32.66 C
ATOM 2719 C PHE A 565 156.999 105.764 133.624 1.00 32.66 C
ATOM 2720 O PHE A 565 157.156 106.990 133.649 1.00 32.66 O
ATOM 2721 CB PHE A 565 154.828 104.773 132.867 1.00 32.66 C
ATOM 2722 CG PHE A 565 154.081 105.921 133.424 1.00 32.66 C
ATOM 2723 CD1 PHE A 565 153.684 106.952 132.616 1.00 32.66 C
ATOM 2724 CD2 PHE A 565 153.740 105.951 134.753 1.00 32.66 C
ATOM 2725 CE1 PHE A 565 152.987 108.008 133.125 1.00 32.66 C
ATOM 2726 CE2 PHE A 565 153.043 107.002 135.266 1.00 32.66 C
ATOM 2727 CZ PHE A 565 152.664 108.031 134.452 1.00 32.66 C
ATOM 2728 N ILE A 566 157.491 104.972 134.576 1.00 35.82 N
ATOM 2729 CA ILE A 566 158.216 105.551 135.703 1.00 35.82 C
ATOM 2730 C ILE A 566 159.576 106.065 135.253 1.00 35.82 C
ATOM 2731 O ILE A 566 160.056 107.104 135.738 1.00 35.82 O
ATOM 2732 CB ILE A 566 158.302 104.521 136.842 1.00 35.82 C
ATOM 2733 CG1 ILE A 566 156.919 104.347 137.448 1.00 35.82 C
ATOM 2734 CG2 ILE A 566 159.267 104.918 137.920 1.00 35.82 C
ATOM 2735 CD1 ILE A 566 156.831 103.212 138.400 1.00 35.82 C
ATOM 2736 N TRP A 567 160.177 105.399 134.260 1.00 40.01 N
ATOM 2737 CA TRP A 567 161.382 105.931 133.631 1.00 40.01 C
ATOM 2738 C TRP A 567 161.135 107.287 132.990 1.00 40.01 C
ATOM 2739 O TRP A 567 162.002 108.164 133.029 1.00 40.01 O
ATOM 2740 CB TRP A 567 161.893 104.972 132.569 1.00 40.01 C
ATOM 2741 CG TRP A 567 163.059 105.518 131.866 1.00 40.01 C
ATOM 2742 CD1 TRP A 567 164.311 105.619 132.346 1.00 40.01 C
ATOM 2743 CD2 TRP A 567 163.073 106.118 130.574 1.00 40.01 C
ATOM 2744 NE1 TRP A 567 165.126 106.206 131.421 1.00 40.01 N
ATOM 2745 CE2 TRP A 567 164.381 106.530 130.323 1.00 40.01 C
ATOM 2746 CE3 TRP A 567 162.104 106.341 129.605 1.00 40.01 C
ATOM 2747 CZ2 TRP A 567 164.752 107.141 129.144 1.00 40.01 C
ATOM 2748 CZ3 TRP A 567 162.475 106.946 128.433 1.00 40.01 C
ATOM 2749 CH2 TRP A 567 163.786 107.340 128.211 1.00 40.01 C
ATOM 2750 N SER A 568 159.964 107.479 132.395 1.00 37.40 N
ATOM 2751 CA SER A 568 159.694 108.772 131.780 1.00 37.40 C
ATOM 2752 C SER A 568 159.388 109.835 132.822 1.00 37.40 C
ATOM 2753 O SER A 568 159.724 111.006 132.632 1.00 37.40 O
ATOM 2754 CB SER A 568 158.546 108.661 130.788 1.00 37.40 C
ATOM 2755 OG SER A 568 158.235 109.930 130.247 1.00 37.40 O
ATOM 2756 N VAL A 569 158.747 109.456 133.928 1.00 32.54 N
ATOM 2757 CA VAL A 569 158.317 110.473 134.883 1.00 32.54 C
ATOM 2758 C VAL A 569 159.476 110.944 135.753 1.00 32.54 C
ATOM 2759 O VAL A 569 159.536 112.123 136.122 1.00 32.54 O
ATOM 2760 CB VAL A 569 157.130 109.942 135.706 1.00 32.54 C
ATOM 2761 CG1 VAL A 569 156.742 110.862 136.828 1.00 32.54 C
ATOM 2762 CG2 VAL A 569 155.947 109.811 134.807 1.00 32.54 C
ATOM 2763 N LEU A 570 160.445 110.068 136.042 1.00 34.35 N
ATOM 2764 CA LEU A 570 161.568 110.475 136.889 1.00 34.35 C
ATOM 2765 C LEU A 570 162.446 111.543 136.248 1.00 34.35 C
ATOM 2766 O LEU A 570 163.048 112.347 136.961 1.00 34.35 O
ATOM 2767 CB LEU A 570 162.431 109.278 137.259 1.00 34.35 C
ATOM 2768 CG LEU A 570 161.899 108.365 138.345 1.00 34.35 C
ATOM 2769 CD1 LEU A 570 162.810 107.181 138.498 1.00 34.35 C
ATOM 2770 CD2 LEU A 570 161.860 109.159 139.610 1.00 34.35 C
ATOM 2771 N GLN A 571 162.524 111.595 134.927 1.00 37.97 N
ATOM 2772 CA GLN A 571 163.405 112.565 134.296 1.00 37.97 C
ATOM 2773 C GLN A 571 162.725 113.887 133.969 1.00 37.97 C
ATOM 2774 O GLN A 571 163.344 114.719 133.299 1.00 37.97 O
ATOM 2775 CB GLN A 571 164.010 111.990 133.024 1.00 37.97 C
ATOM 2776 CG GLN A 571 164.959 110.859 133.262 1.00 37.97 C
ATOM 2777 CD GLN A 571 165.595 110.396 131.981 1.00 37.97 C
ATOM 2778 OE1 GLN A 571 165.298 110.920 130.914 1.00 37.97 O
ATOM 2779 NE2 GLN A 571 166.480 109.415 132.075 1.00 37.97 N
ATOM 2780 N ASN A 572 161.486 114.092 134.430 1.00 42.92 N
ATOM 2781 CA ASN A 572 160.676 115.289 134.150 1.00 42.92 C
ATOM 2782 C ASN A 572 160.527 115.550 132.656 1.00 42.92 C
ATOM 2783 O ASN A 572 160.819 116.639 132.164 1.00 42.92 O
ATOM 2784 CB ASN A 572 161.227 116.526 134.852 1.00 42.92 C
ATOM 2785 CG ASN A 572 161.085 116.451 136.341 1.00 42.92 C
ATOM 2786 OD1 ASN A 572 162.070 116.350 137.066 1.00 42.92 O
ATOM 2787 ND2 ASN A 572 159.856 116.519 136.816 1.00 42.92 N
ATOM 2788 N LYS A 573 160.076 114.540 131.922 1.00 43.16 N
ATOM 2789 CA LYS A 573 159.733 114.705 130.514 1.00 43.16 C
ATOM 2790 C LYS A 573 158.218 114.792 130.421 1.00 43.16 C
ATOM 2791 O LYS A 573 157.514 113.828 130.714 1.00 43.16 O
ATOM 2792 CB LYS A 573 160.277 113.555 129.683 1.00 43.16 C
ATOM 2793 CG LYS A 573 161.774 113.545 129.555 1.00 43.16 C
ATOM 2794 CD LYS A 573 162.217 112.405 128.668 1.00 43.16 C
ATOM 2795 CE LYS A 573 163.718 112.397 128.498 1.00 43.16 C
ATOM 2796 NZ LYS A 573 164.165 111.252 127.661 1.00 43.16 N
ATOM 2797 N LYS A 574 157.706 115.952 130.017 1.00 47.03 N
ATOM 2798 CA LYS A 574 156.261 116.148 130.003 1.00 47.03 C
ATOM 2799 C LYS A 574 155.621 115.437 128.822 1.00 47.03 C
ATOM 2800 O LYS A 574 154.795 114.527 128.991 1.00 47.03 O
ATOM 2801 CB LYS A 574 155.938 117.638 129.954 1.00 47.03 C
ATOM 2802 CG LYS A 574 156.316 118.379 131.207 1.00 47.03 C
ATOM 2803 CD LYS A 574 155.965 119.848 131.107 1.00 47.03 C
ATOM 2804 CE LYS A 574 156.375 120.585 132.368 1.00 47.03 C
ATOM 2805 NZ LYS A 574 156.047 122.032 132.306 1.00 47.03 N
ATOM 2806 N GLU A 575 156.011 115.833 127.612 1.00 43.71 N
ATOM 2807 CA GLU A 575 155.263 115.438 126.428 1.00 43.71 C
ATOM 2808 C GLU A 575 155.492 113.979 126.085 1.00 43.71 C
ATOM 2809 O GLU A 575 154.690 113.375 125.373 1.00 43.71 O
ATOM 2810 CB GLU A 575 155.631 116.333 125.252 1.00 43.71 C
ATOM 2811 N LEU A 576 156.574 113.390 126.578 1.00 40.71 N
ATOM 2812 CA LEU A 576 156.751 111.960 126.372 1.00 40.71 C
ATOM 2813 C LEU A 576 155.903 111.168 127.354 1.00 40.71 C
ATOM 2814 O LEU A 576 155.374 110.103 127.010 1.00 40.71 O
ATOM 2815 CB LEU A 576 158.230 111.600 126.489 1.00 40.71 C
ATOM 2816 CG LEU A 576 158.772 110.247 126.017 1.00 40.71 C
ATOM 2817 CD1 LEU A 576 158.654 109.133 127.039 1.00 40.71 C
ATOM 2818 CD2 LEU A 576 158.061 109.860 124.740 1.00 40.71 C
ATOM 2819 N SER A 577 155.753 111.670 128.577 1.00 40.93 N
ATOM 2820 CA SER A 577 154.999 110.922 129.570 1.00 40.93 C
ATOM 2821 C SER A 577 153.511 110.991 129.291 1.00 40.93 C
ATOM 2822 O SER A 577 152.787 110.029 129.559 1.00 40.93 O
ATOM 2823 CB SER A 577 155.280 111.448 130.962 1.00 40.93 C
ATOM 2824 OG SER A 577 154.700 112.726 131.090 1.00 40.93 O
ATOM 2825 N LYS A 578 153.038 112.106 128.729 1.00 43.86 N
ATOM 2826 CA LYS A 578 151.627 112.175 128.360 1.00 43.86 C
ATOM 2827 C LYS A 578 151.309 111.224 127.218 1.00 43.86 C
ATOM 2828 O LYS A 578 150.186 110.722 127.116 1.00 43.86 O
ATOM 2829 CB LYS A 578 151.239 113.598 127.988 1.00 43.86 C
ATOM 2830 CG LYS A 578 151.254 114.531 129.162 1.00 43.86 C
ATOM 2831 CD LYS A 578 150.869 115.930 128.760 1.00 43.86 C
ATOM 2832 CE LYS A 578 150.985 116.850 129.948 1.00 43.86 C
ATOM 2833 NZ LYS A 578 150.661 118.255 129.596 1.00 43.86 N
ATOM 2834 N VAL A 579 152.288 110.956 126.355 1.00 41.77 N
ATOM 2835 CA VAL A 579 152.091 109.983 125.289 1.00 41.77 C
ATOM 2836 C VAL A 579 152.098 108.574 125.845 1.00 41.77 C
ATOM 2837 O VAL A 579 151.207 107.772 125.546 1.00 41.77 O
ATOM 2838 CB VAL A 579 153.156 110.165 124.200 1.00 41.77 C
ATOM 2839 CG1 VAL A 579 153.116 109.018 123.229 1.00 41.77 C
ATOM 2840 CG2 VAL A 579 152.890 111.446 123.483 1.00 41.77 C
ATOM 2841 N ILE A 580 153.074 108.254 126.690 1.00 37.87 N
ATOM 2842 CA ILE A 580 153.165 106.881 127.162 1.00 37.87 C
ATOM 2843 C ILE A 580 152.117 106.574 128.229 1.00 37.87 C
ATOM 2844 O ILE A 580 151.897 105.403 128.550 1.00 37.87 O
ATOM 2845 CB ILE A 580 154.589 106.598 127.661 1.00 37.87 C
ATOM 2846 CG1 ILE A 580 154.917 105.125 127.505 1.00 37.87 C
ATOM 2847 CG2 ILE A 580 154.743 106.980 129.109 1.00 37.87 C
ATOM 2848 CD1 ILE A 580 154.970 104.706 126.074 1.00 37.87 C
ATOM 2849 N TRP A 581 151.427 107.588 128.757 1.00 38.04 N
ATOM 2850 CA TRP A 581 150.371 107.335 129.731 1.00 38.04 C
ATOM 2851 C TRP A 581 149.135 106.744 129.076 1.00 38.04 C
ATOM 2852 O TRP A 581 148.351 106.049 129.725 1.00 38.04 O
ATOM 2853 CB TRP A 581 150.009 108.628 130.448 1.00 38.04 C
ATOM 2854 CG TRP A 581 148.939 108.481 131.454 1.00 38.04 C
ATOM 2855 CD1 TRP A 581 149.015 107.825 132.629 1.00 38.04 C
ATOM 2856 CD2 TRP A 581 147.614 108.987 131.360 1.00 38.04 C
ATOM 2857 NE1 TRP A 581 147.821 107.900 133.292 1.00 38.04 N
ATOM 2858 CE2 TRP A 581 146.942 108.612 132.526 1.00 38.04 C
ATOM 2859 CE3 TRP A 581 146.932 109.730 130.401 1.00 38.04 C
ATOM 2860 CZ2 TRP A 581 145.626 108.951 132.762 1.00 38.04 C
ATOM 2861 CZ3 TRP A 581 145.629 110.065 130.635 1.00 38.04 C
ATOM 2862 CH2 TRP A 581 144.987 109.680 131.804 1.00 38.04 C
ATOM 2863 N GLU A 582 148.949 106.990 127.785 1.00 46.01 N
ATOM 2864 CA GLU A 582 147.719 106.550 127.143 1.00 46.01 C
ATOM 2865 C GLU A 582 147.784 105.082 126.745 1.00 46.01 C
ATOM 2866 O GLU A 582 146.823 104.545 126.189 1.00 46.01 O
ATOM 2867 CB GLU A 582 147.425 107.420 125.930 1.00 46.01 C
ATOM 2868 CG GLU A 582 147.114 108.852 126.292 1.00 46.01 C
ATOM 2869 CD GLU A 582 146.884 109.717 125.076 1.00 46.01 C
ATOM 2870 OE1 GLU A 582 147.027 109.205 123.947 1.00 46.01 O
ATOM 2871 OE2 GLU A 582 146.580 110.914 125.247 1.00 46.01 O
ATOM 2872 N GLN A 583 148.908 104.418 126.994 1.00 46.25 N
ATOM 2873 CA GLN A 583 149.004 103.019 126.604 1.00 46.25 C
ATOM 2874 C GLN A 583 148.965 102.096 127.811 1.00 46.25 C
ATOM 2875 O GLN A 583 148.864 100.875 127.657 1.00 46.25 O
ATOM 2876 CB GLN A 583 150.276 102.792 125.800 1.00 46.25 C
ATOM 2877 CG GLN A 583 150.356 103.661 124.581 1.00 46.25 C
ATOM 2878 CD GLN A 583 149.262 103.368 123.606 1.00 46.25 C
ATOM 2879 OE1 GLN A 583 148.896 102.214 123.396 1.00 46.25 O
ATOM 2880 NE2 GLN A 583 148.725 104.411 122.994 1.00 46.25 N
ATOM 2881 N THR A 584 149.059 102.647 129.018 1.00 45.48 N
ATOM 2882 CA THR A 584 149.140 101.792 130.193 1.00 45.48 C
ATOM 2883 C THR A 584 147.760 101.267 130.562 1.00 45.48 C
ATOM 2884 O THR A 584 146.738 101.789 130.116 1.00 45.48 O
ATOM 2885 CB THR A 584 149.763 102.543 131.366 1.00 45.48 C
ATOM 2886 OG1 THR A 584 150.003 101.628 132.437 1.00 45.48 O
ATOM 2887 CG2 THR A 584 148.848 103.619 131.854 1.00 45.48 C
ATOM 2888 N ARG A 585 147.734 100.200 131.358 1.00 48.64 N
ATOM 2889 CA ARG A 585 146.476 99.501 131.582 1.00 48.64 C
ATOM 2890 C ARG A 585 145.655 100.167 132.674 1.00 48.64 C
ATOM 2891 O ARG A 585 144.545 100.641 132.418 1.00 48.64 O
ATOM 2892 CB ARG A 585 146.744 98.040 131.922 1.00 48.64 C
ATOM 2893 CG ARG A 585 147.569 97.329 130.871 1.00 48.64 C
ATOM 2894 CD ARG A 585 146.850 97.230 129.536 1.00 48.64 C
ATOM 2895 NE ARG A 585 145.728 96.298 129.550 1.00 48.64 N
ATOM 2896 CZ ARG A 585 144.780 96.271 128.621 1.00 48.64 C
ATOM 2897 NH1 ARG A 585 144.814 97.129 127.614 1.00 48.64 N
ATOM 2898 NH2 ARG A 585 143.797 95.389 128.698 1.00 48.64 N
ATOM 2899 N GLY A 586 146.180 100.228 133.893 1.00 47.83 N
ATOM 2900 CA GLY A 586 145.433 100.820 134.985 1.00 47.83 C
ATOM 2901 C GLY A 586 145.643 102.315 135.022 1.00 47.83 C
ATOM 2902 O GLY A 586 146.640 102.793 135.563 1.00 47.83 O
ATOM 2903 N CYS A 587 144.687 103.066 134.477 1.00 47.07 N
ATOM 2904 CA CYS A 587 144.969 104.437 134.068 1.00 47.07 C
ATOM 2905 C CYS A 587 145.002 105.382 135.259 1.00 47.07 C
ATOM 2906 O CYS A 587 146.002 106.082 135.478 1.00 47.07 O
ATOM 2907 CB CYS A 587 143.932 104.876 133.047 1.00 47.07 C
ATOM 2908 SG CYS A 587 143.887 103.755 131.655 1.00 47.07 S
ATOM 2909 N THR A 588 143.927 105.403 136.052 1.00 43.32 N
ATOM 2910 CA THR A 588 143.869 106.305 137.197 1.00 43.32 C
ATOM 2911 C THR A 588 144.874 105.909 138.268 1.00 43.32 C
ATOM 2912 O THR A 588 145.428 106.772 138.962 1.00 43.32 O
ATOM 2913 CB THR A 588 142.458 106.359 137.768 1.00 43.32 C
ATOM 2914 OG1 THR A 588 142.457 107.181 138.935 1.00 43.32 O
ATOM 2915 CG2 THR A 588 141.945 104.996 138.116 1.00 43.32 C
ATOM 2916 N LEU A 589 145.178 104.614 138.367 1.00 43.21 N
ATOM 2917 CA LEU A 589 146.165 104.159 139.333 1.00 43.21 C
ATOM 2918 C LEU A 589 147.554 104.624 138.940 1.00 43.21 C
ATOM 2919 O LEU A 589 148.322 105.085 139.790 1.00 43.21 O
ATOM 2920 CB LEU A 589 146.121 102.644 139.441 1.00 43.21 C
ATOM 2921 CG LEU A 589 147.075 102.086 140.477 1.00 43.21 C
ATOM 2922 CD1 LEU A 589 146.685 102.594 141.836 1.00 43.21 C
ATOM 2923 CD2 LEU A 589 147.029 100.586 140.435 1.00 43.21 C
ATOM 2924 N ALA A 590 147.872 104.557 137.647 1.00 42.37 N
ATOM 2925 CA ALA A 590 149.177 105.006 137.182 1.00 42.37 C
ATOM 2926 C ALA A 590 149.320 106.511 137.312 1.00 42.37 C
ATOM 2927 O ALA A 590 150.396 107.007 137.676 1.00 42.37 O
ATOM 2928 CB ALA A 590 149.402 104.576 135.739 1.00 42.37 C
ATOM 2929 N ALA A 591 148.241 107.250 137.040 1.00 39.14 N
ATOM 2930 CA ALA A 591 148.284 108.698 137.200 1.00 39.14 C
ATOM 2931 C ALA A 591 148.515 109.082 138.652 1.00 39.14 C
ATOM 2932 O ALA A 591 149.352 109.948 138.956 1.00 39.14 O
ATOM 2933 CB ALA A 591 146.992 109.315 136.684 1.00 39.14 C
ATOM 2934 N LEU A 592 147.852 108.388 139.570 1.00 36.57 N
ATOM 2935 CA LEU A 592 147.981 108.774 140.962 1.00 36.57 C
ATOM 2936 C LEU A 592 149.325 108.325 141.528 1.00 36.57 C
ATOM 2937 O LEU A 592 149.898 108.992 142.403 1.00 36.57 O
ATOM 2938 CB LEU A 592 146.827 108.191 141.753 1.00 36.57 C
ATOM 2939 CG LEU A 592 146.608 109.010 143.003 1.00 36.57 C
ATOM 2940 CD1 LEU A 592 146.051 110.336 142.577 1.00 36.57 C
ATOM 2941 CD2 LEU A 592 145.669 108.323 143.923 1.00 36.57 C
ATOM 2942 N GLY A 593 149.866 107.222 141.008 1.00 38.94 N
ATOM 2943 CA GLY A 593 151.205 106.815 141.396 1.00 38.94 C
ATOM 2944 C GLY A 593 152.268 107.787 140.932 1.00 38.94 C
ATOM 2945 O GLY A 593 153.231 108.056 141.656 1.00 38.94 O
ATOM 2946 N ALA A 594 152.101 108.337 139.729 1.00 37.30 N
ATOM 2947 CA ALA A 594 153.025 109.366 139.265 1.00 37.30 C
ATOM 2948 C ALA A 594 152.939 110.613 140.131 1.00 37.30 C
ATOM 2949 O ALA A 594 153.959 111.264 140.391 1.00 37.30 O
ATOM 2950 CB ALA A 594 152.745 109.712 137.808 1.00 37.30 C
ATOM 2951 N SER A 595 151.736 110.941 140.616 1.00 37.82 N
ATOM 2952 CA SER A 595 151.609 112.085 141.518 1.00 37.82 C
ATOM 2953 C SER A 595 152.347 111.851 142.830 1.00 37.82 C
ATOM 2954 O SER A 595 153.093 112.727 143.296 1.00 37.82 O
ATOM 2955 CB SER A 595 150.150 112.377 141.820 1.00 37.82 C
ATOM 2956 OG SER A 595 149.646 111.397 142.700 1.00 37.82 O
ATOM 2957 N LYS A 596 152.172 110.671 143.433 1.00 36.83 N
ATOM 2958 CA LYS A 596 152.802 110.427 144.731 1.00 36.83 C
ATOM 2959 C LYS A 596 154.307 110.238 144.587 1.00 36.83 C
ATOM 2960 O LYS A 596 155.063 110.444 145.541 1.00 36.83 O
ATOM 2961 CB LYS A 596 152.161 109.226 145.421 1.00 36.83 C
ATOM 2962 CG LYS A 596 152.489 109.099 146.902 1.00 36.83 C
ATOM 2963 CD LYS A 596 153.563 108.083 147.185 1.00 36.83 C
ATOM 2964 CE LYS A 596 153.832 107.980 148.659 1.00 36.83 C
ATOM 2965 NZ LYS A 596 154.445 109.240 149.145 1.00 36.83 N1+
ATOM 2966 N LEU A 597 154.766 109.880 143.394 1.00 35.14 N
ATOM 2967 CA LEU A 597 156.203 109.818 143.167 1.00 35.14 C
ATOM 2968 C LEU A 597 156.797 111.211 143.015 1.00 35.14 C
ATOM 2969 O LEU A 597 157.863 111.508 143.574 1.00 35.14 O
ATOM 2970 CB LEU A 597 156.490 108.974 141.937 1.00 35.14 C
ATOM 2971 CG LEU A 597 157.951 108.740 141.628 1.00 35.14 C
ATOM 2972 CD1 LEU A 597 158.583 108.017 142.769 1.00 35.14 C
ATOM 2973 CD2 LEU A 597 158.042 107.911 140.389 1.00 35.14 C
ATOM 2974 N LEU A 598 156.121 112.087 142.273 1.00 34.60 N
ATOM 2975 CA LEU A 598 156.705 113.394 142.013 1.00 34.60 C
ATOM 2976 C LEU A 598 156.646 114.304 143.227 1.00 34.60 C
ATOM 2977 O LEU A 598 157.472 115.211 143.348 1.00 34.60 O
ATOM 2978 CB LEU A 598 156.035 114.060 140.828 1.00 34.60 C
ATOM 2979 CG LEU A 598 156.416 113.420 139.514 1.00 34.60 C
ATOM 2980 CD1 LEU A 598 155.683 114.125 138.409 1.00 34.60 C
ATOM 2981 CD2 LEU A 598 157.897 113.513 139.319 1.00 34.60 C
ATOM 2982 N LYS A 599 155.691 114.089 144.140 1.00 39.19 N
ATOM 2983 CA LYS A 599 155.732 114.850 145.392 1.00 39.19 C
ATOM 2984 C LYS A 599 156.993 114.539 146.191 1.00 39.19 C
ATOM 2985 O LYS A 599 157.676 115.452 146.681 1.00 39.19 O
ATOM 2986 CB LYS A 599 154.505 114.567 146.246 1.00 39.19 C
ATOM 2987 CG LYS A 599 153.200 115.005 145.658 1.00 39.19 C
ATOM 2988 CD LYS A 599 153.023 116.491 145.647 1.00 39.19 C
ATOM 2989 CE LYS A 599 151.631 116.795 145.134 1.00 39.19 C
ATOM 2990 NZ LYS A 599 151.329 118.242 145.067 1.00 39.19 N1+
ATOM 2991 N SER A 600 157.339 113.258 146.300 1.00 38.87 N
ATOM 2992 CA SER A 600 158.514 112.876 147.072 1.00 38.87 C
ATOM 2993 C SER A 600 159.795 113.270 146.359 1.00 38.87 C
ATOM 2994 O SER A 600 160.818 113.516 147.003 1.00 38.87 O
ATOM 2995 CB SER A 600 158.496 111.380 147.347 1.00 38.87 C
ATOM 2996 OG SER A 600 159.648 111.000 148.068 1.00 38.87 O
ATOM 2997 N MET A 601 159.769 113.328 145.030 1.00 41.08 N
ATOM 2998 CA MET A 601 160.900 113.923 144.323 1.00 41.08 C
ATOM 2999 C MET A 601 160.955 115.429 144.526 1.00 41.08 C
ATOM 3000 O MET A 601 162.023 116.035 144.418 1.00 41.08 O
ATOM 3001 CB MET A 601 160.830 113.596 142.840 1.00 41.08 C
ATOM 3002 CG MET A 601 161.316 112.225 142.492 1.00 41.08 C
ATOM 3003 SD MET A 601 163.090 112.172 142.679 1.00 41.08 S
ATOM 3004 CE MET A 601 163.540 113.264 141.339 1.00 41.08 C
ATOM 3005 N ALA A 602 159.812 116.058 144.791 1.00 42.10 N
ATOM 3006 CA ALA A 602 159.796 117.508 144.931 1.00 42.10 C
ATOM 3007 C ALA A 602 160.226 117.944 146.322 1.00 42.10 C
ATOM 3008 O ALA A 602 160.608 119.101 146.520 1.00 42.10 O
ATOM 3009 CB ALA A 602 158.407 118.050 144.613 1.00 42.10 C
ATOM 3010 N LYS A 603 160.161 117.045 147.306 1.00 50.03 N
ATOM 3011 CA LYS A 603 160.573 117.431 148.657 1.00 50.03 C
ATOM 3012 C LYS A 603 162.083 117.590 148.795 1.00 50.03 C
ATOM 3013 O LYS A 603 162.559 118.074 149.826 1.00 50.03 O
ATOM 3014 CB LYS A 603 160.094 116.422 149.693 1.00 50.03 C
ATOM 3015 CG LYS A 603 158.656 116.525 150.082 1.00 50.03 C
ATOM 3016 CD LYS A 603 158.403 115.545 151.198 1.00 50.03 C
ATOM 3017 CE LYS A 603 156.973 115.575 151.655 1.00 50.03 C
ATOM 3018 NZ LYS A 603 156.765 114.584 152.740 1.00 50.03 N
ATOM 3019 N VAL A 604 162.861 117.153 147.804 1.00 54.31 N
ATOM 3020 CA VAL A 604 164.305 117.306 147.908 1.00 54.31 C
ATOM 3021 C VAL A 604 164.658 118.762 147.640 1.00 54.31 C
ATOM 3022 O VAL A 604 163.874 119.512 147.046 1.00 54.31 O
ATOM 3023 CB VAL A 604 165.022 116.351 146.939 1.00 54.31 C
ATOM 3024 CG1 VAL A 604 165.005 116.892 145.534 1.00 54.31 C
ATOM 3025 CG2 VAL A 604 166.422 116.024 147.418 1.00 54.31 C
ATOM 3026 N LYS A 605 165.818 119.194 148.133 1.00 61.19 N
ATOM 3027 CA LYS A 605 166.230 120.588 148.038 1.00 61.19 C
ATOM 3028 C LYS A 605 167.667 120.742 147.568 1.00 61.19 C
ATOM 3029 O LYS A 605 168.337 121.699 147.961 1.00 61.19 O
ATOM 3030 CB LYS A 605 166.051 121.283 149.386 1.00 61.19 C
ATOM 3031 CG LYS A 605 164.608 121.409 149.842 1.00 61.19 C
ATOM 3032 CD LYS A 605 164.518 122.003 151.227 1.00 61.19 C
ATOM 3033 CE LYS A 605 163.089 122.010 151.727 1.00 61.19 C
ATOM 3034 NZ LYS A 605 163.000 122.564 153.102 1.00 61.19 N
ATOM 3035 N ASN A 606 168.167 119.814 146.757 1.00 57.88 N
ATOM 3036 CA ASN A 606 169.522 119.950 146.239 1.00 57.88 C
ATOM 3037 C ASN A 606 169.547 120.865 145.022 1.00 57.88 C
ATOM 3038 O ASN A 606 170.473 121.664 144.849 1.00 57.88 O
ATOM 3039 CB ASN A 606 170.082 118.575 145.893 1.00 57.88 C
ATOM 3040 CG ASN A 606 171.575 118.584 145.706 1.00 57.88 C
ATOM 3041 OD1 ASN A 606 172.231 119.605 145.878 1.00 57.88 O
ATOM 3042 ND2 ASN A 606 172.123 117.436 145.345 1.00 57.88 N
ATOM 3043 N ASP A 607 168.539 120.759 144.164 1.00 64.60 N
ATOM 3044 CA ASP A 607 168.452 121.531 142.929 1.00 64.60 C
ATOM 3045 C ASP A 607 167.007 121.977 142.774 1.00 64.60 C
ATOM 3046 O ASP A 607 166.099 121.143 142.734 1.00 64.60 O
ATOM 3047 CB ASP A 607 168.902 120.692 141.736 1.00 64.60 C
ATOM 3048 CG ASP A 607 169.106 121.511 140.481 1.00 64.60 C
ATOM 3049 OD1 ASP A 607 168.913 122.744 140.518 1.00 64.60 O
ATOM 3050 OD2 ASP A 607 169.464 120.911 139.446 1.00 64.60 O
ATOM 3051 N ILE A 608 166.791 123.286 142.674 1.00 58.76 N
ATOM 3052 CA ILE A 608 165.428 123.802 142.739 1.00 58.76 C
ATOM 3053 C ILE A 608 164.801 123.845 141.346 1.00 58.76 C
ATOM 3054 O ILE A 608 163.567 123.811 141.200 1.00 58.76 O
ATOM 3055 CB ILE A 608 165.430 125.173 143.442 1.00 58.76 C
ATOM 3056 CG1 ILE A 608 164.024 125.591 143.849 1.00 58.76 C
ATOM 3057 CG2 ILE A 608 166.075 126.230 142.582 1.00 58.76 C
ATOM 3058 CD1 ILE A 608 164.012 126.720 144.824 1.00 58.76 C
ATOM 3059 N ASN A 609 165.639 123.847 140.304 1.00 62.64 N
ATOM 3060 CA ASN A 609 165.149 123.983 138.935 1.00 62.64 C
ATOM 3061 C ASN A 609 164.371 122.754 138.491 1.00 62.64 C
ATOM 3062 O ASN A 609 163.359 122.871 137.794 1.00 62.64 O
ATOM 3063 CB ASN A 609 166.314 124.231 137.987 1.00 62.64 C
ATOM 3064 CG ASN A 609 166.921 125.587 138.174 1.00 62.64 C
ATOM 3065 OD1 ASN A 609 166.211 126.574 138.347 1.00 62.64 O
ATOM 3066 ND2 ASN A 609 168.245 125.652 138.144 1.00 62.64 N
ATOM 3067 N ALA A 610 164.831 121.566 138.876 1.00 62.38 N
ATOM 3068 CA ALA A 610 164.046 120.372 138.603 1.00 62.38 C
ATOM 3069 C ALA A 610 162.839 120.297 139.525 1.00 62.38 C
ATOM 3070 O ALA A 610 161.788 119.769 139.140 1.00 62.38 O
ATOM 3071 CB ALA A 610 164.914 119.124 138.744 1.00 62.38 C
ATOM 3072 N ALA A 611 162.963 120.846 140.737 1.00 60.04 N
ATOM 3073 CA ALA A 611 161.931 120.665 141.751 1.00 60.04 C
ATOM 3074 C ALA A 611 160.662 121.434 141.412 1.00 60.04 C
ATOM 3075 O ALA A 611 159.548 120.929 141.625 1.00 60.04 O
ATOM 3076 CB ALA A 611 162.458 121.088 143.116 1.00 60.04 C
ATOM 3077 N GLY A 612 160.807 122.648 140.875 1.00 64.17 N
ATOM 3078 CA GLY A 612 159.630 123.406 140.472 1.00 64.17 C
ATOM 3079 C GLY A 612 158.848 122.733 139.358 1.00 64.17 C
ATOM 3080 O GLY A 612 157.614 122.613 139.429 1.00 64.17 O
ATOM 3081 N GLU A 613 159.561 122.234 138.344 1.00 66.09 N
ATOM 3082 CA GLU A 613 158.912 121.536 137.242 1.00 66.09 C
ATOM 3083 C GLU A 613 158.293 120.234 137.712 1.00 66.09 C
ATOM 3084 O GLU A 613 157.245 119.816 137.205 1.00 66.09 O
ATOM 3085 CB GLU A 613 159.920 121.261 136.138 1.00 66.09 C
ATOM 3086 CG GLU A 613 160.523 122.510 135.563 1.00 66.09 C
ATOM 3087 CD GLU A 613 161.533 122.213 134.482 1.00 66.09 C
ATOM 3088 OE1 GLU A 613 161.787 121.019 134.223 1.00 66.09 O
ATOM 3089 OE2 GLU A 613 162.088 123.171 133.904 1.00 66.09 O
ATOM 3090 N SER A 614 158.908 119.603 138.711 1.00 52.74 N
ATOM 3091 CA SER A 614 158.375 118.355 139.231 1.00 52.74 C
ATOM 3092 C SER A 614 157.059 118.582 139.956 1.00 52.74 C
ATOM 3093 O SER A 614 156.108 117.811 139.783 1.00 52.74 O
ATOM 3094 CB SER A 614 159.390 117.697 140.154 1.00 52.74 C
ATOM 3095 OG SER A 614 158.877 116.474 140.643 1.00 52.74 O
ATOM 3096 N GLU A 615 156.968 119.653 140.745 1.00 57.37 N
ATOM 3097 CA GLU A 615 155.713 119.884 141.453 1.00 57.37 C
ATOM 3098 C GLU A 615 154.612 120.327 140.493 1.00 57.37 C
ATOM 3099 O GLU A 615 153.436 119.964 140.673 1.00 57.37 O
ATOM 3100 CB GLU A 615 155.909 120.895 142.576 1.00 57.37 C
ATOM 3101 CG GLU A 615 154.726 120.975 143.514 1.00 57.37 C
ATOM 3102 CD GLU A 615 155.006 121.830 144.722 1.00 57.37 C
ATOM 3103 OE1 GLU A 615 156.119 122.382 144.805 1.00 57.37 O
ATOM 3104 OE2 GLU A 615 154.120 121.942 145.594 1.00 57.37 O1-
ATOM 3105 N GLU A 616 154.981 121.047 139.424 1.00 61.87 N
ATOM 3106 CA GLU A 616 153.980 121.394 138.412 1.00 61.87 C
ATOM 3107 C GLU A 616 153.475 120.164 137.669 1.00 61.87 C
ATOM 3108 O GLU A 616 152.270 120.043 137.407 1.00 61.87 O
ATOM 3109 CB GLU A 616 154.530 122.405 137.415 1.00 61.87 C
ATOM 3110 CG GLU A 616 154.673 123.798 137.971 1.00 61.87 C
ATOM 3111 CD GLU A 616 155.172 124.789 136.938 1.00 61.87 C
ATOM 3112 OE1 GLU A 616 155.507 124.361 135.813 1.00 61.87 O
ATOM 3113 OE2 GLU A 616 155.232 125.998 137.248 1.00 61.87 O
ATOM 3114 N LEU A 617 154.374 119.237 137.329 1.00 45.35 N
ATOM 3115 CA LEU A 617 153.944 118.019 136.652 1.00 45.35 C
ATOM 3116 C LEU A 617 153.092 117.152 137.569 1.00 45.35 C
ATOM 3117 O LEU A 617 152.144 116.496 137.114 1.00 45.35 O
ATOM 3118 CB LEU A 617 155.155 117.244 136.149 1.00 45.35 C
ATOM 3119 CG LEU A 617 154.821 116.036 135.289 1.00 45.35 C
ATOM 3120 CD1 LEU A 617 154.117 116.502 134.055 1.00 45.35 C
ATOM 3121 CD2 LEU A 617 156.084 115.337 134.899 1.00 45.35 C
ATOM 3122 N ALA A 618 153.371 117.188 138.873 1.00 46.11 N
ATOM 3123 CA ALA A 618 152.562 116.426 139.819 1.00 46.11 C
ATOM 3124 C ALA A 618 151.140 116.953 139.893 1.00 46.11 C
ATOM 3125 O ALA A 618 150.180 116.169 139.870 1.00 46.11 O
ATOM 3126 CB ALA A 618 153.195 116.458 141.202 1.00 46.11 C
ATOM 3127 N ASN A 619 150.980 118.277 139.977 1.00 50.92 N
ATOM 3128 CA ASN A 619 149.628 118.834 140.003 1.00 50.92 C
ATOM 3129 C ASN A 619 148.903 118.602 138.682 1.00 50.92 C
ATOM 3130 O ASN A 619 147.686 118.339 138.666 1.00 50.92 O
ATOM 3131 CB ASN A 619 149.670 120.319 140.340 1.00 50.92 C
ATOM 3132 CG ASN A 619 149.984 120.562 141.787 1.00 50.92 C
ATOM 3133 OD1 ASN A 619 149.475 119.865 142.661 1.00 50.92 O
ATOM 3134 ND2 ASN A 619 150.831 121.544 142.057 1.00 50.92 N
ATOM 3135 N GLU A 620 149.642 118.638 137.570 1.00 50.67 N
ATOM 3136 CA GLU A 620 149.027 118.388 136.276 1.00 50.67 C
ATOM 3137 C GLU A 620 148.576 116.943 136.122 1.00 50.67 C
ATOM 3138 O GLU A 620 147.580 116.691 135.442 1.00 50.67 O
ATOM 3139 CB GLU A 620 149.996 118.772 135.166 1.00 50.67 C
ATOM 3140 CG GLU A 620 149.384 118.784 133.794 1.00 50.67 C
ATOM 3141 CD GLU A 620 150.335 119.303 132.755 1.00 50.67 C
ATOM 3142 OE1 GLU A 620 151.497 119.585 133.105 1.00 50.67 O
ATOM 3143 OE2 GLU A 620 149.915 119.458 131.593 1.00 50.67 O
ATOM 3144 N TYR A 621 149.243 115.991 136.764 1.00 39.98 N
ATOM 3145 CA TYR A 621 148.717 114.629 136.754 1.00 39.98 C
ATOM 3146 C TYR A 621 147.578 114.407 137.734 1.00 39.98 C
ATOM 3147 O TYR A 621 146.696 113.581 137.462 1.00 39.98 O
ATOM 3148 CB TYR A 621 149.816 113.607 137.015 1.00 39.98 C
ATOM 3149 CG TYR A 621 150.440 113.110 135.750 1.00 39.98 C
ATOM 3150 CD1 TYR A 621 149.833 112.115 135.025 1.00 39.98 C
ATOM 3151 CD2 TYR A 621 151.619 113.633 135.273 1.00 39.98 C
ATOM 3152 CE1 TYR A 621 150.377 111.648 133.870 1.00 39.98 C
ATOM 3153 CE2 TYR A 621 152.179 113.171 134.111 1.00 39.98 C
ATOM 3154 CZ TYR A 621 151.550 112.176 133.414 1.00 39.98 C
ATOM 3155 OH TYR A 621 152.108 111.703 132.254 1.00 39.98 O
ATOM 3156 N GLU A 622 147.560 115.132 138.854 1.00 48.50 N
ATOM 3157 CA GLU A 622 146.444 114.991 139.786 1.00 48.50 C
ATOM 3158 C GLU A 622 145.130 115.449 139.163 1.00 48.50 C
ATOM 3159 O GLU A 622 144.100 114.768 139.300 1.00 48.50 O
ATOM 3160 CB GLU A 622 146.712 115.775 141.060 1.00 48.50 C
ATOM 3161 CG GLU A 622 145.631 115.588 142.080 1.00 48.50 C
ATOM 3162 CD GLU A 622 145.785 116.491 143.281 1.00 48.50 C
ATOM 3163 OE1 GLU A 622 146.762 117.268 143.333 1.00 48.50 O
ATOM 3164 OE2 GLU A 622 144.904 116.443 144.166 1.00 48.50 O
ATOM 3165 N THR A 623 145.152 116.576 138.439 1.00 46.60 N
ATOM 3166 CA THR A 623 143.909 117.055 137.827 1.00 46.60 C
ATOM 3167 C THR A 623 143.438 116.126 136.715 1.00 46.60 C
ATOM 3168 O THR A 623 142.228 115.951 136.513 1.00 46.60 O
ATOM 3169 CB THR A 623 144.074 118.462 137.270 1.00 46.60 C
ATOM 3170 OG1 THR A 623 145.028 118.440 136.206 1.00 46.60 O
ATOM 3171 CG2 THR A 623 144.541 119.410 138.347 1.00 46.60 C
ATOM 3172 N ARG A 624 144.371 115.488 136.013 1.00 41.66 N
ATOM 3173 CA ARG A 624 143.977 114.559 134.965 1.00 41.66 C
ATOM 3174 C ARG A 624 143.368 113.299 135.555 1.00 41.66 C
ATOM 3175 O ARG A 624 142.387 112.763 135.018 1.00 41.66 O
ATOM 3176 CB ARG A 624 145.175 114.230 134.093 1.00 41.66 C
ATOM 3177 CG ARG A 624 144.847 113.365 132.921 1.00 41.66 C
ATOM 3178 CD ARG A 624 146.031 113.308 132.016 1.00 41.66 C
ATOM 3179 NE ARG A 624 146.304 114.622 131.458 1.00 41.66 N
ATOM 3180 CZ ARG A 624 147.390 114.917 130.762 1.00 41.66 C
ATOM 3181 NH1 ARG A 624 148.307 113.990 130.540 1.00 41.66 N1+
ATOM 3182 NH2 ARG A 624 147.563 116.138 130.288 1.00 41.66 N
ATOM 3183 N ALA A 625 143.892 112.851 136.695 1.00 38.37 N
ATOM 3184 CA ALA A 625 143.308 111.696 137.363 1.00 38.37 C
ATOM 3185 C ALA A 625 141.898 111.991 137.854 1.00 38.37 C
ATOM 3186 O ALA A 625 140.998 111.152 137.719 1.00 38.37 O
ATOM 3187 CB ALA A 625 144.188 111.259 138.523 1.00 38.37 C
ATOM 3188 N VAL A 626 141.669 113.194 138.385 1.00 40.27 N
ATOM 3189 CA VAL A 626 140.340 113.457 138.930 1.00 40.27 C
ATOM 3190 C VAL A 626 139.325 113.673 137.807 1.00 40.27 C
ATOM 3191 O VAL A 626 138.162 113.262 137.927 1.00 40.27 O
ATOM 3192 CB VAL A 626 140.361 114.617 139.948 1.00 40.27 C
ATOM 3193 CG1 VAL A 626 140.627 115.953 139.322 1.00 40.27 C
ATOM 3194 CG2 VAL A 626 139.067 114.671 140.690 1.00 40.27 C
ATOM 3195 N GLU A 627 139.757 114.230 136.668 1.00 41.06 N
ATOM 3196 CA GLU A 627 138.831 114.378 135.548 1.00 41.06 C
ATOM 3197 C GLU A 627 138.457 113.022 134.957 1.00 41.06 C
ATOM 3198 O GLU A 627 137.276 112.771 134.665 1.00 41.06 O
ATOM 3199 CB GLU A 627 139.430 115.287 134.478 1.00 41.06 C
ATOM 3200 N LEU A 628 139.443 112.121 134.825 1.00 40.62 N
ATOM 3201 CA LEU A 628 139.163 110.771 134.335 1.00 40.62 C
ATOM 3202 C LEU A 628 138.228 110.016 135.263 1.00 40.62 C
ATOM 3203 O LEU A 628 137.309 109.332 134.800 1.00 40.62 O
ATOM 3204 CB LEU A 628 140.455 109.982 134.158 1.00 40.62 C
ATOM 3205 CG LEU A 628 140.275 108.509 133.794 1.00 40.62 C
ATOM 3206 CD1 LEU A 628 139.603 108.362 132.454 1.00 40.62 C
ATOM 3207 CD2 LEU A 628 141.593 107.798 133.808 1.00 40.62 C
ATOM 3208 N PHE A 629 138.417 110.141 136.575 1.00 40.82 N
ATOM 3209 CA PHE A 629 137.562 109.353 137.452 1.00 40.82 C
ATOM 3210 C PHE A 629 136.166 109.941 137.566 1.00 40.82 C
ATOM 3211 O PHE A 629 135.212 109.190 137.774 1.00 40.82 O
ATOM 3212 CB PHE A 629 138.171 109.200 138.831 1.00 40.82 C
ATOM 3213 CG PHE A 629 137.397 108.288 139.706 1.00 40.82 C
ATOM 3214 CD1 PHE A 629 137.450 106.932 139.513 1.00 40.82 C
ATOM 3215 CD2 PHE A 629 136.593 108.788 140.698 1.00 40.82 C
ATOM 3216 CE1 PHE A 629 136.734 106.093 140.315 1.00 40.82 C
ATOM 3217 CE2 PHE A 629 135.877 107.959 141.498 1.00 40.82 C
ATOM 3218 CZ PHE A 629 135.940 106.613 141.303 1.00 40.82 C
ATOM 3219 N THR A 630 136.010 111.259 137.411 1.00 43.93 N
ATOM 3220 CA THR A 630 134.660 111.815 137.340 1.00 43.93 C
ATOM 3221 C THR A 630 133.929 111.319 136.102 1.00 43.93 C
ATOM 3222 O THR A 630 132.761 110.895 136.184 1.00 43.93 O
ATOM 3223 CB THR A 630 134.714 113.338 137.355 1.00 43.93 C
ATOM 3224 OG1 THR A 630 135.219 113.773 138.620 1.00 43.93 O
ATOM 3225 CG2 THR A 630 133.345 113.934 137.147 1.00 43.93 C
ATOM 3226 N GLU A 631 134.625 111.302 134.963 1.00 48.54 N
ATOM 3227 CA GLU A 631 134.015 110.792 133.742 1.00 48.54 C
ATOM 3228 C GLU A 631 133.664 109.313 133.858 1.00 48.54 C
ATOM 3229 O GLU A 631 132.579 108.898 133.444 1.00 48.54 O
ATOM 3230 CB GLU A 631 134.945 111.032 132.562 1.00 48.54 C
ATOM 3231 CG GLU A 631 134.377 110.567 131.249 1.00 48.54 C
ATOM 3232 CD GLU A 631 133.170 111.367 130.814 1.00 48.54 C
ATOM 3233 OE1 GLU A 631 133.068 112.561 131.176 1.00 48.54 O
ATOM 3234 OE2 GLU A 631 132.317 110.799 130.100 1.00 48.54 O
ATOM 3235 N CYS A 632 134.528 108.521 134.492 1.00 48.09 N
ATOM 3236 CA CYS A 632 134.252 107.094 134.631 1.00 48.09 C
ATOM 3237 C CYS A 632 133.188 106.831 135.688 1.00 48.09 C
ATOM 3238 O CYS A 632 132.519 105.795 135.663 1.00 48.09 O
ATOM 3239 CB CYS A 632 135.541 106.356 134.967 1.00 48.09 C
ATOM 3240 SG CYS A 632 135.401 104.573 135.037 1.00 48.09 S
ATOM 3241 N TYR A 633 133.010 107.756 136.624 1.00 48.82 N
ATOM 3242 CA TYR A 633 131.989 107.563 137.642 1.00 48.82 C
ATOM 3243 C TYR A 633 130.632 107.981 137.119 1.00 48.82 C
ATOM 3244 O TYR A 633 129.601 107.670 137.724 1.00 48.82 O
ATOM 3245 CB TYR A 633 132.357 108.357 138.886 1.00 48.82 C
ATOM 3246 CG TYR A 633 131.486 108.108 140.079 1.00 48.82 C
ATOM 3247 CD1 TYR A 633 131.589 106.931 140.789 1.00 48.82 C
ATOM 3248 CD2 TYR A 633 130.581 109.057 140.510 1.00 48.82 C
ATOM 3249 CE1 TYR A 633 130.813 106.698 141.885 1.00 48.82 C
ATOM 3250 CE2 TYR A 633 129.796 108.829 141.610 1.00 48.82 C
ATOM 3251 CZ TYR A 633 129.920 107.642 142.292 1.00 48.82 C
ATOM 3252 OH TYR A 633 129.150 107.377 143.396 1.00 48.82 O
ATOM 3253 N SER A 634 130.616 108.728 136.015 1.00 49.58 N
ATOM 3254 CA SER A 634 129.338 109.114 135.425 1.00 49.58 C
ATOM 3255 C SER A 634 128.560 107.917 134.880 1.00 49.58 C
ATOM 3256 O SER A 634 127.327 107.917 134.922 1.00 49.58 O
ATOM 3257 CB SER A 634 129.545 110.151 134.330 1.00 49.58 C
ATOM 3258 OG SER A 634 129.950 111.384 134.890 1.00 49.58 O
ATOM 3259 N ASN A 635 129.242 106.888 134.368 1.00 52.14 N
ATOM 3260 CA ASN A 635 128.497 105.814 133.712 1.00 52.14 C
ATOM 3261 C ASN A 635 127.918 104.809 134.702 1.00 52.14 C
ATOM 3262 O ASN A 635 126.697 104.693 134.832 1.00 52.14 O
ATOM 3263 CB ASN A 635 129.361 105.090 132.685 1.00 52.14 C
ATOM 3264 CG ASN A 635 129.498 105.865 131.407 1.00 52.14 C
ATOM 3265 OD1 ASN A 635 128.621 106.639 131.048 1.00 52.14 O
ATOM 3266 ND2 ASN A 635 130.542 105.588 130.663 1.00 52.14 N
ATOM 3267 N ASP A 636 128.767 104.076 135.411 1.00 60.39 N
ATOM 3268 CA ASP A 636 128.315 102.901 136.151 1.00 60.39 C
ATOM 3269 C ASP A 636 128.955 102.918 137.526 1.00 60.39 C
ATOM 3270 O ASP A 636 130.171 102.764 137.642 1.00 60.39 O
ATOM 3271 CB ASP A 636 128.662 101.614 135.409 1.00 60.39 C
ATOM 3272 N GLU A 637 128.135 103.080 138.563 1.00 66.93 N
ATOM 3273 CA GLU A 637 128.670 103.366 139.887 1.00 66.93 C
ATOM 3274 C GLU A 637 129.321 102.138 140.513 1.00 66.93 C
ATOM 3275 O GLU A 637 130.369 102.249 141.166 1.00 66.93 O
ATOM 3276 CB GLU A 637 127.561 103.902 140.784 1.00 66.93 C
ATOM 3277 CG GLU A 637 128.056 104.394 142.122 1.00 66.93 C
ATOM 3278 CD GLU A 637 126.952 104.973 142.970 1.00 66.93 C
ATOM 3279 OE1 GLU A 637 125.787 104.947 142.525 1.00 66.93 O
ATOM 3280 OE2 GLU A 637 127.251 105.460 144.080 1.00 66.93 O
ATOM 3281 N ASP A 638 128.721 100.961 140.317 1.00 70.93 N
ATOM 3282 CA ASP A 638 129.216 99.744 140.955 1.00 70.93 C
ATOM 3283 C ASP A 638 130.587 99.356 140.427 1.00 70.93 C
ATOM 3284 O ASP A 638 131.505 99.051 141.205 1.00 70.93 O
ATOM 3285 CB ASP A 638 128.226 98.608 140.726 1.00 70.93 C
ATOM 3286 CG ASP A 638 126.903 98.854 141.403 1.00 70.93 C
ATOM 3287 OD1 ASP A 638 126.897 99.537 142.449 1.00 70.93 O
ATOM 3288 OD2 ASP A 638 125.871 98.375 140.886 1.00 70.93 O
ATOM 3289 N LEU A 639 130.750 99.400 139.108 1.00 64.34 N
ATOM 3290 CA LEU A 639 132.037 99.082 138.513 1.00 64.34 C
ATOM 3291 C LEU A 639 133.073 100.151 138.837 1.00 64.34 C
ATOM 3292 O LEU A 639 134.260 99.844 138.976 1.00 64.34 O
ATOM 3293 CB LEU A 639 131.874 98.907 137.011 1.00 64.34 C
ATOM 3294 CG LEU A 639 131.038 97.699 136.619 1.00 64.34 C
ATOM 3295 CD1 LEU A 639 130.839 97.671 135.122 1.00 64.34 C
ATOM 3296 CD2 LEU A 639 131.718 96.437 137.096 1.00 64.34 C
ATOM 3297 N ALA A 640 132.637 101.399 139.021 1.00 58.53 N
ATOM 3298 CA ALA A 640 133.572 102.458 139.385 1.00 58.53 C
ATOM 3299 C ALA A 640 134.103 102.272 140.800 1.00 58.53 C
ATOM 3300 O ALA A 640 135.288 102.501 141.061 1.00 58.53 O
ATOM 3301 CB ALA A 640 132.906 103.821 139.243 1.00 58.53 C
ATOM 3302 N GLU A 641 133.261 101.822 141.725 1.00 61.12 N
ATOM 3303 CA GLU A 641 133.761 101.632 143.083 1.00 61.12 C
ATOM 3304 C GLU A 641 134.598 100.367 143.195 1.00 61.12 C
ATOM 3305 O GLU A 641 135.581 100.320 143.955 1.00 61.12 O
ATOM 3306 CB GLU A 641 132.605 101.613 144.063 1.00 61.12 C
ATOM 3307 CG GLU A 641 131.963 102.962 144.178 1.00 61.12 C
ATOM 3308 CD GLU A 641 130.786 102.947 145.100 1.00 61.12 C
ATOM 3309 OE1 GLU A 641 130.417 101.841 145.546 1.00 61.12 O
ATOM 3310 OE2 GLU A 641 130.233 104.032 145.374 1.00 61.12 O
ATOM 3311 N GLN A 642 134.243 99.338 142.425 1.00 60.14 N
ATOM 3312 CA GLN A 642 135.108 98.169 142.329 1.00 60.14 C
ATOM 3313 C GLN A 642 136.443 98.533 141.688 1.00 60.14 C
ATOM 3314 O GLN A 642 137.475 97.930 141.999 1.00 60.14 O
ATOM 3315 CB GLN A 642 134.392 97.077 141.542 1.00 60.14 C
ATOM 3316 CG GLN A 642 135.075 95.736 141.525 1.00 60.14 C
ATOM 3317 CD GLN A 642 134.233 94.695 140.824 1.00 60.14 C
ATOM 3318 OE1 GLN A 642 133.146 94.996 140.334 1.00 60.14 O
ATOM 3319 NE2 GLN A 642 134.726 93.466 140.771 1.00 60.14 N
ATOM 3320 N LEU A 643 136.445 99.543 140.817 1.00 52.69 N
ATOM 3321 CA LEU A 643 137.689 100.060 140.262 1.00 52.69 C
ATOM 3322 C LEU A 643 138.484 100.837 141.302 1.00 52.69 C
ATOM 3323 O LEU A 643 139.716 100.893 141.228 1.00 52.69 O
ATOM 3324 CB LEU A 643 137.372 100.926 139.042 1.00 52.69 C
ATOM 3325 CG LEU A 643 138.429 101.482 138.090 1.00 52.69 C
ATOM 3326 CD1 LEU A 643 139.014 102.794 138.540 1.00 52.69 C
ATOM 3327 CD2 LEU A 643 139.522 100.467 137.939 1.00 52.69 C
ATOM 3328 N LEU A 644 137.800 101.498 142.238 1.00 49.65 N
ATOM 3329 CA LEU A 644 138.514 102.153 143.333 1.00 49.65 C
ATOM 3330 C LEU A 644 139.243 101.153 144.205 1.00 49.65 C
ATOM 3331 O LEU A 644 140.443 101.295 144.453 1.00 49.65 O
ATOM 3332 CB LEU A 644 137.583 102.969 144.217 1.00 49.65 C
ATOM 3333 CG LEU A 644 137.157 104.333 143.737 1.00 49.65 C
ATOM 3334 CD1 LEU A 644 136.216 104.927 144.740 1.00 49.65 C
ATOM 3335 CD2 LEU A 644 138.377 105.179 143.604 1.00 49.65 C
ATOM 3336 N THR A 645 138.546 100.134 144.684 1.00 56.30 N
ATOM 3337 CA THR A 645 139.175 99.264 145.668 1.00 56.30 C
ATOM 3338 C THR A 645 140.114 98.224 145.060 1.00 56.30 C
ATOM 3339 O THR A 645 140.631 97.380 145.796 1.00 56.30 O
ATOM 3340 CB THR A 645 138.108 98.567 146.509 1.00 56.30 C
ATOM 3341 OG1 THR A 645 138.738 97.827 147.562 1.00 56.30 O
ATOM 3342 CG2 THR A 645 137.286 97.632 145.648 1.00 56.30 C
ATOM 3343 N TYR A 646 140.364 98.270 143.758 1.00 58.23 N
ATOM 3344 CA TYR A 646 141.236 97.295 143.118 1.00 58.23 C
ATOM 3345 C TYR A 646 142.699 97.622 143.368 1.00 58.23 C
ATOM 3346 O TYR A 646 143.080 98.791 143.416 1.00 58.23 O
ATOM 3347 CB TYR A 646 140.948 97.271 141.626 1.00 58.23 C
ATOM 3348 CG TYR A 646 141.863 96.400 140.827 1.00 58.23 C
ATOM 3349 CD1 TYR A 646 141.852 95.030 140.989 1.00 58.23 C
ATOM 3350 CD2 TYR A 646 142.696 96.945 139.869 1.00 58.23 C
ATOM 3351 CE1 TYR A 646 142.673 94.226 140.252 1.00 58.23 C
ATOM 3352 CE2 TYR A 646 143.519 96.149 139.117 1.00 58.23 C
ATOM 3353 CZ TYR A 646 143.504 94.788 139.315 1.00 58.23 C
ATOM 3354 OH TYR A 646 144.322 93.976 138.574 1.00 58.23 O
ATOM 3355 N SER A 647 143.524 96.590 143.514 1.00 60.27 N
ATOM 3356 CA SER A 647 144.949 96.754 143.765 1.00 60.27 C
ATOM 3357 C SER A 647 145.759 96.040 142.694 1.00 60.27 C
ATOM 3358 O SER A 647 145.293 95.060 142.108 1.00 60.27 O
ATOM 3359 CB SER A 647 145.327 96.210 145.137 1.00 60.27 C
ATOM 3360 OG SER A 647 145.140 94.810 145.185 1.00 60.27 O
ATOM 3361 N CYS A 648 146.973 96.533 142.438 1.00 65.41 N
ATOM 3362 CA CYS A 648 147.895 95.877 141.522 1.00 65.41 C
ATOM 3363 C CYS A 648 149.267 95.734 142.159 1.00 65.41 C
ATOM 3364 O CYS A 648 149.566 96.356 143.179 1.00 65.41 O
ATOM 3365 CB CYS A 648 148.064 96.616 140.207 1.00 65.41 C
ATOM 3366 SG CYS A 648 149.109 95.670 139.082 1.00 65.41 S
ATOM 3367 N GLU A 649 150.099 94.894 141.541 1.00 75.19 N
ATOM 3368 CA GLU A 649 151.446 94.660 142.046 1.00 75.19 C
ATOM 3369 C GLU A 649 152.480 95.590 141.437 1.00 75.19 C
ATOM 3370 O GLU A 649 153.612 95.619 141.927 1.00 75.19 O
ATOM 3371 CB GLU A 649 151.885 93.226 141.775 1.00 75.19 C
ATOM 3372 CG GLU A 649 151.208 92.179 142.612 1.00 75.19 C
ATOM 3373 CD GLU A 649 151.648 90.788 142.217 1.00 75.19 C
ATOM 3374 OE1 GLU A 649 152.340 90.660 141.185 1.00 75.19 O
ATOM 3375 OE2 GLU A 649 151.313 89.826 142.937 1.00 75.19 O
ATOM 3376 N ALA A 650 152.139 96.300 140.357 1.00 60.49 N
ATOM 3377 CA ALA A 650 153.120 97.136 139.669 1.00 60.49 C
ATOM 3378 C ALA A 650 153.557 98.296 140.546 1.00 60.49 C
ATOM 3379 O ALA A 650 154.746 98.611 140.636 1.00 60.49 O
ATOM 3380 CB ALA A 650 152.542 97.654 138.356 1.00 60.49 C
ATOM 3381 N TRP A 651 152.606 98.928 141.210 1.00 47.52 N
ATOM 3382 CA TRP A 651 152.890 99.881 142.265 1.00 47.52 C
ATOM 3383 C TRP A 651 153.010 99.104 143.560 1.00 47.52 C
ATOM 3384 O TRP A 651 152.916 97.877 143.575 1.00 47.52 O
ATOM 3385 CB TRP A 651 151.788 100.930 142.327 1.00 47.52 C
ATOM 3386 CG TRP A 651 151.635 101.566 141.011 1.00 47.52 C
ATOM 3387 CD1 TRP A 651 150.774 101.201 140.035 1.00 47.52 C
ATOM 3388 CD2 TRP A 651 152.385 102.660 140.496 1.00 47.52 C
ATOM 3389 NE1 TRP A 651 150.932 101.999 138.938 1.00 47.52 N
ATOM 3390 CE2 TRP A 651 151.918 102.908 139.199 1.00 47.52 C
ATOM 3391 CE3 TRP A 651 153.402 103.460 141.009 1.00 47.52 C
ATOM 3392 CZ2 TRP A 651 152.427 103.920 138.410 1.00 47.52 C
ATOM 3393 CZ3 TRP A 651 153.903 104.464 140.225 1.00 47.52 C
ATOM 3394 CH2 TRP A 651 153.418 104.687 138.940 1.00 47.52 C
ATOM 3395 N GLY A 652 153.189 99.814 144.662 1.00 64.50 N
ATOM 3396 CA GLY A 652 153.523 99.128 145.895 1.00 64.50 C
ATOM 3397 C GLY A 652 152.409 98.348 146.567 1.00 64.50 C
ATOM 3398 O GLY A 652 152.157 98.542 147.759 1.00 64.50 O
ATOM 3399 N GLY A 653 151.790 97.424 145.827 1.00 67.49 N
ATOM 3400 CA GLY A 653 150.687 96.600 146.283 1.00 67.49 C
ATOM 3401 C GLY A 653 149.540 97.366 146.905 1.00 67.49 C
ATOM 3402 O GLY A 653 149.043 96.983 147.967 1.00 67.49 O
ATOM 3403 N SER A 654 149.115 98.450 146.270 1.00 65.35 N
ATOM 3404 CA SER A 654 148.238 99.397 146.933 1.00 65.35 C
ATOM 3405 C SER A 654 147.142 99.886 146.002 1.00 65.35 C
ATOM 3406 O SER A 654 147.404 100.288 144.867 1.00 65.35 O
ATOM 3407 CB SER A 654 149.038 100.581 147.462 1.00 65.35 C
ATOM 3408 OG SER A 654 148.196 101.495 148.135 1.00 65.35 O
ATOM 3409 N ASN A 655 145.915 99.863 146.506 1.00 58.10 N
ATOM 3410 CA ASN A 655 144.770 100.405 145.803 1.00 58.10 C
ATOM 3411 C ASN A 655 144.837 101.925 145.755 1.00 58.10 C
ATOM 3412 O ASN A 655 145.572 102.561 146.511 1.00 58.10 O
ATOM 3413 CB ASN A 655 143.480 99.945 146.473 1.00 58.10 C
ATOM 3414 CG ASN A 655 143.529 100.100 147.968 1.00 58.10 C
ATOM 3415 OD1 ASN A 655 144.532 100.539 148.511 1.00 58.10 O
ATOM 3416 ND2 ASN A 655 142.447 99.734 148.645 1.00 58.10 N
ATOM 3417 N CYS A 656 144.046 102.497 144.843 1.00 49.67 N
ATOM 3418 CA CYS A 656 144.130 103.920 144.526 1.00 49.67 C
ATOM 3419 C CYS A 656 143.737 104.792 145.709 1.00 49.67 C
ATOM 3420 O CYS A 656 144.339 105.849 145.945 1.00 49.67 O
ATOM 3421 CB CYS A 656 143.237 104.217 143.327 1.00 49.67 C
ATOM 3422 SG CYS A 656 143.141 105.938 142.842 1.00 49.67 S
ATOM 3423 N LEU A 657 142.757 104.344 146.486 1.00 48.83 N
ATOM 3424 CA LEU A 657 142.216 105.180 147.543 1.00 48.83 C
ATOM 3425 C LEU A 657 143.177 105.271 148.718 1.00 48.83 C
ATOM 3426 O LEU A 657 143.180 106.267 149.445 1.00 48.83 O
ATOM 3427 CB LEU A 657 140.852 104.636 147.962 1.00 48.83 C
ATOM 3428 CG LEU A 657 139.878 105.438 148.816 1.00 48.83 C
ATOM 3429 CD1 LEU A 657 140.119 105.269 150.297 1.00 48.83 C
ATOM 3430 CD2 LEU A 657 139.980 106.891 148.422 1.00 48.83 C
ATOM 3431 N GLU A 658 144.001 104.247 148.925 1.00 57.17 N
ATOM 3432 CA GLU A 658 145.036 104.360 149.944 1.00 57.17 C
ATOM 3433 C GLU A 658 146.180 105.223 149.448 1.00 57.17 C
ATOM 3434 O GLU A 658 146.843 105.907 150.234 1.00 57.17 O
ATOM 3435 CB GLU A 658 145.549 102.980 150.331 1.00 57.17 C
ATOM 3436 CG GLU A 658 146.501 102.951 151.500 1.00 57.17 C
ATOM 3437 CD GLU A 658 146.974 101.551 151.802 1.00 57.17 C
ATOM 3438 OE1 GLU A 658 146.599 100.629 151.048 1.00 57.17 O
ATOM 3439 OE2 GLU A 658 147.714 101.369 152.792 1.00 57.17 O
ATOM 3440 N LEU A 659 146.419 105.210 148.140 1.00 47.61 N
ATOM 3441 CA LEU A 659 147.536 105.961 147.590 1.00 47.61 C
ATOM 3442 C LEU A 659 147.253 107.454 147.622 1.00 47.61 C
ATOM 3443 O LEU A 659 148.175 108.265 147.775 1.00 47.61 O
ATOM 3444 CB LEU A 659 147.814 105.498 146.169 1.00 47.61 C
ATOM 3445 CG LEU A 659 149.117 105.985 145.577 1.00 47.61 C
ATOM 3446 CD1 LEU A 659 150.242 105.370 146.348 1.00 47.61 C
ATOM 3447 CD2 LEU A 659 149.173 105.578 144.153 1.00 47.61 C
ATOM 3448 N ALA A 660 145.980 107.835 147.490 1.00 52.44 N
ATOM 3449 CA ALA A 660 145.629 109.251 147.541 1.00 52.44 C
ATOM 3450 C ALA A 660 145.880 109.846 148.918 1.00 52.44 C
ATOM 3451 O ALA A 660 146.284 111.007 149.030 1.00 52.44 O
ATOM 3452 CB ALA A 660 144.171 109.447 147.152 1.00 52.44 C
ATOM 3453 N VAL A 661 145.658 109.068 149.974 1.00 52.66 N
ATOM 3454 CA VAL A 661 145.864 109.584 151.323 1.00 52.66 C
ATOM 3455 C VAL A 661 147.351 109.722 151.621 1.00 52.66 C
ATOM 3456 O VAL A 661 147.789 110.709 152.222 1.00 52.66 O
ATOM 3457 CB VAL A 661 145.144 108.685 152.343 1.00 52.66 C
ATOM 3458 CG1 VAL A 661 145.461 109.094 153.764 1.00 52.66 C
ATOM 3459 CG2 VAL A 661 143.657 108.756 152.113 1.00 52.66 C
ATOM 3460 N GLU A 662 148.157 108.757 151.173 1.00 60.58 N
ATOM 3461 CA GLU A 662 149.599 108.854 151.381 1.00 60.58 C
ATOM 3462 C GLU A 662 150.209 109.965 150.544 1.00 60.58 C
ATOM 3463 O GLU A 662 151.211 110.567 150.940 1.00 60.58 O
ATOM 3464 CB GLU A 662 150.279 107.527 151.066 1.00 60.58 C
ATOM 3465 CG GLU A 662 150.013 106.435 152.074 1.00 60.58 C
ATOM 3466 CD GLU A 662 150.735 105.150 151.727 1.00 60.58 C
ATOM 3467 OE1 GLU A 662 151.322 105.079 150.626 1.00 60.58 O
ATOM 3468 OE2 GLU A 662 150.721 104.215 152.556 1.00 60.58 O
ATOM 3469 N ALA A 663 149.621 110.254 149.381 1.00 57.71 N
ATOM 3470 CA ALA A 663 150.107 111.370 148.577 1.00 57.71 C
ATOM 3471 C ALA A 663 149.767 112.701 149.220 1.00 57.71 C
ATOM 3472 O ALA A 663 150.426 113.710 148.948 1.00 57.71 O
ATOM 3473 CB ALA A 663 149.524 111.304 147.170 1.00 57.71 C
ATOM 3474 N ARG A 664 148.746 112.706 150.086 1.00 61.59 N
ATOM 3475 CA ARG A 664 148.207 113.890 150.756 1.00 61.59 C
ATOM 3476 C ARG A 664 147.823 114.957 149.738 1.00 61.59 C
ATOM 3477 O ARG A 664 148.230 116.116 149.832 1.00 61.59 O
ATOM 3478 CB ARG A 664 149.182 114.426 151.812 1.00 61.59 C
ATOM 3479 CG ARG A 664 148.598 115.348 152.878 1.00 61.59 C
ATOM 3480 CD ARG A 664 149.682 115.739 153.847 1.00 61.59 C
ATOM 3481 NE ARG A 664 150.689 116.579 153.212 1.00 61.59 N
ATOM 3482 CZ ARG A 664 151.880 116.840 153.739 1.00 61.59 C
ATOM 3483 NH1 ARG A 664 152.217 116.309 154.907 1.00 61.59 N
ATOM 3484 NH2 ARG A 664 152.737 117.619 153.095 1.00 61.59 N
ATOM 3485 N ASP A 665 147.090 114.554 148.710 1.00 58.74 N
ATOM 3486 CA ASP A 665 146.627 115.524 147.736 1.00 58.74 C
ATOM 3487 C ASP A 665 145.164 115.874 147.972 1.00 58.74 C
ATOM 3488 O ASP A 665 144.396 115.090 148.532 1.00 58.74 O
ATOM 3489 CB ASP A 665 146.862 115.018 146.314 1.00 58.74 C
ATOM 3490 CG ASP A 665 146.194 113.694 146.024 1.00 58.74 C
ATOM 3491 OD1 ASP A 665 145.646 113.049 146.939 1.00 58.74 O
ATOM 3492 OD2 ASP A 665 146.223 113.293 144.846 1.00 58.74 O
ATOM 3493 N GLN A 666 144.790 117.074 147.555 1.00 57.42 N
ATOM 3494 CA GLN A 666 143.530 117.670 147.952 1.00 57.42 C
ATOM 3495 C GLN A 666 142.421 117.418 146.952 1.00 57.42 C
ATOM 3496 O GLN A 666 141.266 117.248 147.351 1.00 57.42 O
ATOM 3497 CB GLN A 666 143.700 119.178 148.120 1.00 57.42 C
ATOM 3498 CG GLN A 666 144.868 119.601 148.970 1.00 57.42 C
ATOM 3499 CD GLN A 666 144.745 119.152 150.388 1.00 57.42 C
ATOM 3500 OE1 GLN A 666 143.652 119.118 150.943 1.00 57.42 O
ATOM 3501 NE2 GLN A 666 145.871 118.827 151.003 1.00 57.42 N
ATOM 3502 N GLN A 667 142.742 117.370 145.662 1.00 51.64 N
ATOM 3503 CA GLN A 667 141.737 117.590 144.634 1.00 51.64 C
ATOM 3504 C GLN A 667 141.202 116.268 144.097 1.00 51.64 C
ATOM 3505 O GLN A 667 140.335 116.258 143.227 1.00 51.64 O
ATOM 3506 CB GLN A 667 142.331 118.454 143.513 1.00 51.64 C
ATOM 3507 CG GLN A 667 141.341 119.156 142.589 1.00 51.64 C
ATOM 3508 CD GLN A 667 142.030 119.954 141.518 1.00 51.64 C
ATOM 3509 OE1 GLN A 667 143.254 119.957 141.430 1.00 51.64 O
ATOM 3510 NE2 GLN A 667 141.250 120.640 140.693 1.00 51.64 N
ATOM 3511 N PHE A 668 141.639 115.143 144.649 1.00 43.15 N
ATOM 3512 CA PHE A 668 141.052 113.881 144.228 1.00 43.15 C
ATOM 3513 C PHE A 668 139.937 113.503 145.181 1.00 43.15 C
ATOM 3514 O PHE A 668 138.944 112.893 144.780 1.00 43.15 O
ATOM 3515 CB PHE A 668 142.077 112.756 144.193 1.00 43.15 C
ATOM 3516 CG PHE A 668 141.541 111.477 143.631 1.00 43.15 C
ATOM 3517 CD1 PHE A 668 141.428 111.317 142.271 1.00 43.15 C
ATOM 3518 CD2 PHE A 668 141.144 110.443 144.458 1.00 43.15 C
ATOM 3519 CE1 PHE A 668 140.942 110.155 141.744 1.00 43.15 C
ATOM 3520 CE2 PHE A 668 140.646 109.281 143.928 1.00 43.15 C
ATOM 3521 CZ PHE A 668 140.550 109.138 142.574 1.00 43.15 C
ATOM 3522 N ILE A 669 140.103 113.848 146.448 1.00 41.62 N
ATOM 3523 CA ILE A 669 139.181 113.414 147.484 1.00 41.62 C
ATOM 3524 C ILE A 669 137.977 114.346 147.479 1.00 41.62 C
ATOM 3525 O ILE A 669 136.897 114.000 147.965 1.00 41.62 O
ATOM 3526 CB ILE A 669 139.901 113.386 148.840 1.00 41.62 C
ATOM 3527 CG1 ILE A 669 141.187 112.584 148.707 1.00 41.62 C
ATOM 3528 CG2 ILE A 669 139.088 112.702 149.877 1.00 41.62 C
ATOM 3529 CD1 ILE A 669 140.983 111.157 148.284 1.00 41.62 C
ATOM 3530 N ALA A 670 138.133 115.514 146.868 1.00 44.79 N
ATOM 3531 CA ALA A 670 137.122 116.557 146.962 1.00 44.79 C
ATOM 3532 C ALA A 670 135.865 116.266 146.157 1.00 44.79 C
ATOM 3533 O ALA A 670 134.799 116.794 146.483 1.00 44.79 O
ATOM 3534 CB ALA A 670 137.703 117.893 146.506 1.00 44.79 C
ATOM 3535 N GLN A 671 135.963 115.459 145.115 1.00 45.57 N
ATOM 3536 CA GLN A 671 134.825 115.253 144.234 1.00 45.57 C
ATOM 3537 C GLN A 671 133.780 114.371 144.919 1.00 45.57 C
ATOM 3538 O GLN A 671 134.112 113.652 145.867 1.00 45.57 O
ATOM 3539 CB GLN A 671 135.300 114.624 142.929 1.00 45.57 C
ATOM 3540 CG GLN A 671 135.948 113.314 143.113 1.00 45.57 C
ATOM 3541 CD GLN A 671 136.368 112.752 141.808 1.00 45.57 C
ATOM 3542 OE1 GLN A 671 136.022 113.278 140.757 1.00 45.57 O
ATOM 3543 NE2 GLN A 671 137.170 111.713 141.853 1.00 45.57 N
ATOM 3544 N PRO A 672 132.511 114.418 144.498 1.00 43.11 N
ATOM 3545 CA PRO A 672 131.482 113.686 145.251 1.00 43.11 C
ATOM 3546 C PRO A 672 131.486 112.183 145.067 1.00 43.11 C
ATOM 3547 O PRO A 672 130.735 111.496 145.769 1.00 43.11 O
ATOM 3548 CB PRO A 672 130.181 114.305 144.733 1.00 43.11 C
ATOM 3549 CG PRO A 672 130.560 115.608 144.208 1.00 43.11 C
ATOM 3550 CD PRO A 672 131.891 115.403 143.598 1.00 43.11 C
ATOM 3551 N GLY A 673 132.278 111.651 144.137 1.00 44.74 N
ATOM 3552 CA GLY A 673 132.301 110.209 143.938 1.00 44.74 C
ATOM 3553 C GLY A 673 132.840 109.461 145.142 1.00 44.74 C
ATOM 3554 O GLY A 673 132.162 108.599 145.713 1.00 44.74 O
ATOM 3555 N VAL A 674 134.041 109.825 145.585 1.00 46.34 N
ATOM 3556 CA VAL A 674 134.617 109.131 146.726 1.00 46.34 C
ATOM 3557 C VAL A 674 133.942 109.571 148.012 1.00 46.34 C
ATOM 3558 O VAL A 674 133.966 108.848 149.009 1.00 46.34 O
ATOM 3559 CB VAL A 674 136.135 109.340 146.779 1.00 46.34 C
ATOM 3560 CG1 VAL A 674 136.740 108.868 145.500 1.00 46.34 C
ATOM 3561 CG2 VAL A 674 136.461 110.780 147.002 1.00 46.34 C
ATOM 3562 N GLN A 675 133.285 110.732 148.005 1.00 46.00 N
ATOM 3563 CA GLN A 675 132.505 111.137 149.168 1.00 46.00 C
ATOM 3564 C GLN A 675 131.272 110.264 149.332 1.00 46.00 C
ATOM 3565 O GLN A 675 130.944 109.842 150.448 1.00 46.00 O
ATOM 3566 CB GLN A 675 132.111 112.601 149.056 1.00 46.00 C
ATOM 3567 CG GLN A 675 133.258 113.522 149.274 1.00 46.00 C
ATOM 3568 CD GLN A 675 133.743 113.454 150.692 1.00 46.00 C
ATOM 3569 OE1 GLN A 675 132.951 113.340 151.623 1.00 46.00 O
ATOM 3570 NE2 GLN A 675 135.048 113.525 150.872 1.00 46.00 N
ATOM 3571 N ASN A 676 130.578 109.982 148.228 1.00 49.58 N
ATOM 3572 CA ASN A 676 129.442 109.072 148.279 1.00 49.58 C
ATOM 3573 C ASN A 676 129.895 107.676 148.675 1.00 49.58 C
ATOM 3574 O ASN A 676 129.227 107.003 149.473 1.00 49.58 O
ATOM 3575 CB ASN A 676 128.739 109.053 146.926 1.00 49.58 C
ATOM 3576 CG ASN A 676 127.371 108.414 146.981 1.00 49.58 C
ATOM 3577 OD1 ASN A 676 126.900 107.996 148.034 1.00 49.58 O
ATOM 3578 ND2 ASN A 676 126.722 108.337 145.833 1.00 49.58 N
ATOM 3579 N PHE A 677 131.053 107.249 148.157 1.00 45.22 N
ATOM 3580 CA PHE A 677 131.628 105.962 148.539 1.00 45.22 C
ATOM 3581 C PHE A 677 131.910 105.879 150.030 1.00 45.22 C
ATOM 3582 O PHE A 677 131.506 104.911 150.691 1.00 45.22 O
ATOM 3583 CB PHE A 677 132.912 105.711 147.765 1.00 45.22 C
ATOM 3584 CG PHE A 677 133.663 104.527 148.248 1.00 45.22 C
ATOM 3585 CD1 PHE A 677 133.179 103.259 148.023 1.00 45.22 C
ATOM 3586 CD2 PHE A 677 134.851 104.678 148.932 1.00 45.22 C
ATOM 3587 CE1 PHE A 677 133.864 102.161 148.475 1.00 45.22 C
ATOM 3588 CE2 PHE A 677 135.539 103.588 149.382 1.00 45.22 C
ATOM 3589 CZ PHE A 677 135.046 102.326 149.154 1.00 45.22 C
ATOM 3590 N LEU A 678 132.608 106.881 150.565 1.00 49.30 N
ATOM 3591 CA LEU A 678 132.930 106.930 151.983 1.00 49.30 C
ATOM 3592 C LEU A 678 131.678 106.923 152.839 1.00 49.30 C
ATOM 3593 O LEU A 678 131.576 106.153 153.799 1.00 49.30 O
ATOM 3594 CB LEU A 678 133.736 108.182 152.285 1.00 49.30 C
ATOM 3595 CG LEU A 678 134.025 108.261 153.775 1.00 49.30 C
ATOM 3596 CD1 LEU A 678 135.121 107.295 154.153 1.00 49.30 C
ATOM 3597 CD2 LEU A 678 134.286 109.676 154.244 1.00 49.30 C
ATOM 3598 N SER A 679 130.706 107.765 152.495 1.00 51.47 N
ATOM 3599 CA SER A 679 129.543 107.923 153.353 1.00 51.47 C
ATOM 3600 C SER A 679 128.672 106.673 153.347 1.00 51.47 C
ATOM 3601 O SER A 679 128.136 106.273 154.387 1.00 51.47 O
ATOM 3602 CB SER A 679 128.757 109.154 152.923 1.00 51.47 C
ATOM 3603 OG SER A 679 127.623 109.333 153.742 1.00 51.47 O
ATOM 3604 N LYS A 680 128.575 105.989 152.206 1.00 52.99 N
ATOM 3605 CA LYS A 680 127.769 104.778 152.220 1.00 52.99 C
ATOM 3606 C LYS A 680 128.572 103.593 152.732 1.00 52.99 C
ATOM 3607 O LYS A 680 128.018 102.513 152.953 1.00 52.99 O
ATOM 3608 CB LYS A 680 127.186 104.484 150.845 1.00 52.99 C
ATOM 3609 CG LYS A 680 128.106 103.845 149.854 1.00 52.99 C
ATOM 3610 CD LYS A 680 127.309 103.606 148.597 1.00 52.99 C
ATOM 3611 CE LYS A 680 128.080 102.814 147.582 1.00 52.99 C
ATOM 3612 NZ LYS A 680 127.283 102.614 146.345 1.00 52.99 N
ATOM 3613 N GLN A 681 129.881 103.764 152.916 1.00 55.70 N
ATOM 3614 CA GLN A 681 130.606 102.801 153.737 1.00 55.70 C
ATOM 3615 C GLN A 681 130.409 103.092 155.220 1.00 55.70 C
ATOM 3616 O GLN A 681 130.403 102.171 156.043 1.00 55.70 O
ATOM 3617 CB GLN A 681 132.087 102.813 153.370 1.00 55.70 C
ATOM 3618 CG GLN A 681 132.933 101.778 154.082 1.00 55.70 C
ATOM 3619 CD GLN A 681 134.379 101.824 153.648 1.00 55.70 C
ATOM 3620 OE1 GLN A 681 134.761 102.636 152.808 1.00 55.70 O
ATOM 3621 NE2 GLN A 681 135.197 100.959 154.228 1.00 55.70 N
ATOM 3622 N TRP A 682 130.226 104.364 155.572 1.00 57.63 N
ATOM 3623 CA TRP A 682 129.949 104.740 156.956 1.00 57.63 C
ATOM 3624 C TRP A 682 128.577 104.260 157.399 1.00 57.63 C
ATOM 3625 O TRP A 682 128.381 103.917 158.569 1.00 57.63 O
ATOM 3626 CB TRP A 682 130.056 106.254 157.109 1.00 57.63 C
ATOM 3627 CG TRP A 682 129.585 106.807 158.417 1.00 57.63 C
ATOM 3628 CD1 TRP A 682 128.390 107.399 158.654 1.00 57.63 C
ATOM 3629 CD2 TRP A 682 130.306 106.859 159.646 1.00 57.63 C
ATOM 3630 NE1 TRP A 682 128.308 107.803 159.955 1.00 57.63 N
ATOM 3631 CE2 TRP A 682 129.474 107.482 160.589 1.00 57.63 C
ATOM 3632 CE3 TRP A 682 131.567 106.432 160.044 1.00 57.63 C
ATOM 3633 CZ2 TRP A 682 129.860 107.690 161.902 1.00 57.63 C
ATOM 3634 CZ3 TRP A 682 131.951 106.640 161.351 1.00 57.63 C
ATOM 3635 CH2 TRP A 682 131.100 107.260 162.265 1.00 57.63 C
ATOM 3636 N TYR A 683 127.612 104.229 156.482 1.00 58.12 N
ATOM 3637 CA TYR A 683 126.310 103.691 156.848 1.00 58.12 C
ATOM 3638 C TYR A 683 126.215 102.191 156.648 1.00 58.12 C
ATOM 3639 O TYR A 683 125.400 101.549 157.313 1.00 58.12 O
ATOM 3640 CB TYR A 683 125.200 104.393 156.077 1.00 58.12 C
ATOM 3641 CG TYR A 683 124.747 105.678 156.717 1.00 58.12 C
ATOM 3642 CD1 TYR A 683 125.008 105.934 158.051 1.00 58.12 C
ATOM 3643 CD2 TYR A 683 124.051 106.629 155.988 1.00 58.12 C
ATOM 3644 CE1 TYR A 683 124.587 107.095 158.640 1.00 58.12 C
ATOM 3645 CE2 TYR A 683 123.633 107.795 156.568 1.00 58.12 C
ATOM 3646 CZ TYR A 683 123.907 108.023 157.891 1.00 58.12 C
ATOM 3647 OH TYR A 683 123.485 109.191 158.470 1.00 58.12 O
ATOM 3648 N GLY A 684 127.015 101.620 155.760 1.00 64.66 N
ATOM 3649 CA GLY A 684 127.046 100.171 155.652 1.00 64.66 C
ATOM 3650 C GLY A 684 125.818 99.639 154.950 1.00 64.66 C
ATOM 3651 O GLY A 684 125.315 100.232 153.990 1.00 64.66 O
ATOM 3652 N GLU A 685 125.303 98.514 155.445 1.00 69.27 N
ATOM 3653 CA GLU A 685 124.157 97.888 154.798 1.00 69.27 C
ATOM 3654 C GLU A 685 122.859 98.609 155.143 1.00 69.27 C
ATOM 3655 O GLU A 685 121.824 98.369 154.510 1.00 69.27 O
ATOM 3656 CB GLU A 685 124.077 96.415 155.186 1.00 69.27 C
ATOM 3657 N ILE A 686 122.885 99.479 156.158 1.00 66.07 N
ATOM 3658 CA ILE A 686 121.771 100.392 156.370 1.00 66.07 C
ATOM 3659 C ILE A 686 121.706 101.361 155.211 1.00 66.07 C
ATOM 3660 O ILE A 686 122.689 102.037 154.890 1.00 66.07 O
ATOM 3661 CB ILE A 686 121.918 101.156 157.694 1.00 66.07 C
ATOM 3662 CG1 ILE A 686 121.804 100.208 158.872 1.00 66.07 C
ATOM 3663 CG2 ILE A 686 120.873 102.235 157.802 1.00 66.07 C
ATOM 3664 CD1 ILE A 686 122.106 100.868 160.173 1.00 66.07 C
ATOM 3665 N SER A 687 120.552 101.418 154.557 1.00 75.91 N
ATOM 3666 CA SER A 687 120.392 102.350 153.458 1.00 75.91 C
ATOM 3667 C SER A 687 120.313 103.767 153.991 1.00 75.91 C
ATOM 3668 O SER A 687 119.926 104.007 155.136 1.00 75.91 O
ATOM 3669 CB SER A 687 119.136 102.043 152.651 1.00 75.91 C
ATOM 3670 OG SER A 687 117.982 102.370 153.396 1.00 75.91 O
ATOM 3671 N ARG A 688 120.670 104.713 153.136 1.00 69.34 N
ATOM 3672 CA ARG A 688 120.642 106.119 153.483 1.00 69.34 C
ATOM 3673 C ARG A 688 119.202 106.625 153.483 1.00 69.34 C
ATOM 3674 O ARG A 688 118.245 105.855 153.348 1.00 69.34 O
ATOM 3675 CB ARG A 688 121.512 106.900 152.505 1.00 69.34 C
ATOM 3676 CG ARG A 688 122.945 106.443 152.519 1.00 69.34 C
ATOM 3677 CD ARG A 688 123.764 107.101 151.429 1.00 69.34 C
ATOM 3678 NE ARG A 688 123.855 108.545 151.590 1.00 69.34 N
ATOM 3679 CZ ARG A 688 124.726 109.143 152.392 1.00 69.34 C
ATOM 3680 NH1 ARG A 688 125.551 108.410 153.118 1.00 69.34 N
ATOM 3681 NH2 ARG A 688 124.760 110.463 152.484 1.00 69.34 N
ATOM 3682 N ASP A 689 119.064 107.943 153.660 1.00 73.11 N
ATOM 3683 CA ASP A 689 117.792 108.664 153.566 1.00 73.11 C
ATOM 3684 C ASP A 689 116.791 108.172 154.605 1.00 73.11 C
ATOM 3685 O ASP A 689 115.592 108.072 154.345 1.00 73.11 O
ATOM 3686 CB ASP A 689 117.210 108.584 152.155 1.00 73.11 C
ATOM 3687 CG ASP A 689 118.115 109.221 151.139 1.00 73.11 C
ATOM 3688 OD1 ASP A 689 118.827 110.166 151.527 1.00 73.11 O
ATOM 3689 OD2 ASP A 689 118.140 108.773 149.974 1.00 73.11 O
ATOM 3690 N THR A 690 117.296 107.832 155.783 1.00 82.55 N
ATOM 3691 CA THR A 690 116.473 107.598 156.956 1.00 82.55 C
ATOM 3692 C THR A 690 116.879 108.596 158.024 1.00 82.55 C
ATOM 3693 O THR A 690 118.012 109.083 158.031 1.00 82.55 O
ATOM 3694 CB THR A 690 116.618 106.177 157.494 1.00 82.55 C
ATOM 3695 OG1 THR A 690 117.979 105.943 157.864 1.00 82.55 O
ATOM 3696 CG2 THR A 690 116.208 105.173 156.447 1.00 82.55 C
ATOM 3697 N LYS A 691 115.949 108.909 158.913 1.00 92.80 N
ATOM 3698 CA LYS A 691 116.219 109.898 159.942 1.00 92.80 C
ATOM 3699 C LYS A 691 117.124 109.313 161.016 1.00 92.80 C
ATOM 3700 O LYS A 691 117.200 108.096 161.195 1.00 92.80 O
ATOM 3701 CB LYS A 691 114.917 110.381 160.566 1.00 92.80 C
ATOM 3702 CG LYS A 691 114.101 111.318 159.697 1.00 92.80 C
ATOM 3703 CD LYS A 691 113.092 110.561 158.855 1.00 92.80 C
ATOM 3704 CE LYS A 691 112.143 111.508 158.159 1.00 92.80 C
ATOM 3705 NZ LYS A 691 112.836 112.349 157.143 1.00 92.80 N
ATOM 3706 N ASN A 692 117.816 110.194 161.735 1.00101.48 N
ATOM 3707 CA ASN A 692 118.776 109.732 162.727 1.00101.48 C
ATOM 3708 C ASN A 692 118.081 109.309 164.014 1.00101.48 C
ATOM 3709 O ASN A 692 118.497 108.339 164.664 1.00101.48 O
ATOM 3710 CB ASN A 692 119.807 110.822 162.990 1.00101.48 C
ATOM 3711 CG ASN A 692 120.628 111.136 161.761 1.00101.48 C
ATOM 3712 OD1 ASN A 692 120.976 110.243 160.994 1.00101.48 O
ATOM 3713 ND2 ASN A 692 120.941 112.409 161.566 1.00101.48 N
ATOM 3714 N TRP A 693 117.008 110.016 164.390 1.00104.30 N
ATOM 3715 CA TRP A 693 116.239 109.627 165.570 1.00104.30 C
ATOM 3716 C TRP A 693 115.570 108.281 165.363 1.00104.30 C
ATOM 3717 O TRP A 693 115.367 107.525 166.318 1.00104.30 O
ATOM 3718 CB TRP A 693 115.191 110.688 165.904 1.00104.30 C
ATOM 3719 CG TRP A 693 114.184 110.917 164.817 1.00104.30 C
ATOM 3720 CD1 TRP A 693 114.258 111.843 163.823 1.00104.30 C
ATOM 3721 CD2 TRP A 693 112.957 110.205 164.608 1.00104.30 C
ATOM 3722 NE1 TRP A 693 113.152 111.763 163.016 1.00104.30 N
ATOM 3723 CE2 TRP A 693 112.343 110.758 163.471 1.00104.30 C
ATOM 3724 CE3 TRP A 693 112.320 109.155 165.272 1.00104.30 C
ATOM 3725 CZ2 TRP A 693 111.125 110.296 162.984 1.00104.30 C
ATOM 3726 CZ3 TRP A 693 111.115 108.698 164.786 1.00104.30 C
ATOM 3727 CH2 TRP A 693 110.529 109.268 163.655 1.00104.30 C
ATOM 3728 N LYS A 694 115.225 107.968 164.115 1.00105.65 N
ATOM 3729 CA LYS A 694 114.640 106.677 163.794 1.00105.65 C
ATOM 3730 C LYS A 694 115.634 105.550 164.032 1.00105.65 C
ATOM 3731 O LYS A 694 115.279 104.502 164.582 1.00105.65 O
ATOM 3732 CB LYS A 694 114.164 106.696 162.347 1.00105.65 C
ATOM 3733 CG LYS A 694 113.421 105.478 161.915 1.00105.65 C
ATOM 3734 CD LYS A 694 112.946 105.624 160.480 1.00105.65 C
ATOM 3735 CE LYS A 694 111.795 106.613 160.377 1.00105.65 C
ATOM 3736 NZ LYS A 694 111.243 106.694 158.996 1.00105.65 N
ATOM 3737 N ILE A 695 116.900 105.770 163.675 1.00101.83 N
ATOM 3738 CA ILE A 695 117.920 104.752 163.901 1.00101.83 C
ATOM 3739 C ILE A 695 118.246 104.649 165.385 1.00101.83 C
ATOM 3740 O ILE A 695 118.549 103.565 165.891 1.00101.83 O
ATOM 3741 CB ILE A 695 119.167 105.054 163.053 1.00101.83 C
ATOM 3742 CG1 ILE A 695 118.778 105.152 161.588 1.00101.83 C
ATOM 3743 CG2 ILE A 695 120.179 103.947 163.154 1.00101.83 C
ATOM 3744 CD1 ILE A 695 119.873 105.691 160.720 1.00101.83 C
ATOM 3745 N ILE A 696 118.123 105.754 166.123 1.00105.49 N
ATOM 3746 CA ILE A 696 118.354 105.684 167.567 1.00105.49 C
ATOM 3747 C ILE A 696 117.223 104.925 168.268 1.00105.49 C
ATOM 3748 O ILE A 696 117.464 104.110 169.173 1.00105.49 O
ATOM 3749 CB ILE A 696 118.556 107.100 168.136 1.00105.49 C
ATOM 3750 CG1 ILE A 696 119.841 107.697 167.568 1.00105.49 C
ATOM 3751 CG2 ILE A 696 118.637 107.085 169.650 1.00105.49 C
ATOM 3752 CD1 ILE A 696 120.004 109.167 167.837 1.00105.49 C
ATOM 3753 N LEU A 697 115.977 105.142 167.838 1.00113.14 N
ATOM 3754 CA LEU A 697 114.869 104.380 168.409 1.00113.14 C
ATOM 3755 C LEU A 697 114.940 102.911 168.014 1.00113.14 C
ATOM 3756 O LEU A 697 114.556 102.036 168.796 1.00113.14 O
ATOM 3757 CB LEU A 697 113.528 104.974 167.993 1.00113.14 C
ATOM 3758 CG LEU A 697 113.204 106.324 168.622 1.00113.14 C
ATOM 3759 CD1 LEU A 697 111.872 106.841 168.119 1.00113.14 C
ATOM 3760 CD2 LEU A 697 113.205 106.206 170.132 1.00113.14 C
ATOM 3761 N CYS A 698 115.448 102.616 166.818 1.00117.15 N
ATOM 3762 CA CYS A 698 115.657 101.221 166.451 1.00117.15 C
ATOM 3763 C CYS A 698 116.873 100.641 167.162 1.00117.15 C
ATOM 3764 O CYS A 698 117.040 99.419 167.229 1.00117.15 O
ATOM 3765 CB CYS A 698 115.787 101.095 164.938 1.00117.15 C
ATOM 3766 SG CYS A 698 114.251 101.468 164.067 1.00117.15 S
ATOM 3767 N LEU A 699 117.752 101.501 167.672 1.00108.79 N
ATOM 3768 CA LEU A 699 118.821 101.029 168.541 1.00108.79 C
ATOM 3769 C LEU A 699 118.280 100.649 169.910 1.00108.79 C
ATOM 3770 O LEU A 699 118.759 99.695 170.535 1.00108.79 O
ATOM 3771 CB LEU A 699 119.909 102.093 168.657 1.00108.79 C
ATOM 3772 CG LEU A 699 121.056 101.815 169.619 1.00108.79 C
ATOM 3773 CD1 LEU A 699 121.778 100.547 169.225 1.00108.79 C
ATOM 3774 CD2 LEU A 699 122.000 102.994 169.647 1.00108.79 C
ATOM 3775 N PHE A 700 117.275 101.375 170.397 1.00121.67 N
ATOM 3776 CA PHE A 700 116.638 100.947 171.640 1.00121.67 C
ATOM 3777 C PHE A 700 115.791 99.691 171.443 1.00121.67 C
ATOM 3778 O PHE A 700 115.785 98.801 172.300 1.00121.67 O
ATOM 3779 CB PHE A 700 115.786 102.069 172.228 1.00121.67 C
ATOM 3780 CG PHE A 700 116.581 103.146 172.899 1.00121.67 C
ATOM 3781 CD1 PHE A 700 117.101 102.943 174.166 1.00121.67 C
ATOM 3782 CD2 PHE A 700 116.786 104.367 172.281 1.00121.67 C
ATOM 3783 CE1 PHE A 700 117.828 103.933 174.797 1.00121.67 C
ATOM 3784 CE2 PHE A 700 117.514 105.363 172.906 1.00121.67 C
ATOM 3785 CZ PHE A 700 118.033 105.146 174.166 1.00121.67 C
ATOM 3786 N PHE A 701 115.083 99.590 170.321 1.00122.87 N
ATOM 3787 CA PHE A 701 114.040 98.583 170.143 1.00122.87 C
ATOM 3788 C PHE A 701 114.450 97.551 169.101 1.00122.87 C
ATOM 3789 O PHE A 701 114.724 97.897 167.949 1.00122.87 O
ATOM 3790 CB PHE A 701 112.719 99.237 169.741 1.00122.87 C
ATOM 3791 CG PHE A 701 112.050 99.984 170.852 1.00122.87 C
ATOM 3792 CD1 PHE A 701 112.406 99.761 172.172 1.00122.87 C
ATOM 3793 CD2 PHE A 701 111.061 100.912 170.576 1.00122.87 C
ATOM 3794 CE1 PHE A 701 111.789 100.450 173.195 1.00122.87 C
ATOM 3795 CE2 PHE A 701 110.437 101.605 171.593 1.00122.87 C
ATOM 3796 CZ PHE A 701 110.801 101.374 172.905 1.00122.87 C
ATOM 3797 N PHE A 702 114.464 96.287 169.508 1.00124.13 N
ATOM 3798 CA PHE A 702 114.732 95.204 168.568 1.00124.13 C
ATOM 3799 C PHE A 702 113.666 94.960 167.491 1.00124.13 C
ATOM 3800 O PHE A 702 114.065 94.869 166.317 1.00124.13 O
ATOM 3801 CB PHE A 702 115.004 93.918 169.359 1.00124.13 C
ATOM 3802 CG PHE A 702 116.277 93.962 170.141 1.00124.13 C
ATOM 3803 CD1 PHE A 702 117.489 93.713 169.518 1.00124.13 C
ATOM 3804 CD2 PHE A 702 116.267 94.270 171.490 1.00124.13 C
ATOM 3805 CE1 PHE A 702 118.668 93.756 170.228 1.00124.13 C
ATOM 3806 CE2 PHE A 702 117.442 94.317 172.209 1.00124.13 C
ATOM 3807 CZ PHE A 702 118.646 94.059 171.576 1.00124.13 C
ATOM 3808 N PRO A 703 112.351 94.826 167.773 1.00124.41 N
ATOM 3809 CA PRO A 703 111.461 94.304 166.715 1.00124.41 C
ATOM 3810 C PRO A 703 111.130 95.297 165.608 1.00124.41 C
ATOM 3811 O PRO A 703 110.465 94.926 164.630 1.00124.41 O
ATOM 3812 CB PRO A 703 110.205 93.896 167.490 1.00124.41 C
ATOM 3813 CG PRO A 703 110.163 94.821 168.606 1.00124.41 C
ATOM 3814 CD PRO A 703 111.578 95.046 169.015 1.00124.41 C
ATOM 3815 N LEU A 704 111.581 96.548 165.725 1.00121.79 N
ATOM 3816 CA LEU A 704 111.445 97.487 164.617 1.00121.79 C
ATOM 3817 C LEU A 704 112.313 97.072 163.434 1.00121.79 C
ATOM 3818 O LEU A 704 112.034 97.440 162.288 1.00121.79 O
ATOM 3819 CB LEU A 704 111.813 98.893 165.079 1.00121.79 C
ATOM 3820 CG LEU A 704 110.943 99.492 166.180 1.00121.79 C
ATOM 3821 CD1 LEU A 704 111.465 100.858 166.578 1.00121.79 C
ATOM 3822 CD2 LEU A 704 109.504 99.577 165.725 1.00121.79 C
ATOM 3823 N ILE A 705 113.381 96.319 163.701 1.00119.25 N
ATOM 3824 CA ILE A 705 114.206 95.753 162.640 1.00119.25 C
ATOM 3825 C ILE A 705 113.425 94.710 161.853 1.00119.25 C
ATOM 3826 O ILE A 705 113.420 94.718 160.617 1.00119.25 O
ATOM 3827 CB ILE A 705 115.486 95.164 163.251 1.00119.25 C
ATOM 3828 CG1 ILE A 705 116.271 96.275 163.947 1.00119.25 C
ATOM 3829 CG2 ILE A 705 116.315 94.461 162.193 1.00119.25 C
ATOM 3830 CD1 ILE A 705 117.365 95.782 164.852 1.00119.25 C
ATOM 3831 N GLY A 706 112.737 93.808 162.558 1.00121.34 N
ATOM 3832 CA GLY A 706 111.955 92.788 161.875 1.00121.34 C
ATOM 3833 C GLY A 706 110.648 93.320 161.319 1.00121.34 C
ATOM 3834 O GLY A 706 109.979 92.647 160.530 1.00121.34 O
ATOM 3835 N CYS A 707 110.258 94.527 161.738 1.00122.28 N
ATOM 3836 CA CYS A 707 109.072 95.172 161.181 1.00122.28 C
ATOM 3837 C CYS A 707 109.259 95.522 159.709 1.00122.28 C
ATOM 3838 O CYS A 707 108.288 95.569 158.945 1.00122.28 O
ATOM 3839 CB CYS A 707 108.751 96.430 161.990 1.00122.28 C
ATOM 3840 SG CYS A 707 107.301 97.366 161.446 1.00122.28 S
ATOM 3841 N GLY A 708 110.500 95.742 159.285 1.00119.06 N
ATOM 3842 CA GLY A 708 110.739 96.357 157.998 1.00119.06 C
ATOM 3843 C GLY A 708 110.680 97.861 158.046 1.00119.06 C
ATOM 3844 O GLY A 708 110.273 98.492 157.067 1.00119.06 O
ATOM 3845 N PHE A 709 111.069 98.455 159.175 1.00112.48 N
ATOM 3846 CA PHE A 709 110.806 99.868 159.410 1.00112.48 C
ATOM 3847 C PHE A 709 111.917 100.743 158.844 1.00112.48 C
ATOM 3848 O PHE A 709 111.683 101.904 158.491 1.00112.48 O
ATOM 3849 CB PHE A 709 110.620 100.094 160.905 1.00112.48 C
ATOM 3850 CG PHE A 709 110.185 101.468 161.260 1.00112.48 C
ATOM 3851 CD1 PHE A 709 108.942 101.927 160.872 1.00112.48 C
ATOM 3852 CD2 PHE A 709 110.980 102.275 162.048 1.00112.48 C
ATOM 3853 CE1 PHE A 709 108.520 103.192 161.217 1.00112.48 C
ATOM 3854 CE2 PHE A 709 110.555 103.533 162.409 1.00112.48 C
ATOM 3855 CZ PHE A 709 109.330 103.996 161.988 1.00112.48 C
ATOM 3856 N ILE A 710 113.131 100.210 158.764 1.00102.50 N
ATOM 3857 CA ILE A 710 114.224 100.877 158.065 1.00102.50 C
ATOM 3858 C ILE A 710 114.407 100.198 156.716 1.00102.50 C
ATOM 3859 O ILE A 710 114.349 98.969 156.623 1.00102.50 O
ATOM 3860 CB ILE A 710 115.518 100.809 158.887 1.00102.50 C
ATOM 3861 CG1 ILE A 710 115.297 101.347 160.291 1.00102.50 C
ATOM 3862 CG2 ILE A 710 116.594 101.647 158.246 1.00102.50 C
ATOM 3863 CD1 ILE A 710 116.464 101.077 161.197 1.00102.50 C
ATOM 3864 N SER A 711 114.628 100.981 155.666 1.00 93.18 N
ATOM 3865 CA SER A 711 114.926 100.391 154.372 1.00 93.18 C
ATOM 3866 C SER A 711 116.347 99.839 154.353 1.00 93.18 C
ATOM 3867 O SER A 711 117.148 100.097 155.252 1.00 93.18 O
ATOM 3868 CB SER A 711 114.744 101.413 153.251 1.00 93.18 C
ATOM 3869 OG SER A 711 115.707 102.443 153.342 1.00 93.18 O
ATOM 3870 N PHE A 712 116.649 99.059 153.320 1.00 89.93 N
ATOM 3871 CA PHE A 712 117.934 98.388 153.199 1.00 89.93 C
ATOM 3872 C PHE A 712 118.339 98.267 151.739 1.00 89.93 C
ATOM 3873 O PHE A 712 117.675 98.792 150.842 1.00 89.93 O
ATOM 3874 CB PHE A 712 117.902 96.992 153.815 1.00 89.93 C
ATOM 3875 CG PHE A 712 117.877 96.988 155.304 1.00 89.93 C
ATOM 3876 CD1 PHE A 712 119.048 97.119 156.022 1.00 89.93 C
ATOM 3877 CD2 PHE A 712 116.688 96.844 155.991 1.00 89.93 C
ATOM 3878 CE1 PHE A 712 119.035 97.108 157.403 1.00 89.93 C
ATOM 3879 CE2 PHE A 712 116.667 96.838 157.373 1.00 89.93 C
ATOM 3880 CZ PHE A 712 117.842 96.970 158.078 1.00 89.93 C
ATOM 3881 N ARG A 713 119.452 97.575 151.519 1.00 85.66 N
ATOM 3882 CA ARG A 713 119.862 97.206 150.174 1.00 85.66 C
ATOM 3883 C ARG A 713 119.433 95.777 149.868 1.00 85.66 C
ATOM 3884 O ARG A 713 119.672 94.858 150.657 1.00 85.66 O
ATOM 3885 CB ARG A 713 121.372 97.329 150.038 1.00 85.66 C
ATOM 3886 CG ARG A 713 121.889 98.733 150.209 1.00 85.66 C
ATOM 3887 CD ARG A 713 123.393 98.717 150.169 1.00 85.66 C
ATOM 3888 NE ARG A 713 123.975 100.028 150.414 1.00 85.66 N
ATOM 3889 CZ ARG A 713 125.280 100.241 150.531 1.00 85.66 C
ATOM 3890 NH1 ARG A 713 126.128 99.228 150.428 1.00 85.66 N
ATOM 3891 NH2 ARG A 713 125.739 101.461 150.756 1.00 85.66 N
ATOM 3892 N LYS A 714 118.807 95.587 148.713 1.00 95.91 N
ATOM 3893 CA LYS A 714 118.334 94.265 148.311 1.00 95.91 C
ATOM 3894 C LYS A 714 119.490 93.360 147.897 1.00 95.91 C
ATOM 3895 O LYS A 714 120.533 93.835 147.450 1.00 95.91 O
ATOM 3896 CB LYS A 714 117.326 94.382 147.165 1.00 95.91 C
ATOM 3897 N LYS A 721 116.037 82.781 156.098 1.00128.01 N
ATOM 3898 CA LYS A 721 116.762 83.449 157.170 1.00128.01 C
ATOM 3899 C LYS A 721 117.198 84.843 156.734 1.00128.01 C
ATOM 3900 O LYS A 721 118.388 85.119 156.593 1.00128.01 O
ATOM 3901 CB LYS A 721 117.975 82.621 157.595 1.00128.01 C
ATOM 3902 N LYS A 722 116.219 85.718 156.507 1.00127.27 N
ATOM 3903 CA LYS A 722 116.533 87.075 156.080 1.00127.27 C
ATOM 3904 C LYS A 722 116.715 88.005 157.271 1.00127.27 C
ATOM 3905 O LYS A 722 117.548 88.919 157.235 1.00127.27 O
ATOM 3906 CB LYS A 722 115.438 87.600 155.155 1.00127.27 C
ATOM 3907 N LEU A 723 115.936 87.794 158.336 1.00124.20 N
ATOM 3908 CA LEU A 723 115.938 88.740 159.449 1.00124.20 C
ATOM 3909 C LEU A 723 117.202 88.615 160.292 1.00124.20 C
ATOM 3910 O LEU A 723 117.655 89.598 160.889 1.00124.20 O
ATOM 3911 CB LEU A 723 114.674 88.558 160.291 1.00124.20 C
ATOM 3912 CG LEU A 723 114.322 87.212 160.930 1.00124.20 C
ATOM 3913 CD1 LEU A 723 114.878 87.057 162.345 1.00124.20 C
ATOM 3914 CD2 LEU A 723 112.812 87.019 160.913 1.00124.20 C
ATOM 3915 N PHE A 724 117.795 87.421 160.346 1.00125.75 N
ATOM 3916 CA PHE A 724 119.080 87.281 161.024 1.00125.75 C
ATOM 3917 C PHE A 724 120.178 88.014 160.262 1.00125.75 C
ATOM 3918 O PHE A 724 121.056 88.643 160.870 1.00125.75 O
ATOM 3919 CB PHE A 724 119.436 85.806 161.188 1.00125.75 C
ATOM 3920 CG PHE A 724 120.680 85.577 161.989 1.00125.75 C
ATOM 3921 CD1 PHE A 724 120.658 85.706 163.370 1.00125.75 C
ATOM 3922 CD2 PHE A 724 121.873 85.242 161.367 1.00125.75 C
ATOM 3923 CE1 PHE A 724 121.800 85.499 164.119 1.00125.75 C
ATOM 3924 CE2 PHE A 724 123.023 85.036 162.109 1.00125.75 C
ATOM 3925 CZ PHE A 724 122.985 85.165 163.489 1.00125.75 C
ATOM 3926 N LEU A 725 120.128 87.955 158.926 1.00124.44 N
ATOM 3927 CA LEU A 725 121.009 88.773 158.099 1.00124.44 C
ATOM 3928 C LEU A 725 120.762 90.254 158.333 1.00124.44 C
ATOM 3929 O LEU A 725 121.703 91.055 158.319 1.00124.44 O
ATOM 3930 CB LEU A 725 120.806 88.434 156.626 1.00124.44 C
ATOM 3931 CG LEU A 725 121.240 87.034 156.216 1.00124.44 C
ATOM 3932 CD1 LEU A 725 120.818 86.756 154.787 1.00124.44 C
ATOM 3933 CD2 LEU A 725 122.744 86.900 156.373 1.00124.44 C
ATOM 3934 N TYR A 726 119.501 90.628 158.575 1.00118.70 N
ATOM 3935 CA TYR A 726 119.183 92.017 158.890 1.00118.70 C
ATOM 3936 C TYR A 726 119.812 92.450 160.208 1.00118.70 C
ATOM 3937 O TYR A 726 120.377 93.542 160.292 1.00118.70 O
ATOM 3938 CB TYR A 726 117.670 92.226 158.938 1.00118.70 C
ATOM 3939 CG TYR A 726 116.961 92.156 157.603 1.00118.70 C
ATOM 3940 CD1 TYR A 726 117.668 92.193 156.407 1.00118.70 C
ATOM 3941 CD2 TYR A 726 115.575 92.072 157.544 1.00118.70 C
ATOM 3942 CE1 TYR A 726 117.012 92.130 155.191 1.00118.70 C
ATOM 3943 CE2 TYR A 726 114.912 92.014 156.336 1.00118.70 C
ATOM 3944 CZ TYR A 726 115.635 92.043 155.163 1.00118.70 C
ATOM 3945 OH TYR A 726 114.978 91.985 153.955 1.00118.70 O
ATOM 3946 N TYR A 727 119.746 91.597 161.239 1.00111.76 N
ATOM 3947 CA TYR A 727 120.356 91.938 162.528 1.00111.76 C
ATOM 3948 C TYR A 727 121.875 92.040 162.432 1.00111.76 C
ATOM 3949 O TYR A 727 122.478 92.960 163.006 1.00111.76 O
ATOM 3950 CB TYR A 727 119.989 90.923 163.608 1.00111.76 C
ATOM 3951 CG TYR A 727 118.592 91.039 164.162 1.00111.76 C
ATOM 3952 CD1 TYR A 727 118.228 92.122 164.947 1.00111.76 C
ATOM 3953 CD2 TYR A 727 117.667 90.022 163.984 1.00111.76 C
ATOM 3954 CE1 TYR A 727 116.955 92.222 165.478 1.00111.76 C
ATOM 3955 CE2 TYR A 727 116.396 90.110 164.513 1.00111.76 C
ATOM 3956 CZ TYR A 727 116.047 91.211 165.260 1.00111.76 C
ATOM 3957 OH TYR A 727 114.782 91.298 165.790 1.00111.76 O
ATOM 3958 N VAL A 728 122.510 91.106 161.714 1.00104.34 N
ATOM 3959 CA VAL A 728 123.968 91.135 161.591 1.00104.34 C
ATOM 3960 C VAL A 728 124.415 92.349 160.786 1.00104.34 C
ATOM 3961 O VAL A 728 125.335 93.076 161.189 1.00104.34 O
ATOM 3962 CB VAL A 728 124.480 89.824 160.973 1.00104.34 C
ATOM 3963 CG1 VAL A 728 125.968 89.910 160.711 1.00104.34 C
ATOM 3964 CG2 VAL A 728 124.199 88.674 161.906 1.00104.34 C
ATOM 3965 N SER A 729 123.740 92.619 159.667 1.00100.79 N
ATOM 3966 CA SER A 729 124.064 93.786 158.856 1.00100.79 C
ATOM 3967 C SER A 729 123.744 95.084 159.588 1.00100.79 C
ATOM 3968 O SER A 729 124.355 96.123 159.320 1.00100.79 O
ATOM 3969 CB SER A 729 123.303 93.711 157.537 1.00100.79 C
ATOM 3970 OG SER A 729 121.907 93.774 157.765 1.00100.79 O
ATOM 3971 N PHE A 730 122.792 95.041 160.518 1.00 92.15 N
ATOM 3972 CA PHE A 730 122.488 96.210 161.326 1.00 92.15 C
ATOM 3973 C PHE A 730 123.613 96.509 162.301 1.00 92.15 C
ATOM 3974 O PHE A 730 124.078 97.648 162.396 1.00 92.15 O
ATOM 3975 CB PHE A 730 121.178 95.988 162.072 1.00 92.15 C
ATOM 3976 CG PHE A 730 120.752 97.150 162.908 1.00 92.15 C
ATOM 3977 CD1 PHE A 730 120.198 98.268 162.320 1.00 92.15 C
ATOM 3978 CD2 PHE A 730 120.888 97.117 164.282 1.00 92.15 C
ATOM 3979 CE1 PHE A 730 119.797 99.338 163.087 1.00 92.15 C
ATOM 3980 CE2 PHE A 730 120.488 98.184 165.054 1.00 92.15 C
ATOM 3981 CZ PHE A 730 119.942 99.295 164.455 1.00 92.15 C
ATOM 3982 N PHE A 731 124.071 95.499 163.037 1.00 89.44 N
ATOM 3983 CA PHE A 731 125.071 95.779 164.064 1.00 89.44 C
ATOM 3984 C PHE A 731 126.480 95.858 163.494 1.00 89.44 C
ATOM 3985 O PHE A 731 127.419 96.212 164.213 1.00 89.44 O
ATOM 3986 CB PHE A 731 125.007 94.745 165.178 1.00 89.44 C
ATOM 3987 CG PHE A 731 123.864 94.946 166.108 1.00 89.44 C
ATOM 3988 CD1 PHE A 731 123.940 95.897 167.109 1.00 89.44 C
ATOM 3989 CD2 PHE A 731 122.711 94.196 165.987 1.00 89.44 C
ATOM 3990 CE1 PHE A 731 122.886 96.093 167.979 1.00 89.44 C
ATOM 3991 CE2 PHE A 731 121.651 94.386 166.852 1.00 89.44 C
ATOM 3992 CZ PHE A 731 121.740 95.336 167.850 1.00 89.44 C
ATOM 3993 N THR A 732 126.665 95.520 162.218 1.00 86.74 N
ATOM 3994 CA THR A 732 127.991 95.722 161.643 1.00 86.74 C
ATOM 3995 C THR A 732 128.150 97.102 161.027 1.00 86.74 C
ATOM 3996 O THR A 732 129.254 97.469 160.618 1.00 86.74 O
ATOM 3997 CB THR A 732 128.307 94.652 160.608 1.00 86.74 C
ATOM 3998 OG1 THR A 732 127.224 94.552 159.676 1.00 86.74 O
ATOM 3999 CG2 THR A 732 128.576 93.319 161.282 1.00 86.74 C
ATOM 4000 N SER A 733 127.079 97.870 160.932 1.00 76.20 N
ATOM 4001 CA SER A 733 127.210 99.235 160.447 1.00 76.20 C
ATOM 4002 C SER A 733 127.850 100.100 161.522 1.00 76.20 C
ATOM 4003 O SER A 733 127.358 100.129 162.655 1.00 76.20 O
ATOM 4004 CB SER A 733 125.855 99.810 160.062 1.00 76.20 C
ATOM 4005 OG SER A 733 126.002 101.148 159.624 1.00 76.20 O
ATOM 4006 N PRO A 734 128.916 100.832 161.208 1.00 68.56 N
ATOM 4007 CA PRO A 734 129.712 101.450 162.278 1.00 68.56 C
ATOM 4008 C PRO A 734 129.052 102.645 162.943 1.00 68.56 C
ATOM 4009 O PRO A 734 129.479 103.042 164.034 1.00 68.56 O
ATOM 4010 CB PRO A 734 131.001 101.838 161.554 1.00 68.56 C
ATOM 4011 CG PRO A 734 130.587 102.047 160.163 1.00 68.56 C
ATOM 4012 CD PRO A 734 129.503 101.063 159.883 1.00 68.56 C
ATOM 4013 N PHE A 735 128.026 103.230 162.319 1.00 70.32 N
ATOM 4014 CA PHE A 735 127.320 104.355 162.930 1.00 70.32 C
ATOM 4015 C PHE A 735 126.585 103.932 164.189 1.00 70.32 C
ATOM 4016 O PHE A 735 126.641 104.619 165.221 1.00 70.32 O
ATOM 4017 CB PHE A 735 126.345 104.951 161.924 1.00 70.32 C
ATOM 4018 CG PHE A 735 125.493 106.037 162.484 1.00 70.32 C
ATOM 4019 CD1 PHE A 735 126.037 107.267 162.787 1.00 70.32 C
ATOM 4020 CD2 PHE A 735 124.142 105.838 162.678 1.00 70.32 C
ATOM 4021 CE1 PHE A 735 125.251 108.277 163.294 1.00 70.32 C
ATOM 4022 CE2 PHE A 735 123.352 106.842 163.180 1.00 70.32 C
ATOM 4023 CZ PHE A 735 123.908 108.063 163.491 1.00 70.32 C
ATOM 4024 N VAL A 736 125.906 102.788 164.120 1.00 70.22 N
ATOM 4025 CA VAL A 736 125.202 102.243 165.272 1.00 70.22 C
ATOM 4026 C VAL A 736 126.195 101.859 166.355 1.00 70.22 C
ATOM 4027 O VAL A 736 125.933 102.023 167.553 1.00 70.22 O
ATOM 4028 CB VAL A 736 124.356 101.042 164.823 1.00 70.22 C
ATOM 4029 CG1 VAL A 736 123.510 100.524 165.953 1.00 70.22 C
ATOM 4030 CG2 VAL A 736 123.519 101.424 163.633 1.00 70.22 C
ATOM 4031 N VAL A 737 127.376 101.405 165.940 1.00 70.02 N
ATOM 4032 CA VAL A 737 128.421 101.030 166.879 1.00 70.02 C
ATOM 4033 C VAL A 737 128.936 102.252 167.617 1.00 70.02 C
ATOM 4034 O VAL A 737 129.126 102.217 168.835 1.00 70.02 O
ATOM 4035 CB VAL A 737 129.548 100.309 166.130 1.00 70.02 C
ATOM 4036 CG1 VAL A 737 130.635 99.880 167.085 1.00 70.02 C
ATOM 4037 CG2 VAL A 737 128.978 99.139 165.381 1.00 70.02 C
ATOM 4038 N PHE A 738 129.225 103.308 166.866 1.00 71.63 N
ATOM 4039 CA PHE A 738 129.731 104.530 167.466 1.00 71.63 C
ATOM 4040 C PHE A 738 128.695 105.128 168.398 1.00 71.63 C
ATOM 4041 O PHE A 738 129.017 105.577 169.495 1.00 71.63 O
ATOM 4042 CB PHE A 738 130.112 105.552 166.400 1.00 71.63 C
ATOM 4043 CG PHE A 738 130.391 106.915 166.952 1.00 71.63 C
ATOM 4044 CD1 PHE A 738 131.570 107.172 167.626 1.00 71.63 C
ATOM 4045 CD2 PHE A 738 129.471 107.935 166.810 1.00 71.63 C
ATOM 4046 CE1 PHE A 738 131.830 108.427 168.142 1.00 71.63 C
ATOM 4047 CE2 PHE A 738 129.723 109.192 167.322 1.00 71.63 C
ATOM 4048 CZ PHE A 738 130.905 109.438 167.990 1.00 71.63 C
ATOM 4049 N SER A 739 127.442 105.118 167.963 1.00 74.94 N
ATOM 4050 CA SER A 739 126.366 105.654 168.779 1.00 74.94 C
ATOM 4051 C SER A 739 126.230 104.833 170.047 1.00 74.94 C
ATOM 4052 O SER A 739 126.059 105.374 171.135 1.00 74.94 O
ATOM 4053 CB SER A 739 125.053 105.626 168.008 1.00 74.94 C
ATOM 4054 OG SER A 739 124.704 104.296 167.675 1.00 74.94 O
ATOM 4055 N TRP A 740 126.318 103.516 169.902 1.00 78.55 N
ATOM 4056 CA TRP A 740 126.210 102.629 171.044 1.00 78.55 C
ATOM 4057 C TRP A 740 127.352 102.867 172.015 1.00 78.55 C
ATOM 4058 O TRP A 740 127.152 102.880 173.226 1.00 78.55 O
ATOM 4059 CB TRP A 740 126.212 101.169 170.603 1.00 78.55 C
ATOM 4060 CG TRP A 740 125.652 100.264 171.639 1.00 78.55 C
ATOM 4061 CD1 TRP A 740 126.127 100.072 172.901 1.00 78.55 C
ATOM 4062 CD2 TRP A 740 124.501 99.427 171.512 1.00 78.55 C
ATOM 4063 NE1 TRP A 740 125.343 99.165 173.569 1.00 78.55 N
ATOM 4064 CE2 TRP A 740 124.337 98.754 172.737 1.00 78.55 C
ATOM 4065 CE3 TRP A 740 123.593 99.180 170.480 1.00 78.55 C
ATOM 4066 CZ2 TRP A 740 123.304 97.850 172.957 1.00 78.55 C
ATOM 4067 CZ3 TRP A 740 122.569 98.283 170.700 1.00 78.55 C
ATOM 4068 CH2 TRP A 740 122.432 97.628 171.928 1.00 78.55 C
ATOM 4069 N ASN A 741 128.550 103.069 171.482 1.00 75.18 N
ATOM 4070 CA ASN A 741 129.704 103.287 172.334 1.00 75.18 C
ATOM 4071 C ASN A 741 129.542 104.536 173.174 1.00 75.18 C
ATOM 4072 O ASN A 741 129.825 104.524 174.367 1.00 75.18 O
ATOM 4073 CB ASN A 741 130.972 103.404 171.495 1.00 75.18 C
ATOM 4074 CG ASN A 741 131.408 102.080 170.912 1.00 75.18 C
ATOM 4075 OD1 ASN A 741 131.332 101.045 171.572 1.00 75.18 O
ATOM 4076 ND2 ASN A 741 131.875 102.104 169.671 1.00 75.18 N
ATOM 4077 N VAL A 742 129.062 105.611 172.562 1.00 72.97 N
ATOM 4078 CA VAL A 742 128.881 106.847 173.302 1.00 72.97 C
ATOM 4079 C VAL A 742 127.849 106.657 174.401 1.00 72.97 C
ATOM 4080 O VAL A 742 128.040 107.109 175.528 1.00 72.97 O
ATOM 4081 CB VAL A 742 128.451 108.000 172.385 1.00 72.97 C
ATOM 4082 CG1 VAL A 742 128.039 109.204 173.214 1.00 72.97 C
ATOM 4083 CG2 VAL A 742 129.579 108.363 171.437 1.00 72.97 C
ATOM 4084 N ILE A 743 126.731 106.023 174.062 1.00 76.26 N
ATOM 4085 CA ILE A 743 125.682 105.783 175.043 1.00 76.26 C
ATOM 4086 C ILE A 743 126.202 104.873 176.146 1.00 76.26 C
ATOM 4087 O ILE A 743 125.944 105.097 177.328 1.00 76.26 O
ATOM 4088 CB ILE A 743 124.443 105.136 174.400 1.00 76.26 C
ATOM 4089 CG1 ILE A 743 123.864 106.049 173.319 1.00 76.26 C
ATOM 4090 CG2 ILE A 743 123.394 104.829 175.457 1.00 76.26 C
ATOM 4091 CD1 ILE A 743 122.625 105.495 172.651 1.00 76.26 C
ATOM 4092 N PHE A 744 126.942 103.844 175.747 1.00 81.92 N
ATOM 4093 CA PHE A 744 127.517 102.900 176.694 1.00 81.92 C
ATOM 4094 C PHE A 744 128.529 103.600 177.592 1.00 81.92 C
ATOM 4095 O PHE A 744 128.591 103.349 178.794 1.00 81.92 O
ATOM 4096 CB PHE A 744 128.181 101.738 175.955 1.00 81.92 C
ATOM 4097 CG PHE A 744 128.503 100.566 176.835 1.00 81.92 C
ATOM 4098 CD1 PHE A 744 127.610 99.515 176.966 1.00 81.92 C
ATOM 4099 CD2 PHE A 744 129.697 100.514 177.534 1.00 81.92 C
ATOM 4100 CE1 PHE A 744 127.902 98.434 177.775 1.00 81.92 C
ATOM 4101 CE2 PHE A 744 129.996 99.436 178.346 1.00 81.92 C
ATOM 4102 CZ PHE A 744 129.097 98.395 178.467 1.00 81.92 C
ATOM 4103 N TYR A 745 129.319 104.484 176.991 1.00 77.66 N
ATOM 4104 CA TYR A 745 130.342 105.226 177.715 1.00 77.66 C
ATOM 4105 C TYR A 745 129.729 106.126 178.781 1.00 77.66 C
ATOM 4106 O TYR A 745 130.258 106.241 179.886 1.00 77.66 O
ATOM 4107 CB TYR A 745 131.184 106.057 176.745 1.00 77.66 C
ATOM 4108 CG TYR A 745 132.496 106.533 177.325 1.00 77.66 C
ATOM 4109 CD1 TYR A 745 133.676 105.846 177.076 1.00 77.66 C
ATOM 4110 CD2 TYR A 745 132.555 107.668 178.121 1.00 77.66 C
ATOM 4111 CE1 TYR A 745 134.878 106.276 177.603 1.00 77.66 C
ATOM 4112 CE2 TYR A 745 133.753 108.106 178.652 1.00 77.66 C
ATOM 4113 CZ TYR A 745 134.911 107.406 178.390 1.00 77.66 C
ATOM 4114 OH TYR A 745 136.106 107.838 178.917 1.00 77.66 O
ATOM 4115 N ILE A 746 128.611 106.762 178.446 1.00 80.02 N
ATOM 4116 CA ILE A 746 127.935 107.651 179.382 1.00 80.02 C
ATOM 4117 C ILE A 746 127.473 106.870 180.605 1.00 80.02 C
ATOM 4118 O ILE A 746 127.576 107.347 181.735 1.00 80.02 O
ATOM 4119 CB ILE A 746 126.724 108.343 178.732 1.00 30.00 C
ATOM 4120 CG1 ILE A 746 127.155 109.098 177.473 1.00 30.00 C
ATOM 4121 CG2 ILE A 746 126.056 109.285 179.721 1.00 30.00 C
ATOM 4122 CD1 ILE A 746 126.022 109.818 176.775 1.00 30.00 C
ATOM 4123 N ALA A 747 126.962 105.667 180.370 1.00 82.21 N
ATOM 4124 CA ALA A 747 126.497 104.803 181.455 1.00 82.21 C
ATOM 4125 C ALA A 747 127.657 104.325 182.322 1.00 82.21 C
ATOM 4126 O ALA A 747 127.523 104.217 183.549 1.00 82.21 O
ATOM 4127 CB ALA A 747 125.731 103.612 180.887 1.00 82.21 C
ATOM 4128 N PHE A 748 128.796 104.028 181.692 1.00 85.44 N
ATOM 4129 CA PHE A 748 130.021 103.710 182.413 1.00 85.44 C
ATOM 4130 C PHE A 748 130.439 104.844 183.326 1.00 85.44 C
ATOM 4131 O PHE A 748 130.870 104.609 184.459 1.00 85.44 O
ATOM 4132 CB PHE A 748 131.139 103.416 181.422 1.00 85.44 C
ATOM 4133 CG PHE A 748 132.481 103.278 182.060 1.00 85.44 C
ATOM 4134 CD1 PHE A 748 132.780 102.176 182.828 1.00 85.44 C
ATOM 4135 CD2 PHE A 748 133.450 104.244 181.876 1.00 85.44 C
ATOM 4136 CE1 PHE A 748 134.018 102.044 183.417 1.00 85.44 C
ATOM 4137 CE2 PHE A 748 134.686 104.117 182.460 1.00 85.44 C
ATOM 4138 CZ PHE A 748 134.971 103.018 183.230 1.00 85.44 C
ATOM 4139 N LEU A 749 130.321 106.078 182.842 1.00 85.90 N
ATOM 4140 CA LEU A 749 130.726 107.224 183.645 1.00 85.90 C
ATOM 4141 C LEU A 749 129.805 107.395 184.847 1.00 85.90 C
ATOM 4142 O LEU A 749 130.265 107.699 185.958 1.00 85.90 O
ATOM 4143 CB LEU A 749 130.730 108.476 182.778 1.00 85.90 C
ATOM 4144 CG LEU A 749 131.502 109.631 183.386 1.00 85.90 C
ATOM 4145 CD1 LEU A 749 132.953 109.223 183.460 1.00 85.90 C
ATOM 4146 CD2 LEU A 749 131.338 110.860 182.535 1.00 85.90 C
ATOM 4147 N LEU A 750 128.503 107.158 184.645 1.00 89.58 N
ATOM 4148 CA LEU A 750 127.550 107.215 185.752 1.00 89.58 C
ATOM 4149 C LEU A 750 127.836 106.146 186.797 1.00 89.58 C
ATOM 4150 O LEU A 750 127.796 106.422 188.004 1.00 89.58 O
ATOM 4151 CB LEU A 750 126.125 107.067 185.231 1.00 89.58 C
ATOM 4152 CG LEU A 750 125.558 108.249 184.453 1.00 89.58 C
ATOM 4153 CD1 LEU A 750 124.228 107.895 183.825 1.00 89.58 C
ATOM 4154 CD2 LEU A 750 125.394 109.429 185.387 1.00 89.58 C
ATOM 4155 N LEU A 751 128.140 104.926 186.353 1.00 91.99 N
ATOM 4156 CA LEU A 751 128.426 103.851 187.298 1.00 91.99 C
ATOM 4157 C LEU A 751 129.729 104.113 188.041 1.00 91.99 C
ATOM 4158 O LEU A 751 129.856 103.782 189.228 1.00 91.99 O
ATOM 4159 CB LEU A 751 128.477 102.514 186.559 1.00 91.99 C
ATOM 4160 CG LEU A 751 128.394 101.189 187.319 1.00 91.99 C
ATOM 4161 CD1 LEU A 751 127.735 100.170 186.411 1.00 91.99 C
ATOM 4162 CD2 LEU A 751 129.736 100.666 187.795 1.00 91.99 C
ATOM 4163 N PHE A 752 130.701 104.719 187.355 1.00 92.76 N
ATOM 4164 CA PHE A 752 131.967 105.080 187.982 1.00 92.76 C
ATOM 4165 C PHE A 752 131.744 106.118 189.069 1.00 92.76 C
ATOM 4166 O PHE A 752 132.322 106.025 190.159 1.00 92.76 O
ATOM 4167 CB PHE A 752 132.917 105.599 186.905 1.00 92.76 C
ATOM 4168 CG PHE A 752 134.350 105.663 187.317 1.00 92.76 C
ATOM 4169 CD1 PHE A 752 135.106 104.514 187.372 1.00 92.76 C
ATOM 4170 CD2 PHE A 752 134.954 106.866 187.602 1.00 92.76 C
ATOM 4171 CE1 PHE A 752 136.430 104.568 187.724 1.00 92.76 C
ATOM 4172 CE2 PHE A 752 136.278 106.930 187.950 1.00 92.76 C
ATOM 4173 CZ PHE A 752 137.017 105.780 188.013 1.00 92.76 C
ATOM 4174 N ALA A 753 130.859 107.084 188.803 1.00 97.66 N
ATOM 4175 CA ALA A 753 130.512 108.086 189.806 1.00 97.66 C
ATOM 4176 C ALA A 753 129.792 107.459 190.995 1.00 97.66 C
ATOM 4177 O ALA A 753 130.027 107.842 192.151 1.00 97.66 O
ATOM 4178 CB ALA A 753 129.649 109.175 189.172 1.00 97.66 C
ATOM 4179 N TYR A 754 128.909 106.493 190.725 1.00 98.38 N
ATOM 4180 CA TYR A 754 128.170 105.843 191.805 1.00 98.38 C
ATOM 4181 C TYR A 754 129.090 105.027 192.702 1.00 98.38 C
ATOM 4182 O TYR A 754 128.885 104.964 193.919 1.00 98.38 O
ATOM 4183 CB TYR A 754 127.063 104.957 191.241 1.00 98.38 C
ATOM 4184 CG TYR A 754 126.303 104.225 192.319 1.00 98.38 C
ATOM 4185 CD1 TYR A 754 125.430 104.902 193.155 1.00 98.38 C
ATOM 4186 CD2 TYR A 754 126.461 102.859 192.503 1.00 98.38 C
ATOM 4187 CE1 TYR A 754 124.736 104.240 194.146 1.00 98.38 C
ATOM 4188 CE2 TYR A 754 125.772 102.187 193.491 1.00 98.38 C
ATOM 4189 CZ TYR A 754 124.912 102.884 194.308 1.00 98.38 C
ATOM 4190 OH TYR A 754 124.219 102.225 195.293 1.00 98.38 O
ATOM 4191 N VAL A 755 130.111 104.399 192.124 1.00101.56 N
ATOM 4192 CA VAL A 755 131.060 103.658 192.947 1.00101.56 C
ATOM 4193 C VAL A 755 131.963 104.619 193.714 1.00101.56 C
ATOM 4194 O VAL A 755 132.309 104.371 194.876 1.00101.56 O
ATOM 4195 CB VAL A 755 131.856 102.670 192.076 1.00101.56 C
ATOM 4196 CG1 VAL A 755 132.939 101.961 192.871 1.00101.56 C
ATOM 4197 CG2 VAL A 755 130.919 101.642 191.487 1.00101.56 C
ATOM 4198 N LEU A 756 132.316 105.757 193.100 1.00 97.26 N
ATOM 4199 CA LEU A 756 133.144 106.750 193.788 1.00 97.26 C
ATOM 4200 C LEU A 756 132.412 107.386 194.962 1.00 97.26 C
ATOM 4201 O LEU A 756 133.039 107.842 195.924 1.00 97.26 O
ATOM 4202 CB LEU A 756 133.602 107.834 192.821 1.00 97.26 C
ATOM 4203 CG LEU A 756 134.731 107.446 191.883 1.00 97.26 C
ATOM 4204 CD1 LEU A 756 134.976 108.562 190.896 1.00 97.26 C
ATOM 4205 CD2 LEU A 756 135.966 107.166 192.699 1.00 97.26 C
ATOM 4206 N LEU A 757 131.084 107.444 194.896 1.00103.54 N
ATOM 4207 CA LEU A 757 130.345 107.956 196.043 1.00103.54 C
ATOM 4208 C LEU A 757 130.018 106.845 197.034 1.00103.54 C
ATOM 4209 O LEU A 757 130.083 107.053 198.251 1.00103.54 O
ATOM 4210 CB LEU A 757 129.084 108.667 195.570 1.00103.54 C
ATOM 4211 CG LEU A 757 129.414 109.935 194.789 1.00103.54 C
ATOM 4212 CD1 LEU A 757 128.158 110.542 194.216 1.00103.54 C
ATOM 4213 CD2 LEU A 757 130.122 110.919 195.693 1.00103.54 C
ATOM 4214 N MET A 758 129.650 105.667 196.539 1.00111.84 N
ATOM 4215 CA MET A 758 129.383 104.498 197.380 1.00111.84 C
ATOM 4216 C MET A 758 130.597 103.571 197.384 1.00111.84 C
ATOM 4217 O MET A 758 130.567 102.466 196.839 1.00111.84 O
ATOM 4218 CB MET A 758 128.135 103.770 196.891 1.00111.84 C
ATOM 4219 CG MET A 758 126.814 104.397 197.311 1.00111.84 C
ATOM 4220 SD MET A 758 126.529 106.065 196.684 1.00111.84 S
ATOM 4221 CE MET A 758 126.685 107.032 198.181 1.00111.84 C
ATOM 4222 N ASP A 759 131.676 104.026 198.017 1.00121.33 N
ATOM 4223 CA ASP A 759 132.925 103.276 198.091 1.00121.33 C
ATOM 4224 C ASP A 759 133.104 102.773 199.516 1.00121.33 C
ATOM 4225 O ASP A 759 132.924 103.532 200.473 1.00121.33 O
ATOM 4226 CB ASP A 759 134.118 104.138 197.674 1.00121.33 C
ATOM 4227 CG ASP A 759 135.376 103.321 197.415 1.00121.33 C
ATOM 4228 OD1 ASP A 759 135.338 102.080 197.541 1.00121.33 O
ATOM 4229 OD2 ASP A 759 136.413 103.928 197.079 1.00121.33 O1-
ATOM 4230 N PHE A 760 133.456 101.499 199.648 1.00125.65 N
ATOM 4231 CA PHE A 760 133.655 100.889 200.949 1.00125.65 C
ATOM 4232 C PHE A 760 135.157 100.851 201.255 1.00125.65 C
ATOM 4233 O PHE A 760 135.992 101.279 200.454 1.00125.65 O
ATOM 4234 CB PHE A 760 132.973 99.516 200.963 1.00125.65 C
ATOM 4235 CG PHE A 760 132.825 98.909 202.329 1.00125.65 C
ATOM 4236 CD1 PHE A 760 131.949 99.456 203.249 1.00125.65 C
ATOM 4237 CD2 PHE A 760 133.554 97.783 202.683 1.00125.65 C
ATOM 4238 CE1 PHE A 760 131.815 98.904 204.509 1.00125.65 C
ATOM 4239 CE2 PHE A 760 133.424 97.223 203.940 1.00125.65 C
ATOM 4240 CZ PHE A 760 132.553 97.783 204.854 1.00125.65 C
ATOM 4241 N GLN A 761 135.515 100.333 202.427 1.00129.10 N
ATOM 4242 CA GLN A 761 136.892 100.179 202.876 1.00129.10 C
ATOM 4243 C GLN A 761 137.456 98.900 202.235 1.00129.10 C
ATOM 4244 O GLN A 761 136.843 98.359 201.312 1.00129.10 O
ATOM 4245 CB GLN A 761 136.916 100.214 204.414 1.00129.10 C
ATOM 4246 CG GLN A 761 138.241 100.632 205.068 1.00129.10 C
ATOM 4247 CD GLN A 761 138.148 100.713 206.576 1.00129.10 C
ATOM 4248 OE1 GLN A 761 137.125 100.369 207.165 1.00129.10 O
ATOM 4249 NE2 GLN A 761 139.212 101.194 207.209 1.00129.10 N
ATOM 4250 N LYS A 762 138.578 98.383 202.769 1.00130.22 N
ATOM 4251 CA LYS A 762 139.634 97.515 202.176 1.00130.22 C
ATOM 4252 C LYS A 762 139.072 96.494 201.182 1.00130.22 C
ATOM 4253 O LYS A 762 139.648 96.338 200.098 1.00130.22 O
ATOM 4254 CB LYS A 762 140.418 96.922 203.341 1.00130.22 C
ATOM 4255 N GLU A 763 137.992 95.788 201.499 1.00127.32 N
ATOM 4256 CA GLU A 763 137.425 94.833 200.560 1.00127.32 C
ATOM 4257 C GLU A 763 136.541 95.531 199.530 1.00127.32 C
ATOM 4258 O GLU A 763 135.556 96.183 199.882 1.00127.32 O
ATOM 4259 CB GLU A 763 136.616 93.780 201.307 1.00127.32 C
ATOM 4260 N PRO A 764 136.870 95.406 198.244 1.00127.59 N
ATOM 4261 CA PRO A 764 136.020 96.010 197.211 1.00127.59 C
ATOM 4262 C PRO A 764 134.823 95.131 196.875 1.00127.59 C
ATOM 4263 O PRO A 764 134.910 93.901 196.866 1.00127.59 O
ATOM 4264 CB PRO A 764 136.967 96.145 196.014 1.00127.59 C
ATOM 4265 CG PRO A 764 137.927 95.029 196.186 1.00127.59 C
ATOM 4266 CD PRO A 764 138.109 94.850 197.672 1.00127.59 C
ATOM 4267 N THR A 765 133.696 95.778 196.590 1.00126.04 N
ATOM 4268 CA THR A 765 132.500 95.056 196.184 1.00126.04 C
ATOM 4269 C THR A 765 132.601 94.617 194.725 1.00126.04 C
ATOM 4270 O THR A 765 133.587 94.879 194.031 1.00126.04 O
ATOM 4271 CB THR A 765 131.258 95.921 196.367 1.00126.04 C
ATOM 4272 OG1 THR A 765 131.342 97.058 195.501 1.00126.04 O
ATOM 4273 CG2 THR A 765 131.158 96.396 197.798 1.00126.04 C
ATOM 4274 N ALA A 766 131.542 93.949 194.256 1.00125.09 N
ATOM 4275 CA ALA A 766 131.532 93.418 192.895 1.00125.09 C
ATOM 4276 C ALA A 766 131.426 94.529 191.856 1.00125.09 C
ATOM 4277 O ALA A 766 131.828 94.348 190.699 1.00125.09 O
ATOM 4278 CB ALA A 766 130.386 92.422 192.732 1.00125.09 C
ATOM 4279 N LEU A 767 130.872 95.681 192.251 1.00118.54 N
ATOM 4280 CA LEU A 767 130.749 96.815 191.340 1.00118.54 C
ATOM 4281 C LEU A 767 132.116 97.348 190.932 1.00118.54 C
ATOM 4282 O LEU A 767 132.361 97.618 189.745 1.00118.54 O
ATOM 4283 CB LEU A 767 129.917 97.913 192.000 1.00118.54 C
ATOM 4284 CG LEU A 767 128.465 97.523 192.270 1.00118.54 C
ATOM 4285 CD1 LEU A 767 127.749 98.590 193.074 1.00118.54 C
ATOM 4286 CD2 LEU A 767 127.751 97.273 190.959 1.00118.54 C
ATOM 4287 N GLU A 768 133.025 97.485 191.904 1.00115.10 N
ATOM 4288 CA GLU A 768 134.385 97.919 191.607 1.00115.10 C
ATOM 4289 C GLU A 768 135.099 96.911 190.717 1.00115.10 C
ATOM 4290 O GLU A 768 135.857 97.297 189.819 1.00115.10 O
ATOM 4291 CB GLU A 768 135.161 98.139 192.904 1.00115.10 C
ATOM 4292 N ILE A 769 134.825 95.619 190.921 1.00114.60 N
ATOM 4293 CA ILE A 769 135.406 94.565 190.091 1.00114.60 C
ATOM 4294 C ILE A 769 134.917 94.685 188.655 1.00114.60 C
ATOM 4295 O ILE A 769 135.693 94.523 187.699 1.00114.60 O
ATOM 4296 CB ILE A 769 135.072 93.188 190.693 1.00114.60 C
ATOM 4297 CG1 ILE A 769 135.603 93.107 192.121 1.00114.60 C
ATOM 4298 CG2 ILE A 769 135.680 92.071 189.865 1.00114.60 C
ATOM 4299 CD1 ILE A 769 135.070 91.938 192.903 1.00114.60 C
ATOM 4300 N ILE A 770 133.627 94.997 188.485 1.00108.11 N
ATOM 4301 CA ILE A 770 133.068 95.229 187.156 1.00108.11 C
ATOM 4302 C ILE A 770 133.740 96.427 186.499 1.00108.11 C
ATOM 4303 O ILE A 770 134.017 96.418 185.290 1.00108.11 O
ATOM 4304 CB ILE A 770 131.544 95.416 187.246 1.00108.11 C
ATOM 4305 N LEU A 771 134.040 97.461 187.294 1.00105.92 N
ATOM 4306 CA LEU A 771 134.790 98.605 186.776 1.00105.92 C
ATOM 4307 C LEU A 771 136.187 98.210 186.314 1.00105.92 C
ATOM 4308 O LEU A 771 136.649 98.680 185.265 1.00105.92 O
ATOM 4309 CB LEU A 771 134.896 99.713 187.820 1.00105.92 C
ATOM 4310 CG LEU A 771 133.666 100.549 188.126 1.00105.92 C
ATOM 4311 CD1 LEU A 771 133.988 101.485 189.257 1.00105.92 C
ATOM 4312 CD2 LEU A 771 133.282 101.331 186.902 1.00105.92 C
ATOM 4313 N TYR A 772 136.874 97.355 187.081 1.00107.83 N
ATOM 4314 CA TYR A 772 138.228 96.972 186.689 1.00107.83 C
ATOM 4315 C TYR A 772 138.206 96.136 185.418 1.00107.83 C
ATOM 4316 O TYR A 772 139.099 96.257 184.571 1.00107.83 O
ATOM 4317 CB TYR A 772 138.948 96.201 187.795 1.00107.83 C
ATOM 4318 CG TYR A 772 139.102 96.930 189.106 1.00107.83 C
ATOM 4319 CD1 TYR A 772 139.755 98.149 189.174 1.00107.83 C
ATOM 4320 CD2 TYR A 772 138.721 96.327 190.295 1.00107.83 C
ATOM 4321 CE1 TYR A 772 139.914 98.799 190.377 1.00107.83 C
ATOM 4322 CE2 TYR A 772 138.876 96.969 191.499 1.00107.83 C
ATOM 4323 CZ TYR A 772 139.480 98.199 191.536 1.00107.83 C
ATOM 4324 OH TYR A 772 139.650 98.834 192.737 1.00107.83 O
ATOM 4325 N VAL A 773 137.163 95.320 185.249 1.00107.14 N
ATOM 4326 CA VAL A 773 137.015 94.542 184.021 1.00107.14 C
ATOM 4327 C VAL A 773 136.773 95.458 182.824 1.00107.14 C
ATOM 4328 O VAL A 773 137.362 95.266 181.751 1.00107.14 O
ATOM 4329 CB VAL A 773 135.894 93.501 184.187 1.00107.14 C
ATOM 4330 CG1 VAL A 773 135.591 92.809 182.871 1.00107.14 C
ATOM 4331 CG2 VAL A 773 136.303 92.469 185.209 1.00107.14 C
ATOM 4332 N LEU A 774 135.938 96.488 183.000 1.00104.09 N
ATOM 4333 CA LEU A 774 135.667 97.413 181.898 1.00104.09 C
ATOM 4334 C LEU A 774 136.909 98.210 181.507 1.00104.09 C
ATOM 4335 O LEU A 774 137.182 98.413 180.313 1.00104.09 O
ATOM 4336 CB LEU A 774 134.522 98.350 182.279 1.00104.09 C
ATOM 4337 CG LEU A 774 133.165 97.653 182.356 1.00104.09 C
ATOM 4338 CD1 LEU A 774 132.094 98.569 182.907 1.00104.09 C
ATOM 4339 CD2 LEU A 774 132.778 97.144 180.985 1.00104.09 C
ATOM 4340 N VAL A 775 137.701 98.629 182.493 1.00101.09 N
ATOM 4341 CA VAL A 775 138.922 99.363 182.170 1.00101.09 C
ATOM 4342 C VAL A 775 139.954 98.425 181.546 1.00101.09 C
ATOM 4343 O VAL A 775 140.748 98.834 180.691 1.00101.09 O
ATOM 4344 CB VAL A 775 139.451 100.089 183.422 1.00101.09 C
ATOM 4345 CG1 VAL A 775 140.721 100.853 183.127 1.00101.09 C
ATOM 4346 CG2 VAL A 775 138.415 101.061 183.919 1.00101.09 C
ATOM 4347 N PHE A 776 139.912 97.139 181.907 1.00100.87 N
ATOM 4348 CA PHE A 776 140.768 96.159 181.243 1.00100.87 C
ATOM 4349 C PHE A 776 140.389 95.981 179.776 1.00100.87 C
ATOM 4350 O PHE A 776 141.262 95.779 178.921 1.00100.87 O
ATOM 4351 CB PHE A 776 140.692 94.825 181.977 1.00100.87 C
ATOM 4352 CG PHE A 776 141.542 93.756 181.372 1.00100.87 C
ATOM 4353 CD1 PHE A 776 142.915 93.770 181.545 1.00100.87 C
ATOM 4354 CD2 PHE A 776 140.970 92.735 180.631 1.00100.87 C
ATOM 4355 CE1 PHE A 776 143.705 92.784 180.988 1.00100.87 C
ATOM 4356 CE2 PHE A 776 141.750 91.748 180.074 1.00100.87 C
ATOM 4357 CZ PHE A 776 143.121 91.771 180.251 1.00100.87 C
ATOM 4358 N ILE A 777 139.087 96.037 179.477 1.00102.71 N
ATOM 4359 CA ILE A 777 138.619 96.029 178.088 1.00102.71 C
ATOM 4360 C ILE A 777 139.181 97.230 177.336 1.00102.71 C
ATOM 4361 O ILE A 777 139.676 97.110 176.201 1.00102.71 O
ATOM 4362 CB ILE A 777 137.080 96.015 178.045 1.00102.71 C
ATOM 4363 CG1 ILE A 777 136.534 94.740 178.681 1.00102.71 C
ATOM 4364 CG2 ILE A 777 136.573 96.150 176.623 1.00102.71 C
ATOM 4365 CD1 ILE A 777 135.053 94.786 178.959 1.00102.71 C
ATOM 4366 N LEU A 778 139.128 98.403 177.979 1.00 97.15 N
ATOM 4367 CA LEU A 778 139.735 99.605 177.407 1.00 97.15 C
ATOM 4368 C LEU A 778 141.234 99.437 177.175 1.00 97.15 C
ATOM 4369 O LEU A 778 141.761 99.887 176.151 1.00 97.15 O
ATOM 4370 CB LEU A 778 139.478 100.810 178.308 1.00 97.15 C
ATOM 4371 CG LEU A 778 138.143 101.533 178.255 1.00 97.15 C
ATOM 4372 CD1 LEU A 778 138.066 102.533 179.383 1.00 97.15 C
ATOM 4373 CD2 LEU A 778 138.065 102.249 176.930 1.00 97.15 C
ATOM 4374 N LEU A 779 141.927 98.772 178.102 1.00102.44 N
ATOM 4375 CA LEU A 779 143.370 98.591 177.969 1.00102.44 C
ATOM 4376 C LEU A 779 143.702 97.667 176.812 1.00102.44 C
ATOM 4377 O LEU A 779 144.678 97.897 176.085 1.00102.44 O
ATOM 4378 CB LEU A 779 143.959 98.049 179.269 1.00102.44 C
ATOM 4379 N CYS A 780 142.884 96.628 176.615 1.00106.65 N
ATOM 4380 CA CYS A 780 143.064 95.748 175.464 1.00106.65 C
ATOM 4381 C CYS A 780 142.861 96.502 174.159 1.00106.65 C
ATOM 4382 O CYS A 780 143.621 96.310 173.198 1.00106.65 O
ATOM 4383 CB CYS A 780 142.106 94.565 175.550 1.00106.65 C
ATOM 4384 SG CYS A 780 142.434 93.447 176.922 1.00106.65 S
ATOM 4385 N ASP A 781 141.873 97.402 174.125 1.00108.38 N
ATOM 4386 CA ASP A 781 141.639 98.189 172.914 1.00108.38 C
ATOM 4387 C ASP A 781 142.790 99.160 172.651 1.00108.38 C
ATOM 4388 O ASP A 781 143.191 99.369 171.495 1.00108.38 O
ATOM 4389 CB ASP A 781 140.314 98.937 173.036 1.00108.38 C
ATOM 4390 CG ASP A 781 139.785 99.415 171.701 1.00108.38 C
ATOM 4391 OD1 ASP A 781 140.428 99.156 170.663 1.00108.38 O
ATOM 4392 OD2 ASP A 781 138.709 100.050 171.689 1.00108.38 O1-
ATOM 4393 N GLU A 782 143.359 99.732 173.717 1.00110.29 N
ATOM 4394 CA GLU A 782 144.480 100.656 173.557 1.00110.29 C
ATOM 4395 C GLU A 782 145.731 99.943 173.056 1.00110.29 C
ATOM 4396 O GLU A 782 146.457 100.474 172.206 1.00110.29 O
ATOM 4397 CB GLU A 782 144.766 101.371 174.876 1.00110.29 C
ATOM 4398 CG GLU A 782 143.691 102.353 175.299 1.00110.29 C
ATOM 4399 CD GLU A 782 143.606 103.556 174.387 1.00110.29 C
ATOM 4400 OE1 GLU A 782 144.652 103.970 173.854 1.00110.29 O
ATOM 4401 OE2 GLU A 782 142.494 104.091 174.200 1.00110.29 O1-
ATOM 4402 N VAL A 783 145.992 98.735 173.564 1.00107.46 N
ATOM 4403 CA VAL A 783 147.134 97.952 173.090 1.00107.46 C
ATOM 4404 C VAL A 783 146.931 97.533 171.635 1.00107.46 C
ATOM 4405 O VAL A 783 147.881 97.525 170.831 1.00107.46 O
ATOM 4406 CB VAL A 783 147.361 96.749 174.027 1.00107.46 C
ATOM 4407 CG1 VAL A 783 148.406 95.798 173.487 1.00107.46 C
ATOM 4408 CG2 VAL A 783 147.805 97.239 175.387 1.00107.46 C
ATOM 4409 N ARG A 784 145.682 97.231 171.262 1.00105.66 N
ATOM 4410 CA ARG A 784 145.389 96.908 169.870 1.00105.66 C
ATOM 4411 C ARG A 784 145.656 98.095 168.954 1.00105.66 C
ATOM 4412 O ARG A 784 146.182 97.925 167.849 1.00105.66 O
ATOM 4413 CB ARG A 784 143.942 96.430 169.732 1.00105.66 C
ATOM 4414 CG ARG A 784 143.547 96.000 168.318 1.00105.66 C
ATOM 4415 CD ARG A 784 142.710 97.047 167.590 1.00105.66 C
ATOM 4416 NE ARG A 784 142.445 96.652 166.213 1.00105.66 N
ATOM 4417 CZ ARG A 784 141.435 95.878 165.840 1.00105.66 C
ATOM 4418 NH1 ARG A 784 140.587 95.406 166.742 1.00105.66 N1+
ATOM 4419 NH2 ARG A 784 141.273 95.571 164.562 1.00105.66 N
ATOM 4420 N GLN A 785 145.317 99.306 169.393 1.00105.09 N
ATOM 4421 CA GLN A 785 145.548 100.445 168.510 1.00105.09 C
ATOM 4422 C GLN A 785 147.028 100.826 168.476 1.00105.09 C
ATOM 4423 O GLN A 785 147.519 101.326 167.450 1.00105.09 O
ATOM 4424 CB GLN A 785 144.673 101.626 168.920 1.00105.09 C
ATOM 4425 CG GLN A 785 144.693 102.750 167.904 1.00105.09 C
ATOM 4426 CD GLN A 785 143.736 103.861 168.223 1.00105.09 C
ATOM 4427 OE1 GLN A 785 142.996 103.800 169.203 1.00105.09 O
ATOM 4428 NE2 GLN A 785 143.752 104.901 167.399 1.00105.09 N
ATOM 4429 N TRP A 786 147.750 100.578 169.584 1.00107.30 N
ATOM 4430 CA TRP A 786 149.212 100.664 169.590 1.00107.30 C
ATOM 4431 C TRP A 786 149.821 99.820 168.487 1.00107.30 C
ATOM 4432 O TRP A 786 150.571 100.330 167.641 1.00107.30 O
ATOM 4433 CB TRP A 786 149.783 100.164 170.915 1.00107.30 C
ATOM 4434 CG TRP A 786 149.602 101.004 172.108 1.00107.30 C
ATOM 4435 CD1 TRP A 786 149.108 102.260 172.162 1.00107.30 C
ATOM 4436 CD2 TRP A 786 149.940 100.643 173.448 1.00107.30 C
ATOM 4437 NE1 TRP A 786 149.108 102.714 173.459 1.00107.30 N
ATOM 4438 CE2 TRP A 786 149.617 101.733 174.268 1.00107.30 C
ATOM 4439 CE3 TRP A 786 150.483 99.498 174.033 1.00107.30 C
ATOM 4440 CZ2 TRP A 786 149.819 101.714 175.642 1.00107.30 C
ATOM 4441 CZ3 TRP A 786 150.682 99.483 175.397 1.00107.30 C
ATOM 4442 CH2 TRP A 786 150.350 100.582 176.187 1.00107.30 C
ATOM 4443 N TYR A 787 149.453 98.535 168.462 1.00114.66 N
ATOM 4444 CA TYR A 787 150.068 97.566 167.558 1.00114.66 C
ATOM 4445 C TYR A 787 149.757 97.866 166.096 1.00114.66 C
ATOM 4446 O TYR A 787 150.513 97.478 165.199 1.00114.66 O
ATOM 4447 CB TYR A 787 149.598 96.162 167.939 1.00114.66 C
ATOM 4448 CG TYR A 787 150.117 95.067 167.053 1.00114.66 C
ATOM 4449 CD1 TYR A 787 151.436 94.651 167.138 1.00114.66 C
ATOM 4450 CD2 TYR A 787 149.285 94.447 166.129 1.00114.66 C
ATOM 4451 CE1 TYR A 787 151.916 93.647 166.323 1.00114.66 C
ATOM 4452 CE2 TYR A 787 149.752 93.444 165.311 1.00114.66 C
ATOM 4453 CZ TYR A 787 151.069 93.047 165.411 1.00114.66 C
ATOM 4454 OH TYR A 787 151.543 92.044 164.598 1.00114.66 O
ATOM 4455 N MET A 788 148.662 98.571 165.834 1.00113.38 N
ATOM 4456 CA MET A 788 148.278 98.883 164.455 1.00113.38 C
ATOM 4457 C MET A 788 148.912 100.185 163.976 1.00113.38 C
ATOM 4458 O MET A 788 149.408 100.259 162.849 1.00113.38 O
ATOM 4459 CB MET A 788 146.755 98.918 164.327 1.00113.38 C
ATOM 4460 CG MET A 788 146.118 97.554 164.512 1.00113.38 C
ATOM 4461 SD MET A 788 144.330 97.567 164.336 1.00113.38 S
ATOM 4462 CE MET A 788 144.191 97.829 162.573 1.00113.38 C
ATOM 4463 N ASN A 789 148.897 101.227 164.811 1.00112.12 N
ATOM 4464 CA ASN A 789 149.387 102.515 164.328 1.00112.12 C
ATOM 4465 C ASN A 789 150.886 102.680 164.546 1.00112.12 C
ATOM 4466 O ASN A 789 151.620 102.981 163.599 1.00112.12 O
ATOM 4467 CB ASN A 789 148.617 103.658 164.977 1.00112.12 C
ATOM 4468 CG ASN A 789 147.267 103.874 164.338 1.00112.12 C
ATOM 4469 OD1 ASN A 789 147.139 103.844 163.116 1.00112.12 O
ATOM 4470 ND2 ASN A 789 146.248 104.092 165.159 1.00112.12 N
ATOM 4471 N GLY A 790 151.366 102.500 165.774 1.00111.94 N
ATOM 4472 CA GLY A 790 152.778 102.777 165.994 1.00111.94 C
ATOM 4473 C GLY A 790 153.012 104.178 166.530 1.00111.94 C
ATOM 4474 O GLY A 790 152.566 104.526 167.627 1.00111.94 O
ATOM 4475 N SER A 791 153.750 104.993 165.772 1.00111.51 N
ATOM 4476 CA SER A 791 154.119 106.320 166.263 1.00111.51 C
ATOM 4477 C SER A 791 153.095 107.376 165.859 1.00111.51 C
ATOM 4478 O SER A 791 152.934 108.397 166.547 1.00111.51 O
ATOM 4479 CB SER A 791 155.509 106.694 165.760 1.00111.51 C
ATOM 4480 OG SER A 791 156.486 105.830 166.311 1.00111.51 O
ATOM 4481 N LYS A 792 152.392 107.147 164.744 1.00112.86 N
ATOM 4482 CA LYS A 792 151.298 108.029 164.350 1.00112.86 C
ATOM 4483 C LYS A 792 150.155 107.987 165.355 1.00112.86 C
ATOM 4484 O LYS A 792 149.340 108.915 165.409 1.00112.86 O
ATOM 4485 CB LYS A 792 150.796 107.649 162.957 1.00112.86 C
ATOM 4486 N TYR A 793 150.057 106.894 166.119 1.00108.68 N
ATOM 4487 CA TYR A 793 149.289 106.883 167.358 1.00108.68 C
ATOM 4488 C TYR A 793 149.722 108.003 168.287 1.00108.68 C
ATOM 4489 O TYR A 793 148.902 108.841 168.671 1.00108.68 O
ATOM 4490 CB TYR A 793 149.490 105.546 168.069 1.00108.68 C
ATOM 4491 CG TYR A 793 148.670 105.331 169.321 1.00108.68 C
ATOM 4492 CD1 TYR A 793 147.407 104.763 169.255 1.00108.68 C
ATOM 4493 CD2 TYR A 793 149.160 105.695 170.572 1.00108.68 C
ATOM 4494 CE1 TYR A 793 146.664 104.554 170.400 1.00108.68 C
ATOM 4495 CE2 TYR A 793 148.422 105.519 171.705 1.00108.68 C
ATOM 4496 CZ TYR A 793 147.183 104.942 171.616 1.00108.68 C
ATOM 4497 OH TYR A 793 146.464 104.760 172.766 1.00108.68 O
ATOM 4498 N PHE A 794 150.998 108.031 168.655 1.00103.24 N
ATOM 4499 CA PHE A 794 151.499 108.935 169.678 1.00103.24 C
ATOM 4500 C PHE A 794 151.766 110.337 169.157 1.00103.24 C
ATOM 4501 O PHE A 794 152.261 111.178 169.914 1.00103.24 O
ATOM 4502 CB PHE A 794 152.776 108.368 170.294 1.00103.24 C
ATOM 4503 CG PHE A 794 152.555 107.155 171.151 1.00103.24 C
ATOM 4504 CD1 PHE A 794 152.238 107.285 172.492 1.00103.24 C
ATOM 4505 CD2 PHE A 794 152.662 105.886 170.614 1.00103.24 C
ATOM 4506 CE1 PHE A 794 152.044 106.171 173.281 1.00103.24 C
ATOM 4507 CE2 PHE A 794 152.462 104.767 171.398 1.00103.24 C
ATOM 4508 CZ PHE A 794 152.153 104.911 172.731 1.00103.24 C
ATOM 4509 N SER A 795 151.472 110.603 167.884 1.00103.03 N
ATOM 4510 CA SER A 795 151.556 111.971 167.384 1.00103.03 C
ATOM 4511 C SER A 795 150.493 112.867 168.018 1.00103.03 C
ATOM 4512 O SER A 795 150.721 114.066 168.215 1.00103.03 O
ATOM 4513 CB SER A 795 151.432 111.972 165.861 1.00103.03 C
ATOM 4514 N ASP A 796 149.328 112.307 168.345 1.00100.28 N
ATOM 4515 CA ASP A 796 148.239 113.079 168.935 1.00100.28 C
ATOM 4516 C ASP A 796 148.357 113.088 170.454 1.00100.28 C
ATOM 4517 O ASP A 796 148.477 112.031 171.080 1.00100.28 O
ATOM 4518 CB ASP A 796 146.889 112.498 168.518 1.00100.28 C
ATOM 4519 N LEU A 797 148.300 114.283 171.046 1.00 92.60 N
ATOM 4520 CA LEU A 797 148.562 114.412 172.478 1.00 92.60 C
ATOM 4521 C LEU A 797 147.404 113.877 173.316 1.00 92.60 C
ATOM 4522 O LEU A 797 147.610 113.412 174.444 1.00 92.60 O
ATOM 4523 CB LEU A 797 148.876 115.871 172.817 1.00 92.60 C
ATOM 4524 CG LEU A 797 149.162 116.280 174.267 1.00 92.60 C
ATOM 4525 CD1 LEU A 797 150.256 115.436 174.882 1.00 92.60 C
ATOM 4526 CD2 LEU A 797 149.586 117.719 174.298 1.00 92.60 C
ATOM 4527 N TRP A 798 146.185 113.898 172.769 1.00 87.49 N
ATOM 4528 CA TRP A 798 145.038 113.363 173.499 1.00 87.49 C
ATOM 4529 C TRP A 798 145.142 111.854 173.646 1.00 87.49 C
ATOM 4530 O TRP A 798 144.644 111.271 174.615 1.00 87.49 O
ATOM 4531 CB TRP A 798 143.747 113.732 172.777 1.00 87.49 C
ATOM 4532 CG TRP A 798 143.600 115.184 172.623 1.00 87.49 C
ATOM 4533 CD1 TRP A 798 143.745 115.898 171.481 1.00 87.49 C
ATOM 4534 CD2 TRP A 798 143.368 116.122 173.663 1.00 87.49 C
ATOM 4535 NE1 TRP A 798 143.566 117.233 171.737 1.00 87.49 N
ATOM 4536 CE2 TRP A 798 143.336 117.391 173.075 1.00 87.49 C
ATOM 4537 CE3 TRP A 798 143.156 116.011 175.035 1.00 87.49 C
ATOM 4538 CZ2 TRP A 798 143.108 118.539 173.806 1.00 87.49 C
ATOM 4539 CZ3 TRP A 798 142.932 117.143 175.756 1.00 87.49 C
ATOM 4540 CH2 TRP A 798 142.924 118.389 175.146 1.00 87.49 C
ATOM 4541 N ASN A 799 145.814 111.215 172.702 1.00 96.52 N
ATOM 4542 CA ASN A 799 145.956 109.775 172.746 1.00 96.52 C
ATOM 4543 C ASN A 799 146.968 109.384 173.818 1.00 96.52 C
ATOM 4544 O ASN A 799 146.768 108.410 174.560 1.00 96.52 O
ATOM 4545 CB ASN A 799 146.368 109.320 171.358 1.00 96.52 C
ATOM 4546 CG ASN A 799 145.845 107.975 171.010 1.00 96.52 C
ATOM 4547 OD1 ASN A 799 145.263 107.284 171.841 1.00 96.52 O
ATOM 4548 ND2 ASN A 799 145.968 107.623 169.741 1.00 96.52 N
ATOM 4549 N VAL A 800 148.032 110.186 173.944 1.00 99.19 N
ATOM 4550 CA VAL A 800 148.988 110.080 175.045 1.00 99.19 C
ATOM 4551 C VAL A 800 148.297 110.319 176.380 1.00 99.19 C
ATOM 4552 O VAL A 800 148.587 109.643 177.378 1.00 99.19 O
ATOM 4553 CB VAL A 800 150.143 111.077 174.822 1.00 99.19 C
ATOM 4554 CG1 VAL A 800 151.106 111.110 176.005 1.00 99.19 C
ATOM 4555 CG2 VAL A 800 150.881 110.757 173.529 1.00 99.19 C
ATOM 4556 N MET A 801 147.369 111.281 176.413 1.00 99.93 N
ATOM 4557 CA MET A 801 146.587 111.549 177.618 1.00 99.93 C
ATOM 4558 C MET A 801 145.751 110.345 178.022 1.00 99.93 C
ATOM 4559 O MET A 801 145.694 109.991 179.205 1.00 99.93 O
ATOM 4560 CB MET A 801 145.667 112.742 177.390 1.00 99.93 C
ATOM 4561 CG MET A 801 144.850 113.112 178.602 1.00 99.93 C
ATOM 4562 SD MET A 801 143.569 114.306 178.201 1.00 99.93 S
ATOM 4563 CE MET A 801 142.423 113.255 177.310 1.00 99.93 C
ATOM 4564 N ASP A 802 145.092 109.712 177.048 1.00101.23 N
ATOM 4565 CA ASP A 802 144.253 108.552 177.333 1.00101.23 C
ATOM 4566 C ASP A 802 145.091 107.384 177.844 1.00101.23 C
ATOM 4567 O ASP A 802 144.705 106.705 178.808 1.00101.23 O
ATOM 4568 CB ASP A 802 143.478 108.168 176.070 1.00101.23 C
ATOM 4569 CG ASP A 802 142.268 107.291 176.353 1.00101.23 C
ATOM 4570 OD1 ASP A 802 142.020 106.952 177.526 1.00101.23 O
ATOM 4571 OD2 ASP A 802 141.550 106.951 175.388 1.00101.23 O1-
ATOM 4572 N THR A 803 146.264 107.169 177.237 1.00102.24 N
ATOM 4573 CA THR A 803 147.162 106.103 177.679 1.00102.24 C
ATOM 4574 C THR A 803 147.690 106.352 179.089 1.00102.24 C
ATOM 4575 O THR A 803 147.705 105.438 179.928 1.00102.24 O
ATOM 4576 CB THR A 803 148.321 105.973 176.697 1.00102.24 C
ATOM 4577 OG1 THR A 803 147.813 105.635 175.403 1.00102.24 O
ATOM 4578 CG2 THR A 803 149.292 104.908 177.146 1.00102.24 C
ATOM 4579 N LEU A 804 148.116 107.586 179.371 1.00102.72 N
ATOM 4580 CA LEU A 804 148.597 107.931 180.704 1.00102.72 C
ATOM 4581 C LEU A 804 147.491 107.821 181.742 1.00102.72 C
ATOM 4582 O LEU A 804 147.739 107.368 182.864 1.00102.72 O
ATOM 4583 CB LEU A 804 149.185 109.341 180.702 1.00102.72 C
ATOM 4584 CG LEU A 804 149.754 109.830 182.036 1.00102.72 C
ATOM 4585 CD1 LEU A 804 150.908 108.953 182.467 1.00102.72 C
ATOM 4586 CD2 LEU A 804 150.185 111.283 181.960 1.00102.72 C
ATOM 4587 N ALA A 805 146.257 108.162 181.362 1.00102.78 N
ATOM 4588 CA ALA A 805 145.133 108.056 182.285 1.00102.78 C
ATOM 4589 C ALA A 805 144.834 106.609 182.631 1.00102.78 C
ATOM 4590 O ALA A 805 144.623 106.275 183.803 1.00102.78 O
ATOM 4591 CB ALA A 805 143.898 108.712 181.679 1.00102.78 C
ATOM 4592 N ILE A 806 144.835 105.729 181.630 1.00104.59 N
ATOM 4593 CA ILE A 806 144.461 104.349 181.909 1.00104.59 C
ATOM 4594 C ILE A 806 145.584 103.617 182.642 1.00104.59 C
ATOM 4595 O ILE A 806 145.325 102.774 183.512 1.00104.59 O
ATOM 4596 CB ILE A 806 144.013 103.641 180.616 1.00104.59 C
ATOM 4597 CG1 ILE A 806 143.407 102.289 180.942 1.00104.59 C
ATOM 4598 CG2 ILE A 806 145.127 103.483 179.607 1.00104.59 C
ATOM 4599 CD1 ILE A 806 142.675 101.719 179.806 1.00104.59 C
ATOM 4600 N PHE A 807 146.844 103.982 182.381 1.00104.36 N
ATOM 4601 CA PHE A 807 147.928 103.376 183.147 1.00104.36 C
ATOM 4602 C PHE A 807 147.963 103.919 184.571 1.00104.36 C
ATOM 4603 O PHE A 807 148.315 103.198 185.515 1.00104.36 O
ATOM 4604 CB PHE A 807 149.262 103.597 182.447 1.00104.36 C
ATOM 4605 CG PHE A 807 150.406 102.939 183.140 1.00104.36 C
ATOM 4606 CD1 PHE A 807 150.536 101.560 183.119 1.00104.36 C
ATOM 4607 CD2 PHE A 807 151.351 103.691 183.815 1.00104.36 C
ATOM 4608 CE1 PHE A 807 151.589 100.936 183.765 1.00104.36 C
ATOM 4609 CE2 PHE A 807 152.410 103.077 184.462 1.00104.36 C
ATOM 4610 CZ PHE A 807 152.529 101.696 184.436 1.00104.36 C
ATOM 4611 N TYR A 808 147.566 105.180 184.743 1.00104.37 N
ATOM 4612 CA TYR A 808 147.447 105.771 186.068 1.00104.37 C
ATOM 4613 C TYR A 808 146.349 105.085 186.870 1.00104.37 C
ATOM 4614 O TYR A 808 146.506 104.831 188.071 1.00104.37 O
ATOM 4615 CB TYR A 808 147.176 107.263 185.886 1.00104.37 C
ATOM 4616 CG TYR A 808 147.225 108.128 187.113 1.00104.37 C
ATOM 4617 CD1 TYR A 808 148.426 108.375 187.760 1.00104.37 C
ATOM 4618 CD2 TYR A 808 146.087 108.773 187.572 1.00104.37 C
ATOM 4619 CE1 TYR A 808 148.482 109.190 188.866 1.00104.37 C
ATOM 4620 CE2 TYR A 808 146.133 109.596 188.670 1.00104.37 C
ATOM 4621 CZ TYR A 808 147.332 109.797 189.316 1.00104.37 C
ATOM 4622 OH TYR A 808 147.385 110.614 190.418 1.00104.37 O
ATOM 4623 N PHE A 809 145.252 104.730 186.198 1.00101.23 N
ATOM 4624 CA PHE A 809 144.188 103.958 186.834 1.00101.23 C
ATOM 4625 C PHE A 809 144.667 102.563 187.206 1.00101.23 C
ATOM 4626 O PHE A 809 144.284 102.028 188.254 1.00101.23 O
ATOM 4627 CB PHE A 809 142.993 103.857 185.892 1.00101.23 C
ATOM 4628 CG PHE A 809 141.767 103.259 186.517 1.00101.23 C
ATOM 4629 CD1 PHE A 809 140.889 104.050 187.225 1.00101.23 C
ATOM 4630 CD2 PHE A 809 141.499 101.908 186.408 1.00101.23 C
ATOM 4631 CE1 PHE A 809 139.756 103.512 187.782 1.00101.23 C
ATOM 4632 CE2 PHE A 809 140.377 101.363 186.976 1.00101.23 C
ATOM 4633 CZ PHE A 809 139.505 102.168 187.670 1.00101.23 C
ATOM 4634 N ILE A 810 145.468 101.942 186.333 1.00101.97 N
ATOM 4635 CA ILE A 810 145.973 100.595 186.597 1.00101.97 C
ATOM 4636 C ILE A 810 146.903 100.604 187.800 1.00101.97 C
ATOM 4637 O ILE A 810 146.947 99.645 188.577 1.00101.97 O
ATOM 4638 CB ILE A 810 146.674 100.032 185.347 1.00101.97 C
ATOM 4639 N ALA A 811 147.657 101.689 187.971 1.00106.75 N
ATOM 4640 CA ALA A 811 148.469 101.838 189.173 1.00106.75 C
ATOM 4641 C ALA A 811 147.603 102.064 190.404 1.00106.75 C
ATOM 4642 O ALA A 811 147.868 101.498 191.473 1.00106.75 O
ATOM 4643 CB ALA A 811 149.455 102.990 188.999 1.00106.75 C
ATOM 4644 N GLY A 812 146.562 102.890 190.271 1.00108.91 N
ATOM 4645 CA GLY A 812 145.714 103.193 191.414 1.00108.91 C
ATOM 4646 C GLY A 812 144.906 102.001 191.893 1.00108.91 C
ATOM 4647 O GLY A 812 144.571 101.904 193.077 1.00108.91 O
ATOM 4648 N ILE A 813 144.600 101.072 190.983 1.00112.03 N
ATOM 4649 CA ILE A 813 143.896 99.845 191.355 1.00112.03 C
ATOM 4650 C ILE A 813 144.743 99.007 192.305 1.00112.03 C
ATOM 4651 O ILE A 813 144.259 98.533 193.341 1.00112.03 O
ATOM 4652 CB ILE A 813 143.516 99.049 190.094 1.00112.03 C
ATOM 4653 N VAL A 814 146.027 98.837 191.982 1.00116.16 N
ATOM 4654 CA VAL A 814 146.918 98.060 192.839 1.00116.16 C
ATOM 4655 C VAL A 814 147.247 98.834 194.106 1.00116.16 C
ATOM 4656 O VAL A 814 147.540 98.242 195.152 1.00116.16 O
ATOM 4657 CB VAL A 814 148.196 97.673 192.072 1.00116.16 C
ATOM 4658 N PHE A 815 147.231 100.164 194.028 1.00112.32 N
ATOM 4659 CA PHE A 815 147.499 100.969 195.213 1.00112.32 C
ATOM 4660 C PHE A 815 146.342 100.871 196.200 1.00112.32 C
ATOM 4661 O PHE A 815 146.537 100.922 197.418 1.00112.32 O
ATOM 4662 CB PHE A 815 147.758 102.417 194.807 1.00112.32 C
ATOM 4663 CG PHE A 815 148.320 103.258 195.907 1.00112.32 C
ATOM 4664 CD1 PHE A 815 149.658 103.163 196.240 1.00112.32 C
ATOM 4665 CD2 PHE A 815 147.518 104.132 196.610 1.00112.32 C
ATOM 4666 CE1 PHE A 815 150.190 103.933 197.252 1.00112.32 C
ATOM 4667 CE2 PHE A 815 148.043 104.906 197.625 1.00112.32 C
ATOM 4668 CZ PHE A 815 149.382 104.806 197.945 1.00112.32 C
ATOM 4669 N ARG A 816 145.120 100.728 195.681 1.00116.20 N
ATOM 4670 CA ARG A 816 143.976 100.478 196.551 1.00116.20 C
ATOM 4671 C ARG A 816 143.959 99.036 197.042 1.00116.20 C
ATOM 4672 O ARG A 816 143.496 98.769 198.157 1.00116.20 O
ATOM 4673 CB ARG A 816 142.675 100.820 195.816 1.00116.20 C
ATOM 4674 CG ARG A 816 141.399 100.772 196.664 1.00116.20 C
ATOM 4675 CD ARG A 816 140.599 99.496 196.464 1.00116.20 C
ATOM 4676 NE ARG A 816 139.391 99.472 197.281 1.00116.20 N
ATOM 4677 CZ ARG A 816 138.231 100.007 196.918 1.00116.20 C
ATOM 4678 NH1 ARG A 816 138.118 100.621 195.751 1.00116.20 N1+
ATOM 4679 NH2 ARG A 816 137.182 99.934 197.723 1.00116.20 N
ATOM 4680 N LEU A 817 144.451 98.098 196.224 1.00123.81 N
ATOM 4681 CA LEU A 817 144.382 96.681 196.580 1.00123.81 C
ATOM 4682 C LEU A 817 145.285 96.351 197.761 1.00123.81 C
ATOM 4683 O LEU A 817 145.045 95.373 198.477 1.00123.81 O
ATOM 4684 CB LEU A 817 144.748 95.819 195.374 1.00123.81 C
ATOM 4685 N HIS A 818 146.327 97.150 197.979 1.00129.44 N
ATOM 4686 CA HIS A 818 147.170 96.975 199.152 1.00129.44 C
ATOM 4687 C HIS A 818 146.406 97.371 200.409 1.00129.44 C
ATOM 4688 O HIS A 818 145.703 98.384 200.436 1.00129.44 O
ATOM 4689 CB HIS A 818 148.444 97.808 199.026 1.00129.44 C
ATOM 4690 N SER A 819 146.545 96.559 201.451 1.00137.84 N
ATOM 4691 CA SER A 819 145.810 96.747 202.698 1.00137.84 C
ATOM 4692 C SER A 819 146.752 97.375 203.718 1.00137.84 C
ATOM 4693 O SER A 819 147.597 96.693 204.304 1.00137.84 O
ATOM 4694 CB SER A 819 145.247 95.421 203.198 1.00137.84 C
ATOM 4695 N ASP A 820 146.609 98.684 203.917 1.00135.57 N
ATOM 4696 CA ASP A 820 147.340 99.400 204.947 1.00135.57 C
ATOM 4697 C ASP A 820 146.482 100.382 205.730 1.00135.57 C
ATOM 4698 O ASP A 820 146.967 100.927 206.731 1.00135.57 O
ATOM 4699 CB ASP A 820 148.529 100.156 204.333 1.00135.57 C
ATOM 4700 N GLU A 821 145.270 100.691 205.245 1.00135.11 N
ATOM 4701 CA GLU A 821 144.226 101.512 205.868 1.00135.11 C
ATOM 4702 C GLU A 821 144.574 103.000 205.933 1.00135.11 C
ATOM 4703 O GLU A 821 143.743 103.811 206.350 1.00135.11 O
ATOM 4704 CB GLU A 821 143.863 100.994 207.267 1.00135.11 C
ATOM 4705 N SER A 822 145.785 103.374 205.518 1.00127.11 N
ATOM 4706 CA SER A 822 146.151 104.784 205.462 1.00127.11 C
ATOM 4707 C SER A 822 146.337 105.240 204.024 1.00127.11 C
ATOM 4708 O SER A 822 146.022 106.384 203.678 1.00127.11 O
ATOM 4709 CB SER A 822 147.422 105.028 206.271 1.00127.11 C
ATOM 4710 OG SER A 822 147.825 106.382 206.177 1.00127.11 O
ATOM 4711 N SER A 823 146.864 104.359 203.174 1.00119.51 N
ATOM 4712 CA SER A 823 147.022 104.685 201.763 1.00119.51 C
ATOM 4713 C SER A 823 145.680 104.696 201.047 1.00119.51 C
ATOM 4714 O SER A 823 145.537 105.349 200.004 1.00119.51 O
ATOM 4715 CB SER A 823 147.961 103.682 201.105 1.00119.51 C
ATOM 4716 OG SER A 823 147.365 102.398 201.082 1.00119.51 O
ATOM 4717 N TRP A 824 144.702 103.960 201.596 1.00117.64 N
ATOM 4718 CA TRP A 824 143.339 103.770 201.103 1.00117.64 C
ATOM 4719 C TRP A 824 142.690 105.043 200.592 1.00117.64 C
ATOM 4720 O TRP A 824 142.399 105.153 199.392 1.00117.64 O
ATOM 4721 CB TRP A 824 142.473 103.199 202.226 1.00117.64 C
ATOM 4722 CG TRP A 824 141.029 103.063 201.876 1.00117.64 C
ATOM 4723 CD1 TRP A 824 140.483 102.203 200.974 1.00117.64 C
ATOM 4724 CD2 TRP A 824 139.942 103.824 202.414 1.00117.64 C
ATOM 4725 NE1 TRP A 824 139.121 102.371 200.923 1.00117.64 N
ATOM 4726 CE2 TRP A 824 138.764 103.361 201.798 1.00117.64 C
ATOM 4727 CE3 TRP A 824 139.849 104.847 203.361 1.00117.64 C
ATOM 4728 CZ2 TRP A 824 137.509 103.886 202.095 1.00117.64 C
ATOM 4729 CZ3 TRP A 824 138.600 105.369 203.654 1.00117.64 C
ATOM 4730 CH2 TRP A 824 137.448 104.887 203.024 1.00117.64 C
ATOM 4731 N TYR A 825 142.556 106.013 201.507 1.00115.61 N
ATOM 4732 CA TYR A 825 142.041 107.343 201.193 1.00115.61 C
ATOM 4733 C TYR A 825 142.785 107.972 200.031 1.00115.61 C
ATOM 4734 O TYR A 825 142.158 108.399 199.053 1.00115.61 O
ATOM 4735 CB TYR A 825 142.150 108.238 202.426 1.00115.61 C
ATOM 4736 CG TYR A 825 141.769 109.678 202.193 1.00115.61 C
ATOM 4737 CD1 TYR A 825 140.440 110.054 202.077 1.00115.61 C
ATOM 4738 CD2 TYR A 825 142.742 110.666 202.111 1.00115.61 C
ATOM 4739 CE1 TYR A 825 140.090 111.371 201.875 1.00115.61 C
ATOM 4740 CE2 TYR A 825 142.401 111.983 201.908 1.00115.61 C
ATOM 4741 CZ TYR A 825 141.075 112.330 201.790 1.00115.61 C
ATOM 4742 OH TYR A 825 140.729 113.644 201.587 1.00115.61 O
ATOM 4743 N SER A 826 144.122 107.953 200.090 1.00112.25 N
ATOM 4744 CA SER A 826 144.933 108.553 199.038 1.00112.25 C
ATOM 4745 C SER A 826 144.719 107.843 197.713 1.00112.25 C
ATOM 4746 O SER A 826 144.597 108.500 196.669 1.00112.25 O
ATOM 4747 CB SER A 826 146.408 108.523 199.430 1.00112.25 C
ATOM 4748 OG SER A 826 146.883 107.193 199.504 1.00112.25 O
ATOM 4749 N GLY A 827 144.577 106.512 197.755 1.00106.63 N
ATOM 4750 CA GLY A 827 144.288 105.773 196.540 1.00106.63 C
ATOM 4751 C GLY A 827 142.951 106.167 195.958 1.00106.63 C
ATOM 4752 O GLY A 827 142.831 106.383 194.748 1.00106.63 O
ATOM 4753 N ARG A 828 141.969 106.382 196.839 1.00106.95 N
ATOM 4754 CA ARG A 828 140.655 106.857 196.434 1.00106.95 C
ATOM 4755 C ARG A 828 140.760 108.219 195.765 1.00106.95 C
ATOM 4756 O ARG A 828 140.109 108.467 194.738 1.00106.95 O
ATOM 4757 CB ARG A 828 139.746 106.889 197.666 1.00106.95 C
ATOM 4758 CG ARG A 828 138.318 107.341 197.468 1.00106.95 C
ATOM 4759 CD ARG A 828 138.144 108.765 197.934 1.00106.95 C
ATOM 4760 NE ARG A 828 136.747 109.170 197.933 1.00106.95 N
ATOM 4761 CZ ARG A 828 135.923 108.958 198.950 1.00106.95 C
ATOM 4762 NH1 ARG A 828 136.362 108.341 200.037 1.00106.95 N1+
ATOM 4763 NH2 ARG A 828 134.661 109.357 198.882 1.00106.95 N
ATOM 4764 N VAL A 829 141.657 109.071 196.287 1.00107.12 N
ATOM 4765 CA VAL A 829 141.895 110.396 195.719 1.00107.12 C
ATOM 4766 C VAL A 829 142.363 110.277 194.280 1.00107.12 C
ATOM 4767 O VAL A 829 141.872 110.996 193.395 1.00107.12 O
ATOM 4768 CB VAL A 829 142.909 111.168 196.583 1.00107.12 C
ATOM 4769 CG1 VAL A 829 143.321 112.458 195.912 1.00107.12 C
ATOM 4770 CG2 VAL A 829 142.318 111.473 197.933 1.00107.12 C
ATOM 4771 N ILE A 830 143.226 109.281 194.018 1.00103.99 N
ATOM 4772 CA ILE A 830 143.763 109.036 192.683 1.00103.99 C
ATOM 4773 C ILE A 830 142.640 108.779 191.697 1.00103.99 C
ATOM 4774 O ILE A 830 142.605 109.386 190.613 1.00103.99 O
ATOM 4775 CB ILE A 830 144.752 107.859 192.723 1.00103.99 C
ATOM 4776 CG1 ILE A 830 145.977 108.219 193.550 1.00103.99 C
ATOM 4777 CG2 ILE A 830 145.156 107.444 191.334 1.00103.99 C
ATOM 4778 CD1 ILE A 830 146.866 107.040 193.820 1.00103.99 C
ATOM 4779 N PHE A 831 141.636 107.993 192.129 1.00103.30 N
ATOM 4780 CA PHE A 831 140.517 107.647 191.259 1.00103.30 C
ATOM 4781 C PHE A 831 139.765 108.888 190.826 1.00103.30 C
ATOM 4782 O PHE A 831 139.474 109.049 189.630 1.00103.30 O
ATOM 4783 CB PHE A 831 139.564 106.683 191.959 1.00103.30 C
ATOM 4784 CG PHE A 831 140.102 105.299 192.111 1.00103.30 C
ATOM 4785 CD1 PHE A 831 140.196 104.467 191.020 1.00103.30 C
ATOM 4786 CD2 PHE A 831 140.460 104.811 193.351 1.00103.30 C
ATOM 4787 CE1 PHE A 831 140.678 103.182 191.144 1.00103.30 C
ATOM 4788 CE2 PHE A 831 140.943 103.523 193.490 1.00103.30 C
ATOM 4789 CZ PHE A 831 141.051 102.707 192.382 1.00103.30 C
ATOM 4790 N CYS A 832 139.583 109.829 191.765 1.00100.85 N
ATOM 4791 CA CYS A 832 138.839 111.049 191.483 1.00100.85 C
ATOM 4792 C CYS A 832 139.513 111.853 190.388 1.00100.85 C
ATOM 4793 O CYS A 832 138.849 112.280 189.434 1.00100.85 O
ATOM 4794 CB CYS A 832 138.699 111.878 192.754 1.00100.85 C
ATOM 4795 SG CYS A 832 137.742 111.057 194.037 1.00100.85 S
ATOM 4796 N LEU A 833 140.851 111.931 190.438 1.00 94.35 N
ATOM 4797 CA LEU A 833 141.579 112.680 189.424 1.00 94.35 C
ATOM 4798 C LEU A 833 141.429 112.019 188.070 1.00 94.35 C
ATOM 4799 O LEU A 833 141.101 112.692 187.081 1.00 94.35 O
ATOM 4800 CB LEU A 833 143.048 112.793 189.808 1.00 94.35 C
ATOM 4801 CG LEU A 833 143.297 113.618 191.062 1.00 94.35 C
ATOM 4802 CD1 LEU A 833 144.763 113.579 191.443 1.00 94.35 C
ATOM 4803 CD2 LEU A 833 142.832 115.039 190.832 1.00 94.35 C
ATOM 4804 N ASP A 834 141.516 110.679 188.051 1.00 88.83 N
ATOM 4805 CA ASP A 834 141.374 109.934 186.808 1.00 88.83 C
ATOM 4806 C ASP A 834 139.986 110.127 186.235 1.00 88.83 C
ATOM 4807 O ASP A 834 139.832 110.258 185.010 1.00 88.83 O
ATOM 4808 CB ASP A 834 141.655 108.454 187.046 1.00 88.83 C
ATOM 4809 N TYR A 835 138.996 110.283 187.132 1.00 85.42 N
ATOM 4810 CA TYR A 835 137.611 110.507 186.740 1.00 85.42 C
ATOM 4811 C TYR A 835 137.479 111.731 185.860 1.00 85.42 C
ATOM 4812 O TYR A 835 136.882 111.651 184.776 1.00 85.42 O
ATOM 4813 CB TYR A 835 136.741 110.655 187.986 1.00 85.42 C
ATOM 4814 CG TYR A 835 135.318 111.043 187.701 1.00 85.42 C
ATOM 4815 CD1 TYR A 835 134.460 110.161 187.085 1.00 85.42 C
ATOM 4816 CD2 TYR A 835 134.823 112.278 188.082 1.00 85.42 C
ATOM 4817 CE1 TYR A 835 133.156 110.495 186.833 1.00 85.42 C
ATOM 4818 CE2 TYR A 835 133.509 112.623 187.833 1.00 85.42 C
ATOM 4819 CZ TYR A 835 132.687 111.725 187.206 1.00 85.42 C
ATOM 4820 OH TYR A 835 131.382 112.061 186.960 1.00 85.42 O
ATOM 4821 N ILE A 836 138.157 112.821 186.245 1.00 80.28 N
ATOM 4822 CA ILE A 836 138.055 114.064 185.492 1.00 80.28 C
ATOM 4823 C ILE A 836 138.629 113.876 184.103 1.00 80.28 C
ATOM 4824 O ILE A 836 138.012 114.291 183.110 1.00 80.28 O
ATOM 4825 CB ILE A 836 138.742 115.212 186.250 1.00 80.28 C
ATOM 4826 CG1 ILE A 836 137.961 115.552 187.509 1.00 80.28 C
ATOM 4827 CG2 ILE A 836 138.852 116.444 185.395 1.00 80.28 C
ATOM 4828 CD1 ILE A 836 138.672 116.529 188.393 1.00 80.28 C
ATOM 4829 N VAL A 837 139.711 113.093 184.004 1.00 80.38 N
ATOM 4830 CA VAL A 837 140.360 112.889 182.716 1.00 80.38 C
ATOM 4831 C VAL A 837 139.446 112.108 181.790 1.00 80.38 C
ATOM 4832 O VAL A 837 139.336 112.438 180.600 1.00 80.38 O
ATOM 4833 CB VAL A 837 141.717 112.190 182.888 1.00 80.38 C
ATOM 4834 CG1 VAL A 837 142.430 112.114 181.554 1.00 80.38 C
ATOM 4835 CG2 VAL A 837 142.559 112.924 183.886 1.00 80.38 C
ATOM 4836 N PHE A 838 138.683 111.149 182.349 1.00 77.71 N
ATOM 4837 CA PHE A 838 137.742 110.398 181.520 1.00 77.71 C
ATOM 4838 C PHE A 838 136.672 111.312 180.959 1.00 77.71 C
ATOM 4839 O PHE A 838 136.367 111.248 179.759 1.00 77.71 O
ATOM 4840 CB PHE A 838 137.099 109.248 182.293 1.00 77.71 C
ATOM 4841 CG PHE A 838 137.996 108.062 182.475 1.00 77.71 C
ATOM 4842 CD1 PHE A 838 138.296 107.235 181.405 1.00 77.71 C
ATOM 4843 CD2 PHE A 838 138.491 107.739 183.722 1.00 77.71 C
ATOM 4844 CE1 PHE A 838 139.115 106.137 181.572 1.00 77.71 C
ATOM 4845 CE2 PHE A 838 139.306 106.646 183.896 1.00 77.71 C
ATOM 4846 CZ PHE A 838 139.616 105.843 182.821 1.00 77.71 C
ATOM 4847 N THR A 839 136.197 112.254 181.786 1.00 72.35 N
ATOM 4848 CA THR A 839 135.209 113.222 181.331 1.00 72.35 C
ATOM 4849 C THR A 839 135.781 114.082 180.221 1.00 72.35 C
ATOM 4850 O THR A 839 135.113 114.303 179.200 1.00 72.35 O
ATOM 4851 CB THR A 839 134.748 114.083 182.499 1.00 72.35 C
ATOM 4852 OG1 THR A 839 134.234 113.237 183.529 1.00 72.35 O
ATOM 4853 CG2 THR A 839 133.650 115.013 182.059 1.00 72.35 C
ATOM 4854 N LEU A 840 137.061 114.457 180.351 1.00 75.93 N
ATOM 4855 CA LEU A 840 137.692 115.283 179.331 1.00 75.93 C
ATOM 4856 C LEU A 840 137.791 114.522 178.025 1.00 75.93 C
ATOM 4857 O LEU A 840 137.561 115.099 176.952 1.00 75.93 O
ATOM 4858 CB LEU A 840 139.069 115.746 179.793 1.00 75.93 C
ATOM 4859 CG LEU A 840 139.053 116.663 181.013 1.00 75.93 C
ATOM 4860 CD1 LEU A 840 140.458 117.033 181.417 1.00 75.93 C
ATOM 4861 CD2 LEU A 840 138.232 117.896 180.748 1.00 75.93 C
ATOM 4862 N ARG A 841 138.008 113.201 178.123 1.00 72.24 N
ATOM 4863 CA ARG A 841 138.043 112.349 176.945 1.00 72.24 C
ATOM 4864 C ARG A 841 136.730 112.429 176.196 1.00 72.24 C
ATOM 4865 O ARG A 841 136.719 112.718 174.988 1.00 72.24 O
ATOM 4866 CB ARG A 841 138.330 110.909 177.354 1.00 72.24 C
ATOM 4867 CG ARG A 841 138.440 109.969 176.182 1.00 72.24 C
ATOM 4868 CD ARG A 841 139.673 110.305 175.369 1.00 72.24 C
ATOM 4869 NE ARG A 841 139.854 109.404 174.241 1.00 72.24 N
ATOM 4870 CZ ARG A 841 139.315 109.601 173.046 1.00 72.24 C
ATOM 4871 NH1 ARG A 841 139.526 108.734 172.069 1.00 72.24 N1+
ATOM 4872 NH2 ARG A 841 138.567 110.671 172.830 1.00 72.24 N
ATOM 4873 N LEU A 842 135.622 112.350 176.947 1.00 65.35 N
ATOM 4874 CA LEU A 842 134.291 112.420 176.359 1.00 65.35 C
ATOM 4875 C LEU A 842 134.079 113.741 175.651 1.00 65.35 C
ATOM 4876 O LEU A 842 133.581 113.763 174.515 1.00 65.35 O
ATOM 4877 CB LEU A 842 133.227 112.230 177.436 1.00 65.35 C
ATOM 4878 CG LEU A 842 131.790 112.278 176.935 1.00 65.35 C
ATOM 4879 CD1 LEU A 842 131.579 111.163 175.952 1.00 65.35 C
ATOM 4880 CD2 LEU A 842 130.810 112.173 178.079 1.00 65.35 C
ATOM 4881 N ILE A 843 134.574 114.833 176.253 1.00 62.22 N
ATOM 4882 CA ILE A 843 134.291 116.156 175.712 1.00 62.22 C
ATOM 4883 C ILE A 843 134.992 116.327 174.377 1.00 62.22 C
ATOM 4884 O ILE A 843 134.418 116.907 173.440 1.00 62.22 O
ATOM 4885 CB ILE A 843 134.666 117.249 176.728 1.00 62.22 C
ATOM 4886 CG1 ILE A 843 133.790 117.113 177.964 1.00 62.22 C
ATOM 4887 CG2 ILE A 843 134.418 118.617 176.170 1.00 62.22 C
ATOM 4888 CD1 ILE A 843 134.162 118.046 179.073 1.00 62.22 C
ATOM 4889 N HIS A 844 136.160 115.674 174.218 1.00 63.23 N
ATOM 4890 CA HIS A 844 136.886 115.785 172.958 1.00 63.23 C
ATOM 4891 C HIS A 844 136.092 115.181 171.819 1.00 63.23 C
ATOM 4892 O HIS A 844 136.044 115.760 170.725 1.00 63.23 O
ATOM 4893 CB HIS A 844 138.255 115.126 173.029 1.00 63.23 C
ATOM 4894 CG HIS A 844 138.952 115.090 171.706 1.00 63.23 C
ATOM 4895 ND1 HIS A 844 139.467 116.216 171.105 1.00 63.23 N
ATOM 4896 CD2 HIS A 844 139.186 114.068 170.849 1.00 63.23 C
ATOM 4897 CE1 HIS A 844 140.004 115.888 169.944 1.00 63.23 C
ATOM 4898 NE2 HIS A 844 139.848 114.590 169.766 1.00 63.23 N
ATOM 4899 N ILE A 845 135.366 114.092 172.106 1.00 59.99 N
ATOM 4900 CA ILE A 845 134.555 113.438 171.089 1.00 59.99 C
ATOM 4901 C ILE A 845 133.472 114.382 170.600 1.00 59.99 C
ATOM 4902 O ILE A 845 133.277 114.545 169.385 1.00 59.99 O
ATOM 4903 CB ILE A 845 133.958 112.137 171.639 1.00 59.99 C
ATOM 4904 CG1 ILE A 845 135.075 111.210 172.098 1.00 59.99 C
ATOM 4905 CG2 ILE A 845 133.163 111.447 170.568 1.00 59.99 C
ATOM 4906 CD1 ILE A 845 134.587 110.028 172.895 1.00 59.99 C
ATOM 4907 N PHE A 846 132.852 115.116 171.533 1.00 56.48 N
ATOM 4908 CA PHE A 846 131.821 116.065 171.138 1.00 56.48 C
ATOM 4909 C PHE A 846 132.409 117.202 170.324 1.00 56.48 C
ATOM 4910 O PHE A 846 131.821 117.610 169.314 1.00 56.48 O
ATOM 4911 CB PHE A 846 131.073 116.590 172.356 1.00 56.48 C
ATOM 4912 CG PHE A 846 130.102 115.608 172.923 1.00 56.48 C
ATOM 4913 CD1 PHE A 846 128.880 115.405 172.311 1.00 56.48 C
ATOM 4914 CD2 PHE A 846 130.401 114.890 174.064 1.00 56.48 C
ATOM 4915 CE1 PHE A 846 127.979 114.502 172.822 1.00 56.48 C
ATOM 4916 CE2 PHE A 846 129.501 113.988 174.584 1.00 56.48 C
ATOM 4917 CZ PHE A 846 128.291 113.793 173.961 1.00 56.48 C
ATOM 4918 N THR A 847 133.632 117.629 170.657 1.00 57.86 N
ATOM 4919 CA THR A 847 134.220 118.738 169.917 1.00 57.86 C
ATOM 4920 C THR A 847 134.667 118.295 168.537 1.00 57.86 C
ATOM 4921 O THR A 847 134.906 119.130 167.660 1.00 57.86 O
ATOM 4922 CB THR A 847 135.385 119.343 170.685 1.00 57.86 C
ATOM 4923 OG1 THR A 847 136.369 118.335 170.922 1.00 57.86 O
ATOM 4924 CG2 THR A 847 134.914 119.903 171.999 1.00 57.86 C
ATOM 4925 N VAL A 848 134.766 116.986 168.310 1.00 57.36 N
ATOM 4926 CA VAL A 848 134.979 116.523 166.948 1.00 57.36 C
ATOM 4927 C VAL A 848 133.637 116.290 166.274 1.00 57.36 C
ATOM 4928 O VAL A 848 133.468 116.544 165.076 1.00 57.36 O
ATOM 4929 CB VAL A 848 135.867 115.267 166.944 1.00 57.36 C
ATOM 4930 CG1 VAL A 848 136.100 114.761 165.537 1.00 57.36 C
ATOM 4931 CG2 VAL A 848 137.191 115.582 167.599 1.00 57.36 C
ATOM 4932 N SER A 849 132.640 115.862 167.049 1.00 58.30 N
ATOM 4933 CA SER A 849 131.368 115.494 166.440 1.00 58.30 C
ATOM 4934 C SER A 849 130.561 116.725 166.054 1.00 58.30 C
ATOM 4935 O SER A 849 129.921 116.748 164.997 1.00 58.30 O
ATOM 4936 CB SER A 849 130.564 114.618 167.388 1.00 58.30 C
ATOM 4937 OG SER A 849 130.085 115.392 168.465 1.00 58.30 O
ATOM 4938 N ARG A 850 130.571 117.754 166.899 1.00 62.67 N
ATOM 4939 CA ARG A 850 129.837 118.976 166.586 1.00 62.67 C
ATOM 4940 C ARG A 850 130.511 119.749 165.465 1.00 62.67 C
ATOM 4941 O ARG A 850 129.854 120.186 164.516 1.00 62.67 O
ATOM 4942 CB ARG A 850 129.730 119.845 167.833 1.00 62.67 C
ATOM 4943 CG ARG A 850 129.099 121.204 167.634 1.00 62.67 C
ATOM 4944 CD ARG A 850 127.612 121.130 167.430 1.00 62.67 C
ATOM 4945 NE ARG A 850 127.039 122.468 167.349 1.00 62.67 N
ATOM 4946 CZ ARG A 850 126.937 123.171 166.227 1.00 62.67 C
ATOM 4947 NH1 ARG A 850 127.359 122.659 165.079 1.00 62.67 N1+
ATOM 4948 NH2 ARG A 850 126.407 124.383 166.250 1.00 62.67 N
ATOM 4949 N ASN A 851 131.825 119.908 165.546 1.00 61.05 N
ATOM 4950 CA ASN A 851 132.572 120.715 164.598 1.00 61.05 C
ATOM 4951 C ASN A 851 132.839 120.000 163.290 1.00 61.05 C
ATOM 4952 O ASN A 851 133.449 120.594 162.399 1.00 61.05 O
ATOM 4953 CB ASN A 851 133.891 121.154 165.215 1.00 61.05 C
ATOM 4954 CG ASN A 851 133.700 122.167 166.296 1.00 61.05 C
ATOM 4955 OD1 ASN A 851 132.900 123.089 166.158 1.00 61.05 O
ATOM 4956 ND2 ASN A 851 134.419 122.001 167.394 1.00 61.05 N
ATOM 4957 N LEU A 852 132.437 118.738 163.168 1.00 59.99 N
ATOM 4958 CA LEU A 852 132.539 118.042 161.894 1.00 59.99 C
ATOM 4959 C LEU A 852 131.645 118.740 160.881 1.00 59.99 C
ATOM 4960 O LEU A 852 130.439 118.890 161.090 1.00 59.99 O
ATOM 4961 CB LEU A 852 132.143 116.581 162.052 1.00 59.99 C
ATOM 4962 CG LEU A 852 132.362 115.658 160.854 1.00 59.99 C
ATOM 4963 CD1 LEU A 852 133.831 115.471 160.588 1.00 59.99 C
ATOM 4964 CD2 LEU A 852 131.688 114.317 161.077 1.00 59.99 C
ATOM 4965 N GLY A 853 132.250 119.187 159.792 1.00 58.04 N
ATOM 4966 CA GLY A 853 131.729 120.285 159.024 1.00 58.04 C
ATOM 4967 C GLY A 853 132.897 121.211 158.794 1.00 58.04 C
ATOM 4968 O GLY A 853 134.017 120.882 159.190 1.00 58.04 O
ATOM 4969 N PRO A 854 132.698 122.363 158.148 1.00 54.93 N
ATOM 4970 CA PRO A 854 133.860 123.108 157.616 1.00 54.93 C
ATOM 4971 C PRO A 854 134.737 123.795 158.654 1.00 54.93 C
ATOM 4972 O PRO A 854 135.644 124.543 158.278 1.00 54.93 O
ATOM 4973 CB PRO A 854 133.204 124.131 156.682 1.00 54.93 C
ATOM 4974 CG PRO A 854 131.894 123.551 156.344 1.00 54.93 C
ATOM 4975 CD PRO A 854 131.437 122.839 157.570 1.00 54.93 C
ATOM 4976 N LYS A 855 134.506 123.555 159.939 1.00 60.73 N
ATOM 4977 CA LYS A 855 135.222 124.258 160.987 1.00 60.73 C
ATOM 4978 C LYS A 855 136.563 123.618 161.331 1.00 60.73 C
ATOM 4979 O LYS A 855 137.366 124.243 162.039 1.00 60.73 O
ATOM 4980 CB LYS A 855 134.346 124.308 162.232 1.00 60.73 C
ATOM 4981 CG LYS A 855 133.023 125.006 162.014 1.00 60.73 C
ATOM 4982 CD LYS A 855 132.198 125.029 163.283 1.00 60.73 C
ATOM 4983 CE LYS A 855 130.806 125.546 163.000 1.00 60.73 C
ATOM 4984 NZ LYS A 855 130.834 126.969 162.583 1.00 60.73 N1+
ATOM 4985 N ILE A 856 136.828 122.400 160.845 1.00 63.58 N
ATOM 4986 CA ILE A 856 137.898 121.568 161.403 1.00 63.58 C
ATOM 4987 C ILE A 856 139.269 122.130 161.056 1.00 63.58 C
ATOM 4988 O ILE A 856 140.219 121.999 161.838 1.00 63.58 O
ATOM 4989 CB ILE A 856 137.744 120.120 160.911 1.00 63.58 C
ATOM 4990 CG1 ILE A 856 136.348 119.644 161.217 1.00 63.58 C
ATOM 4991 CG2 ILE A 856 138.653 119.188 161.669 1.00 63.58 C
ATOM 4992 CD1 ILE A 856 135.994 118.429 160.461 1.00 63.58 C
ATOM 4993 N ILE A 857 139.387 122.764 159.882 1.00 64.45 N
ATOM 4994 CA ILE A 857 140.603 123.481 159.500 1.00 64.45 C
ATOM 4995 C ILE A 857 140.955 124.523 160.546 1.00 64.45 C
ATOM 4996 O ILE A 857 142.124 124.692 160.912 1.00 64.45 O
ATOM 4997 CB ILE A 857 140.418 124.128 158.120 1.00 64.45 C
ATOM 4998 CG1 ILE A 857 140.193 123.065 157.066 1.00 64.45 C
ATOM 4999 CG2 ILE A 857 141.618 124.960 157.727 1.00 64.45 C
ATOM 5000 CD1 ILE A 857 139.743 123.654 155.776 1.00 64.45 C
ATOM 5001 N MET A 858 139.941 125.224 161.050 1.00 68.19 N
ATOM 5002 CA MET A 858 140.108 126.030 162.248 1.00 68.19 C
ATOM 5003 C MET A 858 140.542 125.170 163.420 1.00 68.19 C
ATOM 5004 O MET A 858 141.666 125.322 163.922 1.00 68.19 O
ATOM 5005 CB MET A 858 138.794 126.727 162.579 1.00 68.19 C
ATOM 5006 CG MET A 858 138.865 127.712 163.713 1.00 68.19 C
ATOM 5007 SD MET A 858 137.218 128.316 164.108 1.00 68.19 S
ATOM 5008 CE MET A 858 136.834 129.213 162.613 1.00 68.19 C
ATOM 5009 N LEU A 859 139.720 124.164 163.749 1.00 60.65 N
ATOM 5010 CA LEU A 859 139.617 123.621 165.102 1.00 60.65 C
ATOM 5011 C LEU A 859 140.936 123.076 165.620 1.00 60.65 C
ATOM 5012 O LEU A 859 141.444 123.554 166.645 1.00 60.65 O
ATOM 5013 CB LEU A 859 138.567 122.524 165.128 1.00 60.65 C
ATOM 5014 CG LEU A 859 138.411 121.906 166.503 1.00 60.65 C
ATOM 5015 CD1 LEU A 859 137.874 122.931 167.451 1.00 60.65 C
ATOM 5016 CD2 LEU A 859 137.492 120.727 166.409 1.00 60.65 C
ATOM 5017 N GLN A 860 141.523 122.124 164.886 1.00 60.44 N
ATOM 5018 CA GLN A 860 142.788 121.502 165.266 1.00 60.44 C
ATOM 5019 C GLN A 860 143.884 122.533 165.449 1.00 60.44 C
ATOM 5020 O GLN A 860 144.589 122.517 166.470 1.00 60.44 O
ATOM 5021 CB GLN A 860 143.205 120.490 164.209 1.00 60.44 C
ATOM 5022 CG GLN A 860 142.325 119.288 164.150 1.00 60.44 C
ATOM 5023 CD GLN A 860 142.715 118.378 163.029 1.00 60.44 C
ATOM 5024 OE1 GLN A 860 143.591 118.705 162.232 1.00 60.44 O
ATOM 5025 NE2 GLN A 860 142.075 117.222 162.957 1.00 60.44 N
ATOM 5026 N ARG A 861 143.972 123.489 164.508 1.00 64.98 N
ATOM 5027 CA ARG A 861 144.996 124.526 164.573 1.00 64.98 C
ATOM 5028 C ARG A 861 144.879 125.328 165.850 1.00 64.98 C
ATOM 5029 O ARG A 861 145.892 125.553 166.532 1.00 64.98 O
ATOM 5030 CB ARG A 861 144.904 125.453 163.367 1.00 64.98 C
ATOM 5031 CG ARG A 861 145.439 124.872 162.087 1.00 64.98 C
ATOM 5032 CD ARG A 861 145.300 125.881 160.966 1.00 64.98 C
ATOM 5033 NE ARG A 861 145.812 125.381 159.695 1.00 64.98 N
ATOM 5034 CZ ARG A 861 145.699 126.032 158.543 1.00 64.98 C
ATOM 5035 NH1 ARG A 861 145.078 127.202 158.502 1.00 64.98 N
ATOM 5036 NH2 ARG A 861 146.193 125.509 157.431 1.00 64.98 N
ATOM 5037 N MET A 862 143.633 125.630 166.250 1.00 64.24 N
ATOM 5038 CA MET A 862 143.377 126.387 167.469 1.00 64.24 C
ATOM 5039 C MET A 862 143.972 125.684 168.668 1.00 64.24 C
ATOM 5040 O MET A 862 144.767 126.292 169.404 1.00 64.24 O
ATOM 5041 CB MET A 862 141.878 126.567 167.667 1.00 64.24 C
ATOM 5042 CG MET A 862 141.205 127.387 166.609 1.00 64.24 C
ATOM 5043 SD MET A 862 141.864 129.043 166.598 1.00 64.24 S
ATOM 5044 CE MET A 862 141.285 129.587 168.193 1.00 64.24 C
ATOM 5045 N MET A 863 143.737 124.361 168.752 1.00 63.58 N
ATOM 5046 CA MET A 863 144.211 123.553 169.871 1.00 63.58 C
ATOM 5047 C MET A 863 145.714 123.656 170.006 1.00 63.58 C
ATOM 5048 O MET A 863 146.219 123.990 171.090 1.00 63.58 O
ATOM 5049 CB MET A 863 143.813 122.092 169.682 1.00 63.58 C
ATOM 5050 CG MET A 863 142.342 121.803 169.788 1.00 63.58 C
ATOM 5051 SD MET A 863 142.036 120.043 169.555 1.00 63.58 S
ATOM 5052 CE MET A 863 140.253 120.001 169.600 1.00 63.58 C
ATOM 5053 N ILE A 864 146.411 123.567 168.863 1.00 59.38 N
ATOM 5054 CA ILE A 864 147.868 123.533 168.861 1.00 59.38 C
ATOM 5055 C ILE A 864 148.415 124.825 169.427 1.00 59.38 C
ATOM 5056 O ILE A 864 149.208 124.802 170.382 1.00 59.38 O
ATOM 5057 CB ILE A 864 148.391 123.268 167.441 1.00 59.38 C
ATOM 5058 CG1 ILE A 864 147.901 121.915 166.949 1.00 59.38 C
ATOM 5059 CG2 ILE A 864 149.893 123.292 167.425 1.00 59.38 C
ATOM 5060 CD1 ILE A 864 148.131 121.698 165.484 1.00 59.38 C
ATOM 5061 N ASP A 865 147.846 125.958 168.987 1.00 63.01 N
ATOM 5062 CA ASP A 865 148.382 127.249 169.399 1.00 63.01 C
ATOM 5063 C ASP A 865 148.157 127.472 170.877 1.00 63.01 C
ATOM 5064 O ASP A 865 149.068 127.937 171.576 1.00 63.01 O
ATOM 5065 CB ASP A 865 147.769 128.380 168.582 1.00 63.01 C
ATOM 5066 CG ASP A 865 148.322 128.441 167.180 1.00 63.01 C
ATOM 5067 OD1 ASP A 865 149.482 128.024 166.986 1.00 63.01 O
ATOM 5068 OD2 ASP A 865 147.608 128.911 166.273 1.00 63.01 O
ATOM 5069 N VAL A 866 147.022 126.991 171.395 1.00 56.15 N
ATOM 5070 CA VAL A 866 146.722 127.258 172.792 1.00 56.15 C
ATOM 5071 C VAL A 866 147.644 126.439 173.678 1.00 56.15 C
ATOM 5072 O VAL A 866 148.142 126.948 174.697 1.00 56.15 O
ATOM 5073 CB VAL A 866 145.233 127.008 173.081 1.00 56.15 C
ATOM 5074 CG1 VAL A 866 144.921 127.250 174.535 1.00 56.15 C
ATOM 5075 CG2 VAL A 866 144.405 127.938 172.245 1.00 56.15 C
ATOM 5076 N PHE A 867 148.013 125.222 173.212 1.00 65.30 N
ATOM 5077 CA PHE A 867 149.016 124.425 173.915 1.00 65.30 C
ATOM 5078 C PHE A 867 150.317 125.189 174.045 1.00 65.30 C
ATOM 5079 O PHE A 867 150.828 125.361 175.163 1.00 65.30 O
ATOM 5080 CB PHE A 867 149.291 123.098 173.207 1.00 65.30 C
ATOM 5081 CG PHE A 867 148.315 122.005 173.513 1.00 65.30 C
ATOM 5082 CD1 PHE A 867 148.272 121.441 174.775 1.00 65.30 C
ATOM 5083 CD2 PHE A 867 147.541 121.446 172.508 1.00 65.30 C
ATOM 5084 CE1 PHE A 867 147.403 120.411 175.052 1.00 65.30 C
ATOM 5085 CE2 PHE A 867 146.683 120.402 172.774 1.00 65.30 C
ATOM 5086 CZ PHE A 867 146.627 119.871 174.043 1.00 65.30 C
ATOM 5087 N PHE A 868 150.768 125.783 172.932 1.00 58.25 N
ATOM 5088 CA PHE A 868 152.029 126.505 172.937 1.00 58.25 C
ATOM 5089 C PHE A 868 151.943 127.704 173.855 1.00 58.25 C
ATOM 5090 O PHE A 868 152.867 127.943 174.646 1.00 58.25 O
ATOM 5091 CB PHE A 868 152.400 126.933 171.525 1.00 58.25 C
ATOM 5092 CG PHE A 868 153.690 127.669 171.451 1.00 58.25 C
ATOM 5093 CD1 PHE A 868 154.882 127.007 171.648 1.00 58.25 C
ATOM 5094 CD2 PHE A 868 153.716 129.020 171.181 1.00 58.25 C
ATOM 5095 CE1 PHE A 868 156.076 127.676 171.587 1.00 58.25 C
ATOM 5096 CE2 PHE A 868 154.908 129.696 171.118 1.00 58.25 C
ATOM 5097 CZ PHE A 868 156.089 129.022 171.322 1.00 58.25 C
ATOM 5098 N PHE A 869 150.773 128.361 173.863 1.00 55.42 N
ATOM 5099 CA PHE A 869 150.557 129.510 174.730 1.00 55.42 C
ATOM 5100 C PHE A 869 150.709 129.129 176.184 1.00 55.42 C
ATOM 5101 O PHE A 869 151.457 129.789 176.921 1.00 55.42 O
ATOM 5102 CB PHE A 869 149.180 130.111 174.488 1.00 55.42 C
ATOM 5103 CG PHE A 869 148.737 131.028 175.577 1.00 55.42 C
ATOM 5104 CD1 PHE A 869 149.341 132.250 175.767 1.00 55.42 C
ATOM 5105 CD2 PHE A 869 147.699 130.662 176.414 1.00 55.42 C
ATOM 5106 CE1 PHE A 869 148.928 133.082 176.781 1.00 55.42 C
ATOM 5107 CE2 PHE A 869 147.286 131.490 177.421 1.00 55.42 C
ATOM 5108 CZ PHE A 869 147.901 132.703 177.603 1.00 55.42 C
ATOM 5109 N LEU A 870 150.114 127.994 176.572 1.00 57.61 N
ATOM 5110 CA LEU A 870 150.168 127.581 177.967 1.00 57.61 C
ATOM 5111 C LEU A 870 151.590 127.257 178.367 1.00 57.61 C
ATOM 5112 O LEU A 870 152.013 127.596 179.484 1.00 57.61 O
ATOM 5113 CB LEU A 870 149.251 126.388 178.211 1.00 57.61 C
ATOM 5114 CG LEU A 870 147.767 126.723 178.167 1.00 57.61 C
ATOM 5115 CD1 LEU A 870 146.955 125.464 178.292 1.00 57.61 C
ATOM 5116 CD2 LEU A 870 147.437 127.676 179.287 1.00 57.61 C
ATOM 5117 N PHE A 871 152.366 126.718 177.414 1.00 61.15 N
ATOM 5118 CA PHE A 871 153.766 126.415 177.665 1.00 61.15 C
ATOM 5119 C PHE A 871 154.523 127.671 178.046 1.00 61.15 C
ATOM 5120 O PHE A 871 155.168 127.710 179.104 1.00 61.15 O
ATOM 5121 CB PHE A 871 154.391 125.757 176.441 1.00 61.15 C
ATOM 5122 CG PHE A 871 155.856 125.527 176.576 1.00 61.15 C
ATOM 5123 CD1 PHE A 871 156.339 124.542 177.411 1.00 61.15 C
ATOM 5124 CD2 PHE A 871 156.754 126.300 175.866 1.00 61.15 C
ATOM 5125 CE1 PHE A 871 157.692 124.332 177.540 1.00 61.15 C
ATOM 5126 CE2 PHE A 871 158.104 126.098 175.989 1.00 61.15 C
ATOM 5127 CZ PHE A 871 158.576 125.111 176.827 1.00 61.15 C
ATOM 5128 N LEU A 872 154.327 128.747 177.268 1.00 60.29 N
ATOM 5129 CA LEU A 872 155.000 130.004 177.565 1.00 60.29 C
ATOM 5130 C LEU A 872 154.540 130.541 178.898 1.00 60.29 C
ATOM 5131 O LEU A 872 155.369 130.955 179.721 1.00 60.29 O
ATOM 5132 CB LEU A 872 154.747 131.024 176.464 1.00 60.29 C
ATOM 5133 CG LEU A 872 155.416 130.683 175.141 1.00 60.29 C
ATOM 5134 CD1 LEU A 872 155.046 131.695 174.104 1.00 60.29 C
ATOM 5135 CD2 LEU A 872 156.905 130.641 175.315 1.00 60.29 C
ATOM 5136 N PHE A 873 153.242 130.378 179.180 1.00 63.05 N
ATOM 5137 CA PHE A 873 152.682 130.860 180.430 1.00 63.05 C
ATOM 5138 C PHE A 873 153.303 130.133 181.603 1.00 63.05 C
ATOM 5139 O PHE A 873 153.720 130.777 182.579 1.00 63.05 O
ATOM 5140 CB PHE A 873 151.171 130.683 180.422 1.00 63.05 C
ATOM 5141 CG PHE A 873 150.505 131.163 181.663 1.00 63.05 C
ATOM 5142 CD1 PHE A 873 150.381 132.511 181.914 1.00 63.05 C
ATOM 5143 CD2 PHE A 873 149.990 130.265 182.575 1.00 63.05 C
ATOM 5144 CE1 PHE A 873 149.766 132.957 183.053 1.00 63.05 C
ATOM 5145 CE2 PHE A 873 149.369 130.703 183.715 1.00 63.05 C
ATOM 5146 CZ PHE A 873 149.254 132.052 183.952 1.00 63.05 C
ATOM 5147 N ALA A 874 153.515 128.817 181.446 1.00 66.15 N
ATOM 5148 CA ALA A 874 154.094 128.027 182.524 1.00 66.15 C
ATOM 5149 C ALA A 874 155.503 128.493 182.826 1.00 66.15 C
ATOM 5150 O ALA A 874 155.856 128.668 184.004 1.00 66.15 O
ATOM 5151 CB ALA A 874 154.084 126.545 182.165 1.00 66.15 C
ATOM 5152 N VAL A 875 156.254 128.839 181.766 1.00 64.82 N
ATOM 5153 CA VAL A 875 157.627 129.305 181.920 1.00 64.82 C
ATOM 5154 C VAL A 875 157.653 130.552 182.771 1.00 64.82 C
ATOM 5155 O VAL A 875 158.365 130.597 183.790 1.00 64.82 O
ATOM 5156 CB VAL A 875 158.272 129.551 180.547 1.00 64.82 C
ATOM 5157 CG1 VAL A 875 159.632 130.173 180.723 1.00 64.82 C
ATOM 5158 CG2 VAL A 875 158.395 128.257 179.792 1.00 64.82 C
ATOM 5159 N TRP A 876 156.733 131.488 182.476 1.00 72.96 N
ATOM 5160 CA TRP A 876 156.705 132.762 183.180 1.00 72.96 C
ATOM 5161 C TRP A 876 156.443 132.544 184.651 1.00 72.96 C
ATOM 5162 O TRP A 876 157.145 133.116 185.499 1.00 72.96 O
ATOM 5163 CB TRP A 876 155.633 133.685 182.611 1.00 72.96 C
ATOM 5164 CG TRP A 876 155.658 135.004 183.291 1.00 72.96 C
ATOM 5165 CD1 TRP A 876 156.521 136.022 183.055 1.00 72.96 C
ATOM 5166 CD2 TRP A 876 154.858 135.407 184.406 1.00 72.96 C
ATOM 5167 NE1 TRP A 876 156.272 137.063 183.911 1.00 72.96 N
ATOM 5168 CE2 TRP A 876 155.260 136.704 184.760 1.00 72.96 C
ATOM 5169 CE3 TRP A 876 153.833 134.800 185.129 1.00 72.96 C
ATOM 5170 CZ2 TRP A 876 154.667 137.408 185.797 1.00 72.96 C
ATOM 5171 CZ3 TRP A 876 153.245 135.501 186.157 1.00 72.96 C
ATOM 5172 CH2 TRP A 876 153.664 136.792 186.483 1.00 72.96 C
ATOM 5173 N MET A 877 155.547 131.595 184.954 1.00 85.83 N
ATOM 5174 CA MET A 877 155.115 131.405 186.328 1.00 85.83 C
ATOM 5175 C MET A 877 156.268 130.909 187.174 1.00 85.83 C
ATOM 5176 O MET A 877 156.494 131.427 188.279 1.00 85.83 O
ATOM 5177 CB MET A 877 153.943 130.432 186.390 1.00 85.83 C
ATOM 5178 CG MET A 877 153.279 130.388 187.745 1.00 85.83 C
ATOM 5179 SD MET A 877 152.497 131.963 188.106 1.00 85.83 S
ATOM 5180 CE MET A 877 151.081 131.874 187.031 1.00 85.83 C
ATOM 5181 N VAL A 878 157.101 130.032 186.591 1.00 85.50 N
ATOM 5182 CA VAL A 878 158.213 129.460 187.341 1.00 85.50 C
ATOM 5183 C VAL A 878 159.215 130.546 187.675 1.00 85.50 C
ATOM 5184 O VAL A 878 159.681 130.640 188.821 1.00 85.50 O
ATOM 5185 CB VAL A 878 158.853 128.305 186.555 1.00 85.50 C
ATOM 5186 CG1 VAL A 878 160.099 127.807 187.251 1.00 85.50 C
ATOM 5187 CG2 VAL A 878 157.859 127.175 186.407 1.00 85.50 C
ATOM 5188 N ALA A 879 159.426 131.468 186.724 1.00 83.85 N
ATOM 5189 CA ALA A 879 160.328 132.586 186.949 1.00 83.85 C
ATOM 5190 C ALA A 879 159.832 133.439 188.095 1.00 83.85 C
ATOM 5191 O ALA A 879 160.588 133.698 189.047 1.00 83.85 O
ATOM 5192 CB ALA A 879 160.463 133.414 185.679 1.00 83.85 C
ATOM 5193 N PHE A 880 158.518 133.725 188.090 1.00 89.48 N
ATOM 5194 CA PHE A 880 157.895 134.509 189.149 1.00 89.48 C
ATOM 5195 C PHE A 880 158.111 133.854 190.492 1.00 89.48 C
ATOM 5196 O PHE A 880 158.587 134.511 191.432 1.00 89.48 O
ATOM 5197 CB PHE A 880 156.403 134.672 188.880 1.00 89.48 C
ATOM 5198 CG PHE A 880 155.676 135.446 189.942 1.00 89.48 C
ATOM 5199 CD1 PHE A 880 155.795 136.822 190.012 1.00 89.48 C
ATOM 5200 CD2 PHE A 880 154.865 134.800 190.864 1.00 89.48 C
ATOM 5201 CE1 PHE A 880 155.128 137.539 190.986 1.00 89.48 C
ATOM 5202 CE2 PHE A 880 154.195 135.512 191.840 1.00 89.48 C
ATOM 5203 CZ PHE A 880 154.326 136.883 191.899 1.00 89.48 C
ATOM 5204 N GLY A 881 157.943 132.523 190.527 1.00 97.80 N
ATOM 5205 CA GLY A 881 158.051 131.789 191.773 1.00 97.80 C
ATOM 5206 C GLY A 881 159.425 131.914 192.388 1.00 97.80 C
ATOM 5207 O GLY A 881 159.544 132.251 193.573 1.00 97.80 O
ATOM 5208 N VAL A 882 160.468 131.814 191.550 1.00 96.50 N
ATOM 5209 CA VAL A 882 161.831 131.900 192.058 1.00 96.50 C
ATOM 5210 C VAL A 882 162.078 133.288 192.605 1.00 96.50 C
ATOM 5211 O VAL A 882 162.480 133.444 193.771 1.00 96.50 O
ATOM 5212 CB VAL A 882 162.842 131.537 190.959 1.00 96.50 C
ATOM 5213 CG1 VAL A 882 164.249 131.755 191.457 1.00 96.50 C
ATOM 5214 CG2 VAL A 882 162.649 130.100 190.531 1.00 96.50 C
ATOM 5215 N ALA A 883 161.650 134.299 191.839 1.00100.01 N
ATOM 5216 CA ALA A 883 161.837 135.684 192.242 1.00100.01 C
ATOM 5217 C ALA A 883 161.072 135.965 193.515 1.00100.01 C
ATOM 5218 O ALA A 883 161.596 136.630 194.422 1.00100.01 O
ATOM 5219 CB ALA A 883 161.385 136.617 191.127 1.00100.01 C
ATOM 5220 N ARG A 884 159.904 135.321 193.654 1.00112.66 N
ATOM 5221 CA ARG A 884 159.049 135.554 194.807 1.00112.66 C
ATOM 5222 C ARG A 884 159.738 135.101 196.077 1.00112.66 C
ATOM 5223 O ARG A 884 159.805 135.856 197.057 1.00112.66 O
ATOM 5224 CB ARG A 884 157.724 134.827 194.629 1.00112.66 C
ATOM 5225 CG ARG A 884 156.751 135.096 195.734 1.00112.66 C
ATOM 5226 CD ARG A 884 155.458 134.376 195.482 1.00112.66 C
ATOM 5227 NE ARG A 884 154.493 134.612 196.546 1.00112.66 N
ATOM 5228 CZ ARG A 884 153.275 134.089 196.559 1.00112.66 C
ATOM 5229 NH1 ARG A 884 152.443 134.347 197.559 1.00112.66 N
ATOM 5230 NH2 ARG A 884 152.898 133.303 195.565 1.00112.66 N
ATOM 5231 N GLN A 885 160.382 133.929 196.027 1.00119.94 N
ATOM 5232 CA GLN A 885 161.009 133.429 197.240 1.00119.94 C
ATOM 5233 C GLN A 885 162.252 134.238 197.550 1.00119.94 C
ATOM 5234 O GLN A 885 162.555 134.493 198.725 1.00119.94 O
ATOM 5235 CB GLN A 885 161.318 131.942 197.114 1.00119.94 C
ATOM 5236 CG GLN A 885 161.805 131.325 198.404 1.00119.94 C
ATOM 5237 CD GLN A 885 161.854 129.823 198.337 1.00119.94 C
ATOM 5238 OE1 GLN A 885 161.516 129.228 197.318 1.00119.94 O
ATOM 5239 NE2 GLN A 885 162.270 129.195 199.428 1.00119.94 N
ATOM 5240 N GLY A 886 162.885 134.779 196.499 1.00111.24 N
ATOM 5241 CA GLY A 886 164.042 135.633 196.693 1.00111.24 C
ATOM 5242 C GLY A 886 163.695 136.900 197.444 1.00111.24 C
ATOM 5243 O GLY A 886 164.523 137.457 198.166 1.00111.24 O
ATOM 5244 N ILE A 887 162.444 137.340 197.332 1.00115.15 N
ATOM 5245 CA ILE A 887 162.033 138.499 198.106 1.00115.15 C
ATOM 5246 C ILE A 887 161.636 138.073 199.512 1.00115.15 C
ATOM 5247 O ILE A 887 161.970 138.740 200.498 1.00115.15 O
ATOM 5248 CB ILE A 887 160.903 139.249 197.382 1.00115.15 C
ATOM 5249 CG1 ILE A 887 161.403 139.734 196.023 1.00115.15 C
ATOM 5250 CG2 ILE A 887 160.434 140.442 198.186 1.00115.15 C
ATOM 5251 CD1 ILE A 887 160.320 140.281 195.132 1.00115.15 C
ATOM 5252 N LEU A 888 160.967 136.925 199.637 1.00126.49 N
ATOM 5253 CA LEU A 888 160.163 136.713 200.839 1.00126.49 C
ATOM 5254 C LEU A 888 160.938 135.986 201.928 1.00126.49 C
ATOM 5255 O LEU A 888 160.994 136.447 203.073 1.00126.49 O
ATOM 5256 CB LEU A 888 158.878 135.963 200.497 1.00126.49 C
ATOM 5257 CG LEU A 888 157.882 136.742 199.637 1.00126.49 C
ATOM 5258 CD1 LEU A 888 156.654 135.899 199.358 1.00126.49 C
ATOM 5259 CD2 LEU A 888 157.501 138.058 200.289 1.00126.49 C
ATOM 5260 N ARG A 889 161.531 134.843 201.604 1.00138.62 N
ATOM 5261 CA ARG A 889 162.186 134.030 202.616 1.00138.62 C
ATOM 5262 C ARG A 889 163.624 133.768 202.208 1.00138.62 C
ATOM 5263 O ARG A 889 163.887 133.278 201.106 1.00138.62 O
ATOM 5264 CB ARG A 889 161.449 132.700 202.827 1.00138.62 C
ATOM 5265 N LYS A 890 164.554 134.094 203.103 1.00146.11 N
ATOM 5266 CA LYS A 890 165.971 133.841 202.885 1.00146.11 C
ATOM 5267 C LYS A 890 166.516 133.102 204.107 1.00146.11 C
ATOM 5268 O LYS A 890 167.113 133.707 205.001 1.00146.11 O
ATOM 5269 CB LYS A 890 166.727 135.142 202.622 1.00146.11 C
ATOM 5270 N ASN A 891 166.323 131.783 204.103 1.00151.70 N
ATOM 5271 CA ASN A 891 166.788 130.858 205.128 1.00151.70 C
ATOM 5272 C ASN A 891 166.505 129.450 204.630 1.00151.70 C
ATOM 5273 O ASN A 891 165.905 129.267 203.566 1.00151.70 O
ATOM 5274 CB ASN A 891 166.096 131.080 206.480 1.00151.70 C
ATOM 5275 N GLU A 892 166.945 128.464 205.423 1.00155.73 N
ATOM 5276 CA GLU A 892 166.491 127.076 205.328 1.00155.73 C
ATOM 5277 C GLU A 892 166.759 126.418 203.977 1.00155.73 C
ATOM 5278 O GLU A 892 165.836 126.232 203.177 1.00155.73 O
ATOM 5279 CB GLU A 892 165.006 126.986 205.683 1.00155.73 C
ATOM 5280 CG GLU A 892 164.721 127.339 207.132 1.00155.73 C
ATOM 5281 CD GLU A 892 165.313 126.336 208.107 1.00155.73 C
ATOM 5282 OE1 GLU A 892 165.352 125.132 207.775 1.00155.73 O
ATOM 5283 OE2 GLU A 892 165.747 126.753 209.201 1.00155.73 O
ATOM 5284 N HIS A 893 168.019 126.073 203.709 1.00155.06 N
ATOM 5285 CA HIS A 893 168.458 125.581 202.407 1.00155.06 C
ATOM 5286 C HIS A 893 168.167 124.099 202.186 1.00155.06 C
ATOM 5287 O HIS A 893 168.948 123.427 201.499 1.00155.06 O
ATOM 5288 CB HIS A 893 169.955 125.844 202.221 1.00155.06 C
ATOM 5289 N ARG A 894 167.080 123.592 202.759 1.00155.68 N
ATOM 5290 CA ARG A 894 166.727 122.194 202.560 1.00155.68 C
ATOM 5291 C ARG A 894 166.349 122.007 201.098 1.00155.68 C
ATOM 5292 O ARG A 894 165.634 122.830 200.527 1.00155.68 O
ATOM 5293 CB ARG A 894 165.570 121.795 203.473 1.00155.68 C
ATOM 5294 CG ARG A 894 165.834 122.079 204.940 1.00155.68 C
ATOM 5295 CD ARG A 894 164.817 121.392 205.834 1.00155.68 C
ATOM 5296 NE ARG A 894 165.074 121.660 207.245 1.00155.68 N
ATOM 5297 CZ ARG A 894 166.037 121.077 207.950 1.00155.68 C
ATOM 5298 NH1 ARG A 894 166.840 120.194 207.372 1.00155.68 N
ATOM 5299 NH2 ARG A 894 166.200 121.379 209.230 1.00155.68 N
ATOM 5300 N TRP A 895 166.825 120.926 200.494 1.00155.81 N
ATOM 5301 CA TRP A 895 166.544 120.669 199.088 1.00155.81 C
ATOM 5302 C TRP A 895 165.060 120.456 198.806 1.00155.81 C
ATOM 5303 O TRP A 895 164.524 120.983 197.833 1.00155.81 O
ATOM 5304 CB TRP A 895 167.338 119.449 198.618 1.00155.81 C
ATOM 5305 CG TRP A 895 167.382 119.289 197.136 1.00155.81 C
ATOM 5306 CD1 TRP A 895 166.372 118.858 196.328 1.00155.81 C
ATOM 5307 CD2 TRP A 895 168.499 119.549 196.280 1.00155.81 C
ATOM 5308 NE1 TRP A 895 166.790 118.838 195.019 1.00155.81 N
ATOM 5309 CE2 TRP A 895 168.093 119.258 194.963 1.00155.81 C
ATOM 5310 CE3 TRP A 895 169.803 120.002 196.498 1.00155.81 C
ATOM 5311 CZ2 TRP A 895 168.943 119.405 193.869 1.00155.81 C
ATOM 5312 CZ3 TRP A 895 170.646 120.148 195.411 1.00155.81 C
ATOM 5313 CH2 TRP A 895 170.213 119.851 194.114 1.00155.81 C
ATOM 5314 N GLU A 896 164.400 119.683 199.662 1.00152.86 N
ATOM 5315 CA GLU A 896 162.977 119.396 199.499 1.00152.86 C
ATOM 5316 C GLU A 896 162.070 120.617 199.640 1.00152.86 C
ATOM 5317 O GLU A 896 161.125 120.790 198.873 1.00152.86 O
ATOM 5318 CB GLU A 896 162.537 118.307 200.481 1.00152.86 C
ATOM 5319 N TRP A 897 162.363 121.459 200.626 1.00151.99 N
ATOM 5320 CA TRP A 897 161.553 122.645 200.884 1.00151.99 C
ATOM 5321 C TRP A 897 161.549 123.667 199.751 1.00151.99 C
ATOM 5322 O TRP A 897 160.503 124.210 199.401 1.00151.99 O
ATOM 5323 CB TRP A 897 162.026 123.322 202.173 1.00151.99 C
ATOM 5324 CG TRP A 897 161.812 122.496 203.400 1.00151.99 C
ATOM 5325 CD1 TRP A 897 162.111 121.175 203.563 1.00151.99 C
ATOM 5326 CD2 TRP A 897 161.268 122.940 204.649 1.00151.99 C
ATOM 5327 NE1 TRP A 897 161.777 120.766 204.831 1.00151.99 N
ATOM 5328 CE2 TRP A 897 161.258 121.832 205.519 1.00151.99 C
ATOM 5329 CE3 TRP A 897 160.784 124.166 205.114 1.00151.99 C
ATOM 5330 CZ2 TRP A 897 160.784 121.913 206.827 1.00151.99 C
ATOM 5331 CZ3 TRP A 897 160.314 124.245 206.413 1.00151.99 C
ATOM 5332 CH2 TRP A 897 160.317 123.126 207.253 1.00151.99 C
ATOM 5333 N ILE A 898 162.720 123.922 199.180 1.00141.69 N
ATOM 5334 CA ILE A 898 162.843 124.899 198.104 1.00141.69 C
ATOM 5335 C ILE A 898 162.082 124.524 196.835 1.00141.69 C
ATOM 5336 O ILE A 898 161.437 125.370 196.216 1.00141.69 O
ATOM 5337 CB ILE A 898 164.318 125.163 197.756 1.00141.69 C
ATOM 5338 CG1 ILE A 898 165.063 125.685 198.987 1.00141.69 C
ATOM 5339 CG2 ILE A 898 164.421 126.151 196.605 1.00141.69 C
ATOM 5340 CD1 ILE A 898 166.528 125.971 198.744 1.00141.69 C
ATOM 5341 N PHE A 899 162.153 123.253 196.456 1.00141.44 N
ATOM 5342 CA PHE A 899 161.475 122.781 195.256 1.00141.44 C
ATOM 5343 C PHE A 899 159.962 122.916 195.364 1.00141.44 C
ATOM 5344 O PHE A 899 159.293 123.303 194.409 1.00141.44 O
ATOM 5345 CB PHE A 899 161.841 121.327 194.971 1.00141.44 C
ATOM 5346 CG PHE A 899 161.012 120.698 193.893 1.00141.44 C
ATOM 5347 CD1 PHE A 899 161.547 120.459 192.639 1.00141.44 C
ATOM 5348 CD2 PHE A 899 159.693 120.355 194.130 1.00141.44 C
ATOM 5349 CE1 PHE A 899 160.784 119.880 191.643 1.00141.44 C
ATOM 5350 CE2 PHE A 899 158.923 119.778 193.139 1.00141.44 C
ATOM 5351 CZ PHE A 899 159.470 119.540 191.893 1.00141.44 C
ATOM 5352 N ARG A 900 159.430 122.593 196.538 1.00141.67 N
ATOM 5353 CA ARG A 900 157.989 122.668 196.771 1.00141.67 C
ATOM 5354 C ARG A 900 157.469 124.088 196.614 1.00141.67 C
ATOM 5355 O ARG A 900 156.404 124.307 196.015 1.00141.67 O
ATOM 5356 CB ARG A 900 157.666 122.150 198.175 1.00141.67 C
ATOM 5357 CG ARG A 900 157.760 120.646 198.352 1.00141.67 C
ATOM 5358 CD ARG A 900 157.511 120.257 199.800 1.00141.67 C
ATOM 5359 NE ARG A 900 157.465 118.810 199.977 1.00141.67 N
ATOM 5360 CZ ARG A 900 157.289 118.209 201.149 1.00141.67 C
ATOM 5361 NH1 ARG A 900 157.147 118.932 202.252 1.00141.67 N
ATOM 5362 NH2 ARG A 900 157.256 116.885 201.219 1.00141.67 N
ATOM 5363 N SER A 901 158.227 125.060 197.128 1.00141.40 N
ATOM 5364 CA SER A 901 157.840 126.460 197.021 1.00141.40 C
ATOM 5365 C SER A 901 157.820 126.914 195.570 1.00141.40 C
ATOM 5366 O SER A 901 156.780 127.358 195.072 1.00141.40 O
ATOM 5367 CB SER A 901 158.792 127.332 197.837 1.00141.40 C
ATOM 5368 OG SER A 901 160.083 127.348 197.257 1.00141.40 O
ATOM 5369 N VAL A 902 158.925 126.708 194.851 1.00135.05 N
ATOM 5370 CA VAL A 902 159.064 127.300 193.524 1.00135.05 C
ATOM 5371 C VAL A 902 158.284 126.511 192.479 1.00135.05 C
ATOM 5372 O VAL A 902 158.216 126.916 191.313 1.00135.05 O
ATOM 5373 CB VAL A 902 160.544 127.424 193.134 1.00135.05 C
ATOM 5374 CG1 VAL A 902 161.272 128.280 194.142 1.00135.05 C
ATOM 5375 CG2 VAL A 902 161.177 126.051 192.994 1.00135.05 C
ATOM 5376 N ILE A 903 157.707 125.373 192.848 1.00136.73 N
ATOM 5377 CA ILE A 903 156.697 124.826 191.949 1.00136.73 C
ATOM 5378 C ILE A 903 155.284 125.234 192.356 1.00136.73 C
ATOM 5379 O ILE A 903 154.578 125.860 191.563 1.00136.73 O
ATOM 5380 CB ILE A 903 156.832 123.304 191.791 1.00136.73 C
ATOM 5381 CG1 ILE A 903 158.046 123.004 190.919 1.00136.73 C
ATOM 5382 CG2 ILE A 903 155.584 122.711 191.157 1.00136.73 C
ATOM 5383 CD1 ILE A 903 158.272 121.555 190.676 1.00136.73 C
ATOM 5384 N TYR A 904 154.804 124.929 193.565 1.00137.86 N
ATOM 5385 CA TYR A 904 153.374 125.101 193.800 1.00137.86 C
ATOM 5386 C TYR A 904 153.013 126.206 194.791 1.00137.86 C
ATOM 5387 O TYR A 904 151.915 126.172 195.352 1.00137.86 O
ATOM 5388 CB TYR A 904 152.720 123.773 194.206 1.00137.86 C
ATOM 5389 CG TYR A 904 153.232 123.077 195.451 1.00137.86 C
ATOM 5390 CD1 TYR A 904 154.170 122.055 195.364 1.00137.86 C
ATOM 5391 CD2 TYR A 904 152.746 123.415 196.708 1.00137.86 C
ATOM 5392 CE1 TYR A 904 154.612 121.402 196.497 1.00137.86 C
ATOM 5393 CE2 TYR A 904 153.191 122.779 197.843 1.00137.86 C
ATOM 5394 CZ TYR A 904 154.123 121.779 197.735 1.00137.86 C
ATOM 5395 OH TYR A 904 154.544 121.157 198.881 1.00137.86 O
ATOM 5396 N GLU A 905 153.865 127.205 195.001 1.00138.06 N
ATOM 5397 CA GLU A 905 153.331 128.407 195.638 1.00138.06 C
ATOM 5398 C GLU A 905 152.550 129.328 194.692 1.00138.06 C
ATOM 5399 O GLU A 905 151.473 129.784 195.100 1.00138.06 O
ATOM 5400 CB GLU A 905 154.430 129.208 196.343 1.00138.06 C
ATOM 5401 CG GLU A 905 154.926 128.600 197.623 1.00138.06 C
ATOM 5402 CD GLU A 905 155.991 129.451 198.275 1.00138.06 C
ATOM 5403 OE1 GLU A 905 156.394 130.467 197.671 1.00138.06 O
ATOM 5404 OE2 GLU A 905 156.433 129.106 199.387 1.00138.06 O
ATOM 5405 N PRO A 906 153.015 129.667 193.465 1.00133.85 N
ATOM 5406 CA PRO A 906 152.220 130.614 192.657 1.00133.85 C
ATOM 5407 C PRO A 906 150.887 130.075 192.167 1.00133.85 C
ATOM 5408 O PRO A 906 149.928 130.848 192.030 1.00133.85 O
ATOM 5409 CB PRO A 906 153.157 130.940 191.491 1.00133.85 C
ATOM 5410 CG PRO A 906 154.488 130.628 191.961 1.00133.85 C
ATOM 5411 CD PRO A 906 154.311 129.427 192.790 1.00133.85 C
ATOM 5412 N TYR A 907 150.796 128.773 191.892 1.00133.66 N
ATOM 5413 CA TYR A 907 149.515 128.206 191.493 1.00133.66 C
ATOM 5414 C TYR A 907 148.521 128.222 192.647 1.00133.66 C
ATOM 5415 O TYR A 907 147.330 128.470 192.440 1.00133.66 O
ATOM 5416 CB TYR A 907 149.702 126.791 190.956 1.00133.66 C
ATOM 5417 CG TYR A 907 150.405 126.748 189.623 1.00133.66 C
ATOM 5418 CD1 TYR A 907 149.729 127.072 188.455 1.00133.66 C
ATOM 5419 CD2 TYR A 907 151.737 126.370 189.529 1.00133.66 C
ATOM 5420 CE1 TYR A 907 150.362 127.032 187.230 1.00133.66 C
ATOM 5421 CE2 TYR A 907 152.378 126.325 188.309 1.00133.66 C
ATOM 5422 CZ TYR A 907 151.685 126.657 187.164 1.00133.66 C
ATOM 5423 OH TYR A 907 152.319 126.614 185.947 1.00133.66 O
ATOM 5424 N LEU A 908 148.992 127.995 193.874 1.00133.95 N
ATOM 5425 CA LEU A 908 148.097 128.107 195.022 1.00133.95 C
ATOM 5426 C LEU A 908 147.776 129.562 195.331 1.00133.95 C
ATOM 5427 O LEU A 908 146.744 129.859 195.943 1.00133.95 O
ATOM 5428 CB LEU A 908 148.698 127.416 196.244 1.00133.95 C
ATOM 5429 CG LEU A 908 148.724 125.887 196.206 1.00133.95 C
ATOM 5430 CD1 LEU A 908 149.442 125.328 197.427 1.00133.95 C
ATOM 5431 CD2 LEU A 908 147.313 125.321 196.103 1.00133.95 C
ATOM 5432 N ALA A 909 148.645 130.485 194.917 1.00132.48 N
ATOM 5433 CA ALA A 909 148.377 131.902 195.140 1.00132.48 C
ATOM 5434 C ALA A 909 147.311 132.415 194.184 1.00132.48 C
ATOM 5435 O ALA A 909 146.389 133.133 194.586 1.00132.48 O
ATOM 5436 CB ALA A 909 149.662 132.710 194.991 1.00132.48 C
ATOM 5437 N MET A 910 147.433 132.067 192.903 1.00139.09 N
ATOM 5438 CA MET A 910 146.444 132.504 191.923 1.00139.09 C
ATOM 5439 C MET A 910 145.142 131.721 192.068 1.00139.09 C
ATOM 5440 O MET A 910 144.053 132.259 191.837 1.00139.09 O
ATOM 5441 CB MET A 910 147.019 132.366 190.515 1.00139.09 C
ATOM 5442 CG MET A 910 146.126 132.897 189.411 1.00139.09 C
ATOM 5443 SD MET A 910 146.899 132.815 187.788 1.00139.09 S
ATOM 5444 CE MET A 910 148.072 134.164 187.913 1.00139.09 C
ATOM 5445 N PHE A 911 145.234 130.452 192.470 1.00138.38 N
ATOM 5446 CA PHE A 911 144.035 129.647 192.676 1.00138.38 C
ATOM 5447 C PHE A 911 143.327 130.033 193.967 1.00138.38 C
ATOM 5448 O PHE A 911 142.131 130.344 193.958 1.00138.38 O
ATOM 5449 CB PHE A 911 144.408 128.164 192.678 1.00138.38 C
ATOM 5450 CG PHE A 911 143.252 127.242 192.930 1.00138.38 C
ATOM 5451 CD1 PHE A 911 142.282 127.045 191.962 1.00138.38 C
ATOM 5452 CD2 PHE A 911 143.155 126.547 194.127 1.00138.38 C
ATOM 5453 CE1 PHE A 911 141.219 126.191 192.190 1.00138.38 C
ATOM 5454 CE2 PHE A 911 142.098 125.689 194.360 1.00138.38 C
ATOM 5455 CZ PHE A 911 141.128 125.510 193.390 1.00138.38 C
ATOM 5456 N GLY A 912 144.045 130.029 195.084 1.00133.59 N
ATOM 5457 CA GLY A 912 143.466 130.402 196.361 1.00133.59 C
ATOM 5458 C GLY A 912 143.824 131.813 196.780 1.00133.59 C
ATOM 5459 O GLY A 912 143.144 132.772 196.419 1.00133.59 O
ATOM 5460 N GLU A 952 161.815 150.593 199.100 1.00131.68 N
ATOM 5461 CA GLU A 952 160.440 151.017 198.862 1.00131.68 C
ATOM 5462 C GLU A 952 160.302 151.640 197.481 1.00131.68 C
ATOM 5463 O GLU A 952 159.206 151.997 197.056 1.00131.68 O
ATOM 5464 CB GLU A 952 159.990 152.009 199.934 1.00131.68 C
ATOM 5465 N TRP A 953 161.430 151.766 196.782 1.00140.23 N
ATOM 5466 CA TRP A 953 161.471 152.303 195.428 1.00140.23 C
ATOM 5467 C TRP A 953 161.379 151.186 194.384 1.00140.23 C
ATOM 5468 O TRP A 953 161.786 151.349 193.229 1.00140.23 O
ATOM 5469 CB TRP A 953 162.738 153.150 195.266 1.00140.23 C
ATOM 5470 CG TRP A 953 162.979 153.755 193.905 1.00140.23 C
ATOM 5471 CD1 TRP A 953 163.885 153.347 192.969 1.00140.23 C
ATOM 5472 CD2 TRP A 953 162.292 154.873 193.339 1.00140.23 C
ATOM 5473 NE1 TRP A 953 163.806 154.146 191.856 1.00140.23 N
ATOM 5474 CE2 TRP A 953 162.834 155.089 192.057 1.00140.23 C
ATOM 5475 CE3 TRP A 953 161.266 155.712 193.789 1.00140.23 C
ATOM 5476 CZ2 TRP A 953 162.386 156.109 191.221 1.00140.23 C
ATOM 5477 CZ3 TRP A 953 160.823 156.725 192.959 1.00140.23 C
ATOM 5478 CH2 TRP A 953 161.383 156.915 191.690 1.00140.23 C
ATOM 5479 N ILE A 954 160.824 150.036 194.776 1.00125.21 N
ATOM 5480 CA ILE A 954 160.596 148.942 193.843 1.00125.21 C
ATOM 5481 C ILE A 954 159.196 148.970 193.257 1.00125.21 C
ATOM 5482 O ILE A 954 158.785 147.996 192.615 1.00125.21 O
ATOM 5483 CB ILE A 954 160.845 147.582 194.525 1.00125.21 C
ATOM 5484 CG1 ILE A 954 159.873 147.390 195.692 1.00125.21 C
ATOM 5485 CG2 ILE A 954 162.281 147.493 195.004 1.00125.21 C
ATOM 5486 CD1 ILE A 954 159.863 145.990 196.262 1.00125.21 C
ATOM 5487 N THR A 955 158.443 150.051 193.470 1.00113.49 N
ATOM 5488 CA THR A 955 157.070 150.112 192.983 1.00113.49 C
ATOM 5489 C THR A 955 157.027 150.246 191.467 1.00113.49 C
ATOM 5490 O THR A 955 156.399 149.436 190.779 1.00113.49 O
ATOM 5491 CB THR A 955 156.334 151.275 193.645 1.00113.49 C
ATOM 5492 N ILE A 956 157.696 151.261 190.932 1.00104.89 N
ATOM 5493 CA ILE A 956 157.737 151.520 189.491 1.00104.89 C
ATOM 5494 C ILE A 956 158.462 150.440 188.677 1.00104.89 C
ATOM 5495 O ILE A 956 157.960 150.107 187.590 1.00104.89 O
ATOM 5496 CB ILE A 956 158.329 152.911 189.201 1.00104.89 C
ATOM 5497 N PRO A 957 159.611 149.861 189.098 1.00101.76 N
ATOM 5498 CA PRO A 957 160.161 148.754 188.292 1.00101.76 C
ATOM 5499 C PRO A 957 159.290 147.509 188.260 1.00101.76 C
ATOM 5500 O PRO A 957 159.140 146.905 187.193 1.00101.76 O
ATOM 5501 CB PRO A 957 161.518 148.482 188.947 1.00101.76 C
ATOM 5502 CG PRO A 957 161.884 149.729 189.576 1.00101.76 C
ATOM 5503 CD PRO A 957 160.615 150.280 190.103 1.00101.76 C
ATOM 5504 N LEU A 958 158.699 147.112 189.388 1.00 95.41 N
ATOM 5505 CA LEU A 958 157.784 145.975 189.384 1.00 95.41 C
ATOM 5506 C LEU A 958 156.539 146.282 188.560 1.00 95.41 C
ATOM 5507 O LEU A 958 156.033 145.426 187.824 1.00 95.41 O
ATOM 5508 CB LEU A 958 157.408 145.599 190.817 1.00 95.41 C
ATOM 5509 N VAL A 959 156.063 147.527 188.644 1.00 97.50 N
ATOM 5510 CA VAL A 959 154.890 147.953 187.895 1.00 97.50 C
ATOM 5511 C VAL A 959 155.144 147.989 186.397 1.00 97.50 C
ATOM 5512 O VAL A 959 154.205 147.811 185.615 1.00 97.50 O
ATOM 5513 CB VAL A 959 154.416 149.332 188.384 1.00 97.50 C
ATOM 5514 N CYS A 960 156.381 148.212 185.960 1.00 92.47 N
ATOM 5515 CA CYS A 960 156.592 148.127 184.520 1.00 92.47 C
ATOM 5516 C CYS A 960 156.957 146.715 184.072 1.00 92.47 C
ATOM 5517 O CYS A 960 156.696 146.350 182.919 1.00 92.47 O
ATOM 5518 CB CYS A 960 157.658 149.126 184.066 1.00 92.47 C
ATOM 5519 SG CYS A 960 159.331 148.821 184.639 1.00 92.47 S
ATOM 5520 N ILE A 961 157.532 145.903 184.966 1.00 84.10 N
ATOM 5521 CA ILE A 961 157.832 144.511 184.633 1.00 84.10 C
ATOM 5522 C ILE A 961 156.551 143.700 184.455 1.00 84.10 C
ATOM 5523 O ILE A 961 156.443 142.890 183.520 1.00 84.10 O
ATOM 5524 CB ILE A 961 158.773 143.904 185.692 1.00 84.10 C
ATOM 5525 CG1 ILE A 961 160.197 144.411 185.473 1.00 84.10 C
ATOM 5526 CG2 ILE A 961 158.753 142.393 185.690 1.00 84.10 C
ATOM 5527 CD1 ILE A 961 161.138 144.065 186.598 1.00 84.10 C
ATOM 5528 N TYR A 962 155.554 143.915 185.329 1.00 84.31 N
ATOM 5529 CA TYR A 962 154.243 143.296 185.118 1.00 84.31 C
ATOM 5530 C TYR A 962 153.613 143.733 183.799 1.00 84.31 C
ATOM 5531 O TYR A 962 152.978 142.924 183.117 1.00 84.31 O
ATOM 5532 CB TYR A 962 153.282 143.602 186.268 1.00 84.31 C
ATOM 5533 CG TYR A 962 153.435 142.739 187.504 1.00 84.31 C
ATOM 5534 CD1 TYR A 962 152.993 141.423 187.511 1.00 84.31 C
ATOM 5535 CD2 TYR A 962 153.948 143.259 188.681 1.00 84.31 C
ATOM 5536 CE1 TYR A 962 153.110 140.636 188.643 1.00 84.31 C
ATOM 5537 CE2 TYR A 962 154.066 142.481 189.816 1.00 84.31 C
ATOM 5538 CZ TYR A 962 153.644 141.175 189.789 1.00 84.31 C
ATOM 5539 OH TYR A 962 153.760 140.405 190.918 1.00 84.31 O
ATOM 5540 N MET A 963 153.815 144.994 183.407 1.00 77.57 N
ATOM 5541 CA MET A 963 153.272 145.475 182.140 1.00 77.57 C
ATOM 5542 C MET A 963 153.938 144.793 180.951 1.00 77.57 C
ATOM 5543 O MET A 963 153.258 144.388 179.996 1.00 77.57 O
ATOM 5544 CB MET A 963 153.431 146.990 182.048 1.00 77.57 C
ATOM 5545 N LEU A 964 155.264 144.639 181.004 1.00 72.97 N
ATOM 5546 CA LEU A 964 155.985 143.948 179.938 1.00 72.97 C
ATOM 5547 C LEU A 964 155.563 142.488 179.839 1.00 72.97 C
ATOM 5548 O LEU A 964 155.370 141.953 178.735 1.00 72.97 O
ATOM 5549 CB LEU A 964 157.488 144.053 180.173 1.00 72.97 C
ATOM 5550 CG LEU A 964 158.048 145.456 180.005 1.00 72.97 C
ATOM 5551 CD1 LEU A 964 159.516 145.475 180.354 1.00 72.97 C
ATOM 5552 CD2 LEU A 964 157.821 145.910 178.583 1.00 72.97 C
ATOM 5553 N SER A 965 155.394 141.835 180.991 1.00 71.27 N
ATOM 5554 CA SER A 965 154.982 140.438 180.996 1.00 71.27 C
ATOM 5555 C SER A 965 153.568 140.271 180.456 1.00 71.27 C
ATOM 5556 O SER A 965 153.296 139.318 179.717 1.00 71.27 O
ATOM 5557 CB SER A 965 155.090 139.869 182.406 1.00 71.27 C
ATOM 5558 OG SER A 965 154.154 140.486 183.267 1.00 71.27 O
ATOM 5559 N THR A 966 152.662 141.201 180.788 1.00 69.42 N
ATOM 5560 CA THR A 966 151.305 141.130 180.250 1.00 69.42 C
ATOM 5561 C THR A 966 151.285 141.382 178.754 1.00 69.42 C
ATOM 5562 O THR A 966 150.461 140.804 178.039 1.00 69.42 O
ATOM 5563 CB THR A 966 150.377 142.112 180.955 1.00 69.42 C
ATOM 5564 OG1 THR A 966 150.968 143.414 180.951 1.00 69.42 O
ATOM 5565 CG2 THR A 966 150.071 141.653 182.369 1.00 69.42 C
ATOM 5566 N ASN A 967 152.212 142.200 178.256 1.00 61.72 N
ATOM 5567 CA ASN A 967 152.327 142.367 176.811 1.00 61.72 C
ATOM 5568 C ASN A 967 152.739 141.067 176.132 1.00 61.72 C
ATOM 5569 O ASN A 967 152.067 140.612 175.194 1.00 61.72 O
ATOM 5570 CB ASN A 967 153.329 143.459 176.480 1.00 61.72 C
ATOM 5571 CG ASN A 967 153.306 143.843 175.021 1.00 61.72 C
ATOM 5572 OD1 ASN A 967 152.492 143.369 174.229 1.00 61.72 O
ATOM 5573 ND2 ASN A 967 154.220 144.705 174.653 1.00 61.72 N
ATOM 5574 N ILE A 968 153.849 140.466 176.583 1.00 62.98 N
ATOM 5575 CA ILE A 968 154.382 139.273 175.915 1.00 62.98 C
ATOM 5576 C ILE A 968 153.412 138.111 176.050 1.00 62.98 C
ATOM 5577 O ILE A 968 153.290 137.267 175.153 1.00 62.98 O
ATOM 5578 CB ILE A 968 155.756 138.899 176.488 1.00 62.98 C
ATOM 5579 CG1 ILE A 968 156.689 140.074 176.421 1.00 62.98 C
ATOM 5580 CG2 ILE A 968 156.416 137.827 175.660 1.00 62.98 C
ATOM 5581 CD1 ILE A 968 157.969 139.863 177.186 1.00 62.98 C
ATOM 5582 N LEU A 969 152.670 138.079 177.152 1.00 62.53 N
ATOM 5583 CA LEU A 969 151.717 137.009 177.363 1.00 62.53 C
ATOM 5584 C LEU A 969 150.477 137.197 176.499 1.00 62.53 C
ATOM 5585 O LEU A 969 149.986 136.234 175.903 1.00 62.53 O
ATOM 5586 CB LEU A 969 151.354 136.972 178.842 1.00 62.53 C
ATOM 5587 CG LEU A 969 150.723 135.706 179.381 1.00 62.53 C
ATOM 5588 CD1 LEU A 969 151.783 134.621 179.332 1.00 62.53 C
ATOM 5589 CD2 LEU A 969 150.208 135.943 180.796 1.00 62.53 C
ATOM 5590 N LEU A 970 149.967 138.432 176.404 1.00 59.83 N
ATOM 5591 CA LEU A 970 148.717 138.679 175.693 1.00 59.83 C
ATOM 5592 C LEU A 970 148.884 138.550 174.188 1.00 59.83 C
ATOM 5593 O LEU A 970 147.944 138.141 173.490 1.00 59.83 O
ATOM 5594 CB LEU A 970 148.195 140.069 176.057 1.00 59.83 C
ATOM 5595 CG LEU A 970 146.893 140.570 175.438 1.00 59.83 C
ATOM 5596 CD1 LEU A 970 145.748 139.648 175.780 1.00 59.83 C
ATOM 5597 CD2 LEU A 970 146.604 141.968 175.933 1.00 59.83 C
ATOM 5598 N VAL A 971 150.065 138.909 173.667 1.00 59.48 N
ATOM 5599 CA VAL A 971 150.283 138.865 172.220 1.00 59.48 C
ATOM 5600 C VAL A 971 150.224 137.433 171.702 1.00 59.48 C
ATOM 5601 O VAL A 971 149.675 137.173 170.626 1.00 59.48 O
ATOM 5602 CB VAL A 971 151.615 139.559 171.875 1.00 59.48 C
ATOM 5603 CG1 VAL A 971 152.027 139.299 170.464 1.00 59.48 C
ATOM 5604 CG2 VAL A 971 151.458 141.047 172.036 1.00 59.48 C
ATOM 5605 N ASN A 972 150.700 136.478 172.504 1.00 60.30 N
ATOM 5606 CA ASN A 972 150.641 135.071 172.126 1.00 60.30 C
ATOM 5607 C ASN A 972 149.204 134.570 172.016 1.00 60.30 C
ATOM 5608 O ASN A 972 148.852 133.869 171.065 1.00 60.30 O
ATOM 5609 CB ASN A 972 151.419 134.237 173.138 1.00 60.30 C
ATOM 5610 CG ASN A 972 152.900 134.302 172.904 1.00 60.30 C
ATOM 5611 OD1 ASN A 972 153.379 134.018 171.810 1.00 60.30 O
ATOM 5612 ND2 ASN A 972 153.634 134.742 173.913 1.00 60.30 N
ATOM 5613 N LEU A 973 148.351 134.941 172.972 1.00 61.21 N
ATOM 5614 CA LEU A 973 146.968 134.480 172.938 1.00 61.21 C
ATOM 5615 C LEU A 973 146.194 135.158 171.817 1.00 61.21 C
ATOM 5616 O LEU A 973 145.317 134.548 171.195 1.00 61.21 O
ATOM 5617 CB LEU A 973 146.299 134.713 174.294 1.00 61.21 C
ATOM 5618 CG LEU A 973 144.898 134.155 174.554 1.00 61.21 C
ATOM 5619 CD1 LEU A 973 144.816 133.695 175.976 1.00 61.21 C
ATOM 5620 CD2 LEU A 973 143.825 135.205 174.335 1.00 61.21 C
ATOM 5621 N LEU A 974 146.505 136.425 171.539 1.00 63.76 N
ATOM 5622 CA LEU A 974 145.816 137.102 170.447 1.00 63.76 C
ATOM 5623 C LEU A 974 146.292 136.592 169.098 1.00 63.76 C
ATOM 5624 O LEU A 974 145.561 136.672 168.109 1.00 63.76 O
ATOM 5625 CB LEU A 974 145.997 138.608 170.540 1.00 63.76 C
ATOM 5626 CG LEU A 974 145.291 139.245 171.728 1.00 63.76 C
ATOM 5627 CD1 LEU A 974 145.564 140.729 171.768 1.00 63.76 C
ATOM 5628 CD2 LEU A 974 143.812 138.966 171.650 1.00 63.76 C
ATOM 5629 N VAL A 975 147.515 136.067 169.034 1.00 63.87 N
ATOM 5630 CA VAL A 975 147.902 135.278 167.872 1.00 63.87 C
ATOM 5631 C VAL A 975 147.136 133.965 167.857 1.00 63.87 C
ATOM 5632 O VAL A 975 146.690 133.506 166.803 1.00 63.87 O
ATOM 5633 CB VAL A 975 149.427 135.069 167.858 1.00 63.87 C
ATOM 5634 CG1 VAL A 975 149.846 134.015 166.852 1.00 63.87 C
ATOM 5635 CG2 VAL A 975 150.095 136.359 167.494 1.00 63.87 C
ATOM 5636 N ALA A 976 146.912 133.380 169.036 1.00 68.03 N
ATOM 5637 CA ALA A 976 146.318 132.049 169.117 1.00 68.03 C
ATOM 5638 C ALA A 976 144.843 132.060 168.740 1.00 68.03 C
ATOM 5639 O ALA A 976 144.303 131.036 168.311 1.00 68.03 O
ATOM 5640 CB ALA A 976 146.502 131.483 170.521 1.00 68.03 C
ATOM 5641 N MET A 977 144.170 133.199 168.909 1.00 75.16 N
ATOM 5642 CA MET A 977 142.815 133.330 168.383 1.00 75.16 C
ATOM 5643 C MET A 977 142.812 133.266 166.864 1.00 75.16 C
ATOM 5644 O MET A 977 141.843 132.809 166.253 1.00 75.16 O
ATOM 5645 CB MET A 977 142.175 134.637 168.850 1.00 75.16 C
ATOM 5646 CG MET A 977 141.780 134.677 170.312 1.00 75.16 C
ATOM 5647 SD MET A 977 140.921 136.210 170.710 1.00 75.16 S
ATOM 5648 CE MET A 977 140.614 135.997 172.459 1.00 75.16 C
ATOM 5649 N PHE A 978 143.876 133.745 166.243 1.00 76.98 N
ATOM 5650 CA PHE A 978 144.024 133.748 164.801 1.00 76.98 C
ATOM 5651 C PHE A 978 145.019 132.681 164.362 1.00 76.98 C
ATOM 5652 O PHE A 978 145.334 131.742 165.095 1.00 76.98 O
ATOM 5653 CB PHE A 978 144.432 135.129 164.331 1.00 76.98 C
ATOM 5654 CG PHE A 978 143.399 136.160 164.605 1.00 76.98 C
ATOM 5655 CD1 PHE A 978 142.335 136.333 163.745 1.00 76.98 C
ATOM 5656 CD2 PHE A 978 143.461 136.924 165.754 1.00 76.98 C
ATOM 5657 CE1 PHE A 978 141.371 137.279 164.007 1.00 76.98 C
ATOM 5658 CE2 PHE A 978 142.506 137.867 166.023 1.00 76.98 C
ATOM 5659 CZ PHE A 978 141.459 138.047 165.150 1.00 76.98 C
ATOM 5660 N GLY A 979 145.464 132.797 163.121 1.00 83.15 N
ATOM 5661 CA GLY A 979 146.484 131.934 162.584 1.00 83.15 C
ATOM 5662 C GLY A 979 145.980 130.965 161.544 1.00 83.15 C
ATOM 5663 O GLY A 979 146.674 130.717 160.553 1.00 83.15 O
ATOM 5664 N TYR A 980 144.778 130.427 161.740 1.00 82.82 N
ATOM 5665 CA TYR A 980 144.095 129.737 160.657 1.00 82.82 C
ATOM 5666 C TYR A 980 143.676 130.721 159.574 1.00 82.82 C
ATOM 5667 O TYR A 980 143.506 130.342 158.410 1.00 82.82 O
ATOM 5668 CB TYR A 980 142.887 128.981 161.208 1.00 82.82 C
ATOM 5669 CG TYR A 980 141.835 129.873 161.822 1.00 82.82 C
ATOM 5670 CD1 TYR A 980 141.916 130.257 163.152 1.00 82.82 C
ATOM 5671 CD2 TYR A 980 140.745 130.312 161.078 1.00 82.82 C
ATOM 5672 CE1 TYR A 980 140.966 131.066 163.711 1.00 82.82 C
ATOM 5673 CE2 TYR A 980 139.792 131.121 161.632 1.00 82.82 C
ATOM 5674 CZ TYR A 980 139.909 131.495 162.946 1.00 82.82 C
ATOM 5675 OH TYR A 980 138.958 132.302 163.501 1.00 82.82 O
ATOM 5676 N THR A 981 143.486 131.987 159.952 1.00 85.56 N
ATOM 5677 CA THR A 981 143.121 133.040 159.015 1.00 85.56 C
ATOM 5678 C THR A 981 144.243 133.317 158.026 1.00 85.56 C
ATOM 5679 O THR A 981 144.039 133.253 156.809 1.00 85.56 O
ATOM 5680 CB THR A 981 142.780 134.315 159.782 1.00 85.56 C
ATOM 5681 OG1 THR A 981 143.942 134.763 160.490 1.00 85.56 O
ATOM 5682 CG2 THR A 981 141.676 134.051 160.779 1.00 85.56 C
ATOM 5683 N VAL A 982 145.437 133.615 158.536 1.00 86.26 N
ATOM 5684 CA VAL A 982 146.535 134.032 157.670 1.00 86.26 C
ATOM 5685 C VAL A 982 147.173 132.831 156.986 1.00 86.26 C
ATOM 5686 O VAL A 982 147.887 132.975 155.988 1.00 86.26 O
ATOM 5687 CB VAL A 982 147.566 134.842 158.472 1.00 86.26 C
ATOM 5688 CG1 VAL A 982 146.946 136.134 158.953 1.00 86.26 C
ATOM 5689 CG2 VAL A 982 148.063 134.032 159.648 1.00 86.26 C
ATOM 5690 N GLY A 983 146.937 131.636 157.509 1.00 88.40 N
ATOM 5691 CA GLY A 983 147.510 130.442 156.922 1.00 88.40 C
ATOM 5692 C GLY A 983 146.770 129.963 155.688 1.00 88.40 C
ATOM 5693 O GLY A 983 146.642 130.687 154.701 1.00 88.40 O
ATOM 5694 N ASN A 988 139.188 127.605 148.453 1.00 79.24 N
ATOM 5695 CA ASN A 988 140.073 126.453 148.507 1.00 79.24 C
ATOM 5696 C ASN A 988 140.145 125.902 149.916 1.00 79.24 C
ATOM 5697 O ASN A 988 140.945 125.018 150.206 1.00 79.24 O
ATOM 5698 CB ASN A 988 141.466 126.820 148.012 1.00 79.24 C
ATOM 5699 CG ASN A 988 141.493 127.094 146.533 1.00 79.24 C
ATOM 5700 OD1 ASN A 988 140.846 126.398 145.752 1.00 79.24 O
ATOM 5701 ND2 ASN A 988 142.241 128.113 146.134 1.00 79.24 N
ATOM 5702 N ASN A 989 139.306 126.436 150.803 1.00 72.51 N
ATOM 5703 CA ASN A 989 139.103 125.786 152.091 1.00 72.51 C
ATOM 5704 C ASN A 989 138.240 124.542 151.931 1.00 72.51 C
ATOM 5705 O ASN A 989 138.253 123.649 152.788 1.00 72.51 O
ATOM 5706 CB ASN A 989 138.470 126.760 153.082 1.00 72.51 C
ATOM 5707 N ASP A 990 137.490 124.473 150.826 1.00 70.82 N
ATOM 5708 CA ASP A 990 136.573 123.369 150.565 1.00 70.82 C
ATOM 5709 C ASP A 990 137.313 122.040 150.429 1.00 70.82 C
ATOM 5710 O ASP A 990 136.953 121.052 151.085 1.00 70.82 O
ATOM 5711 CB ASP A 990 135.785 123.681 149.294 1.00 70.82 C
ATOM 5712 CG ASP A 990 134.554 122.828 149.139 1.00 70.82 C
ATOM 5713 OD1 ASP A 990 134.267 121.998 150.026 1.00 70.82 O
ATOM 5714 OD2 ASP A 990 133.862 122.990 148.114 1.00 70.82 O
ATOM 5715 N GLN A 991 138.359 122.007 149.600 1.00 63.98 N
ATOM 5716 CA GLN A 991 139.090 120.769 149.355 1.00 63.98 C
ATOM 5717 C GLN A 991 139.850 120.314 150.592 1.00 63.98 C
ATOM 5718 O GLN A 991 139.871 119.118 150.909 1.00 63.98 O
ATOM 5719 CB GLN A 991 140.045 120.964 148.184 1.00 63.98 C
ATOM 5720 CG GLN A 991 139.334 121.213 146.883 1.00 63.98 C
ATOM 5721 CD GLN A 991 140.285 121.469 145.737 1.00 63.98 C
ATOM 5722 OE1 GLN A 991 141.500 121.540 145.921 1.00 63.98 O
ATOM 5723 NE2 GLN A 991 139.735 121.611 144.541 1.00 63.98 N
ATOM 5724 N VAL A 992 140.460 121.262 151.308 1.00 62.88 N
ATOM 5725 CA VAL A 992 141.207 120.947 152.523 1.00 62.88 C
ATOM 5726 C VAL A 992 140.277 120.398 153.590 1.00 62.88 C
ATOM 5727 O VAL A 992 140.597 119.414 154.277 1.00 62.88 O
ATOM 5728 CB VAL A 992 141.949 122.198 153.022 1.00 62.88 C
ATOM 5729 CG1 VAL A 992 142.712 121.903 154.298 1.00 62.88 C
ATOM 5730 CG2 VAL A 992 142.872 122.721 151.952 1.00 62.88 C
ATOM 5731 N TRP A 993 139.095 120.998 153.713 1.00 60.68 N
ATOM 5732 CA TRP A 993 138.107 120.501 154.657 1.00 60.68 C
ATOM 5733 C TRP A 993 137.644 119.093 154.313 1.00 60.68 C
ATOM 5734 O TRP A 993 137.585 118.229 155.202 1.00 60.68 O
ATOM 5735 CB TRP A 993 136.922 121.453 154.720 1.00 60.68 C
ATOM 5736 CG TRP A 993 135.758 120.802 155.307 1.00 60.68 C
ATOM 5737 CD1 TRP A 993 135.657 120.244 156.546 1.00 60.68 C
ATOM 5738 CD2 TRP A 993 134.501 120.607 154.674 1.00 60.68 C
ATOM 5739 NE1 TRP A 993 134.430 119.677 156.700 1.00 60.68 N
ATOM 5740 CE2 TRP A 993 133.683 119.918 155.581 1.00 60.68 C
ATOM 5741 CE3 TRP A 993 133.984 120.953 153.429 1.00 60.68 C
ATOM 5742 CZ2 TRP A 993 132.378 119.568 155.284 1.00 60.68 C
ATOM 5743 CZ3 TRP A 993 132.689 120.605 153.135 1.00 60.68 C
ATOM 5744 CH2 TRP A 993 131.897 119.917 154.057 1.00 60.68 C
ATOM 5745 N LYS A 994 137.286 118.853 153.047 1.00 58.70 N
ATOM 5746 CA LYS A 994 136.784 117.538 152.662 1.00 58.70 C
ATOM 5747 C LYS A 994 137.844 116.463 152.842 1.00 58.70 C
ATOM 5748 O LYS A 994 137.529 115.346 153.271 1.00 58.70 O
ATOM 5749 CB LYS A 994 136.270 117.558 151.224 1.00 58.70 C
ATOM 5750 CG LYS A 994 134.923 118.249 151.067 1.00 58.70 C
ATOM 5751 CD LYS A 994 134.412 118.170 149.638 1.00 58.70 C
ATOM 5752 CE LYS A 994 133.069 118.858 149.496 1.00 58.70 C
ATOM 5753 NZ LYS A 994 132.568 118.775 148.103 1.00 58.70 N
ATOM 5754 N PHE A 995 139.111 116.804 152.588 1.00 57.20 N
ATOM 5755 CA PHE A 995 140.190 115.849 152.814 1.00 57.20 C
ATOM 5756 C PHE A 995 140.350 115.520 154.289 1.00 57.20 C
ATOM 5757 O PHE A 995 140.556 114.353 154.644 1.00 57.20 O
ATOM 5758 CB PHE A 995 141.505 116.384 152.267 1.00 57.20 C
ATOM 5759 CG PHE A 995 142.638 115.435 152.436 1.00 57.20 C
ATOM 5760 CD1 PHE A 995 142.745 114.341 151.615 1.00 57.20 C
ATOM 5761 CD2 PHE A 995 143.582 115.617 153.428 1.00 57.20 C
ATOM 5762 CE1 PHE A 995 143.777 113.451 151.765 1.00 57.20 C
ATOM 5763 CE2 PHE A 995 144.615 114.725 153.586 1.00 57.20 C
ATOM 5764 CZ PHE A 995 144.713 113.643 152.752 1.00 57.20 C
ATOM 5765 N GLN A 996 140.277 116.529 155.161 1.00 56.13 N
ATOM 5766 CA GLN A 996 140.474 116.259 156.582 1.00 56.13 C
ATOM 5767 C GLN A 996 139.326 115.435 157.156 1.00 56.13 C
ATOM 5768 O GLN A 996 139.546 114.516 157.963 1.00 56.13 O
ATOM 5769 CB GLN A 996 140.629 117.565 157.345 1.00 56.13 C
ATOM 5770 CG GLN A 996 141.052 117.354 158.760 1.00 56.13 C
ATOM 5771 CD GLN A 996 142.435 116.783 158.834 1.00 56.13 C
ATOM 5772 OE1 GLN A 996 143.323 117.197 158.094 1.00 56.13 O
ATOM 5773 NE2 GLN A 996 142.634 115.823 159.723 1.00 56.13 N
ATOM 5774 N ARG A 997 138.099 115.723 156.713 1.00 60.21 N
ATOM 5775 CA ARG A 997 136.940 114.947 157.147 1.00 60.21 C
ATOM 5776 C ARG A 997 137.028 113.510 156.658 1.00 60.21 C
ATOM 5777 O ARG A 997 136.727 112.568 157.405 1.00 60.21 O
ATOM 5778 CB ARG A 997 135.660 115.633 156.663 1.00 60.21 C
ATOM 5779 CG ARG A 997 134.379 114.835 156.795 1.00 60.21 C
ATOM 5780 CD ARG A 997 133.937 114.338 155.426 1.00 60.21 C
ATOM 5781 NE ARG A 997 132.741 113.514 155.490 1.00 60.21 N
ATOM 5782 CZ ARG A 997 131.507 113.993 155.464 1.00 60.21 C
ATOM 5783 NH1 ARG A 997 131.304 115.300 155.383 1.00 60.21 N1+
ATOM 5784 NH2 ARG A 997 130.477 113.160 155.526 1.00 60.21 N
ATOM 5785 N PHE A 998 137.462 113.328 155.407 1.00 55.22 N
ATOM 5786 CA PHE A 998 137.645 111.993 154.854 1.00 55.22 C
ATOM 5787 C PHE A 998 138.686 111.206 155.624 1.00 55.22 C
ATOM 5788 O PHE A 998 138.504 110.011 155.886 1.00 55.22 O
ATOM 5789 CB PHE A 998 138.058 112.097 153.394 1.00 55.22 C
ATOM 5790 CG PHE A 998 138.297 110.781 152.742 1.00 55.22 C
ATOM 5791 CD1 PHE A 998 137.242 109.988 152.360 1.00 55.22 C
ATOM 5792 CD2 PHE A 998 139.579 110.342 152.495 1.00 55.22 C
ATOM 5793 CE1 PHE A 998 137.451 108.779 151.757 1.00 55.22 C
ATOM 5794 CE2 PHE A 998 139.795 109.146 151.886 1.00 55.22 C
ATOM 5795 CZ PHE A 998 138.731 108.357 151.521 1.00 55.22 C
ATOM 5796 N PHE A 999 139.786 111.863 155.986 1.00 57.67 N
ATOM 5797 CA PHE A 999 140.845 111.175 156.708 1.00 57.67 C
ATOM 5798 C PHE A 999 140.392 110.760 158.096 1.00 57.67 C
ATOM 5799 O PHE A 999 140.708 109.652 158.544 1.00 57.67 O
ATOM 5800 CB PHE A 999 142.084 112.055 156.789 1.00 57.67 C
ATOM 5801 CG PHE A 999 143.183 111.454 157.591 1.00 57.67 C
ATOM 5802 CD1 PHE A 999 143.876 110.364 157.117 1.00 57.67 C
ATOM 5803 CD2 PHE A 999 143.536 111.990 158.815 1.00 57.67 C
ATOM 5804 CE1 PHE A 999 144.893 109.806 157.854 1.00 57.67 C
ATOM 5805 CE2 PHE A 999 144.556 111.438 159.557 1.00 57.67 C
ATOM 5806 CZ PHE A 999 145.235 110.345 159.077 1.00 57.67 C
ATOM 5807 N LEU A1000 139.602 111.603 158.768 1.00 60.76 N
ATOM 5808 CA LEU A1000 139.119 111.220 160.095 1.00 60.76 C
ATOM 5809 C LEU A1000 138.111 110.078 160.032 1.00 60.76 C
ATOM 5810 O LEU A1000 138.164 109.158 160.862 1.00 60.76 O
ATOM 5811 CB LEU A1000 138.509 112.414 160.814 1.00 60.76 C
ATOM 5812 CG LEU A1000 139.548 113.407 161.302 1.00 60.76 C
ATOM 5813 CD1 LEU A1000 138.874 114.595 161.935 1.00 60.76 C
ATOM 5814 CD2 LEU A1000 140.458 112.717 162.292 1.00 60.76 C
ATOM 5815 N VAL A1001 137.201 110.107 159.050 1.00 59.08 N
ATOM 5816 CA VAL A1001 136.219 109.031 158.928 1.00 59.08 C
ATOM 5817 C VAL A1001 136.903 107.713 158.594 1.00 59.08 C
ATOM 5818 O VAL A1001 136.627 106.681 159.220 1.00 59.08 O
ATOM 5819 CB VAL A1001 135.143 109.389 157.889 1.00 59.08 C
ATOM 5820 CG1 VAL A1001 134.226 108.216 157.658 1.00 59.08 C
ATOM 5821 CG2 VAL A1001 134.331 110.553 158.375 1.00 59.08 C
ATOM 5822 N GLN A1002 137.847 107.736 157.650 1.00 61.62 N
ATOM 5823 CA GLN A1002 138.504 106.499 157.249 1.00 61.62 C
ATOM 5824 C GLN A1002 139.419 105.978 158.347 1.00 61.62 C
ATOM 5825 O GLN A1002 139.599 104.763 158.488 1.00 61.62 O
ATOM 5826 CB GLN A1002 139.285 106.717 155.960 1.00 61.62 C
ATOM 5827 CG GLN A1002 139.799 105.442 155.359 1.00 61.62 C
ATOM 5828 CD GLN A1002 140.587 105.677 154.116 1.00 61.62 C
ATOM 5829 OE1 GLN A1002 140.787 106.812 153.710 1.00 61.62 O
ATOM 5830 NE2 GLN A1002 141.057 104.603 153.502 1.00 61.62 N
ATOM 5831 N GLU A1003 139.984 106.876 159.158 1.00 73.98 N
ATOM 5832 CA GLU A1003 140.754 106.422 160.309 1.00 73.98 C
ATOM 5833 C GLU A1003 139.854 105.766 161.345 1.00 73.98 C
ATOM 5834 O GLU A1003 140.244 104.775 161.975 1.00 73.98 O
ATOM 5835 CB GLU A1003 141.524 107.586 160.928 1.00 73.98 C
ATOM 5836 CG GLU A1003 142.413 107.182 162.091 1.00 73.98 C
ATOM 5837 CD GLU A1003 143.186 108.345 162.669 1.00 73.98 C
ATOM 5838 OE1 GLU A1003 143.048 109.469 162.146 1.00 73.98 O
ATOM 5839 OE2 GLU A1003 143.924 108.140 163.654 1.00 73.98 O
ATOM 5840 N TYR A1004 138.636 106.279 161.524 1.00 70.32 N
ATOM 5841 CA TYR A1004 137.766 105.664 162.521 1.00 70.32 C
ATOM 5842 C TYR A1004 137.185 104.344 162.022 1.00 70.32 C
ATOM 5843 O TYR A1004 136.879 103.457 162.826 1.00 70.32 O
ATOM 5844 CB TYR A1004 136.649 106.617 162.935 1.00 70.32 C
ATOM 5845 CG TYR A1004 135.818 106.047 164.056 1.00 70.32 C
ATOM 5846 CD1 TYR A1004 136.308 106.019 165.350 1.00 70.32 C
ATOM 5847 CD2 TYR A1004 134.563 105.503 163.814 1.00 70.32 C
ATOM 5848 CE1 TYR A1004 135.566 105.486 166.379 1.00 70.32 C
ATOM 5849 CE2 TYR A1004 133.815 104.961 164.837 1.00 70.32 C
ATOM 5850 CZ TYR A1004 134.321 104.957 166.117 1.00 70.32 C
ATOM 5851 OH TYR A1004 133.576 104.424 167.140 1.00 70.32 O
ATOM 5852 N CYS A1005 137.036 104.189 160.700 1.00 76.40 N
ATOM 5853 CA CYS A1005 136.416 102.980 160.150 1.00 76.40 C
ATOM 5854 C CYS A1005 137.265 101.737 160.384 1.00 76.40 C
ATOM 5855 O CYS A1005 136.746 100.616 160.392 1.00 76.40 O
ATOM 5856 CB CYS A1005 136.153 103.140 158.653 1.00 76.40 C
ATOM 5857 SG CYS A1005 134.813 104.252 158.208 1.00 76.40 S
ATOM 5858 N SER A1006 138.570 101.910 160.572 1.00 81.30 N
ATOM 5859 CA SER A1006 139.464 100.762 160.579 1.00 81.30 C
ATOM 5860 C SER A1006 139.590 100.105 161.947 1.00 81.30 C
ATOM 5861 O SER A1006 140.368 99.158 162.086 1.00 81.30 O
ATOM 5862 CB SER A1006 140.837 101.179 160.062 1.00 81.30 C
ATOM 5863 OG SER A1006 140.761 101.554 158.697 1.00 81.30 O
ATOM 5864 N ARG A1007 138.863 100.570 162.958 1.00 91.49 N
ATOM 5865 CA ARG A1007 138.843 99.848 164.225 1.00 91.49 C
ATOM 5866 C ARG A1007 137.934 98.626 164.156 1.00 91.49 C
ATOM 5867 O ARG A1007 137.418 98.259 163.098 1.00 91.49 O
ATOM 5868 CB ARG A1007 138.386 100.742 165.375 1.00 91.49 C
ATOM 5869 CG ARG A1007 139.424 101.700 165.915 1.00 91.49 C
ATOM 5870 CD ARG A1007 138.847 102.414 167.121 1.00 91.49 C
ATOM 5871 NE ARG A1007 139.793 103.300 167.786 1.00 91.49 N
ATOM 5872 CZ ARG A1007 139.964 104.576 167.467 1.00 91.49 C
ATOM 5873 NH1 ARG A1007 139.265 105.112 166.475 1.00 91.49 N
ATOM 5874 NH2 ARG A1007 140.833 105.318 168.133 1.00 91.49 N
ATOM 5875 N LEU A1008 137.749 97.989 165.315 1.00 96.69 N
ATOM 5876 CA LEU A1008 136.886 96.818 165.417 1.00 96.69 C
ATOM 5877 C LEU A1008 135.424 97.200 165.224 1.00 96.69 C
ATOM 5878 O LEU A1008 135.055 98.374 165.303 1.00 96.69 O
ATOM 5879 CB LEU A1008 137.079 96.139 166.770 1.00 96.69 C
ATOM 5880 N THR A1009 134.588 96.193 164.972 1.00101.15 N
ATOM 5881 CA THR A1009 133.211 96.455 164.571 1.00101.15 C
ATOM 5882 C THR A1009 132.243 96.177 165.720 1.00101.15 C
ATOM 5883 O THR A1009 131.175 96.788 165.813 1.00101.15 O
ATOM 5884 CB THR A1009 132.891 95.613 163.337 1.00101.15 C
ATOM 5885 OG1 THR A1009 133.907 95.844 162.355 1.00101.15 O
ATOM 5886 CG2 THR A1009 131.561 96.005 162.726 1.00101.15 C
ATOM 5887 N ILE A1010 132.612 95.260 166.607 1.00100.77 N
ATOM 5888 CA ILE A1010 131.821 94.876 167.776 1.00100.77 C
ATOM 5889 C ILE A1010 131.617 96.065 168.713 1.00100.77 C
ATOM 5890 O ILE A1010 132.556 96.843 168.929 1.00100.77 O
ATOM 5891 CB ILE A1010 132.499 93.698 168.491 1.00100.77 C
ATOM 5892 CG1 ILE A1010 132.572 92.503 167.545 1.00100.77 C
ATOM 5893 CG2 ILE A1010 131.776 93.299 169.751 1.00100.77 C
ATOM 5894 CD1 ILE A1010 131.221 92.020 167.085 1.00100.77 C
ATOM 5895 N PRO A1011 130.405 96.277 169.233 1.00 96.76 N
ATOM 5896 CA PRO A1011 130.191 97.324 170.240 1.00 96.76 C
ATOM 5897 C PRO A1011 130.983 97.070 171.513 1.00 96.76 C
ATOM 5898 O PRO A1011 131.365 95.936 171.801 1.00 96.76 O
ATOM 5899 CB PRO A1011 128.687 97.249 170.505 1.00 96.76 C
ATOM 5900 CG PRO A1011 128.122 96.676 169.277 1.00 96.76 C
ATOM 5901 CD PRO A1011 129.134 95.700 168.771 1.00 96.76 C
ATOM 5902 N PHE A1012 131.170 98.147 172.290 1.00 98.24 N
ATOM 5903 CA PHE A1012 132.139 98.250 173.394 1.00 98.24 C
ATOM 5904 C PHE A1012 132.160 97.099 174.401 1.00 98.24 C
ATOM 5905 O PHE A1012 133.203 96.433 174.485 1.00 98.24 O
ATOM 5906 CB PHE A1012 131.921 99.597 174.102 1.00 98.24 C
ATOM 5907 CG PHE A1012 132.894 99.871 175.199 1.00 98.24 C
ATOM 5908 CD1 PHE A1012 134.183 100.250 174.899 1.00 98.24 C
ATOM 5909 CD2 PHE A1012 132.514 99.777 176.527 1.00 98.24 C
ATOM 5910 CE1 PHE A1012 135.079 100.517 175.900 1.00 98.24 C
ATOM 5911 CE2 PHE A1012 133.406 100.046 177.537 1.00 98.24 C
ATOM 5912 CZ PHE A1012 134.692 100.415 177.222 1.00 98.24 C
ATOM 5913 N PRO A1013 131.074 96.752 175.122 1.00 97.01 N
ATOM 5914 CA PRO A1013 131.230 95.811 176.247 1.00 97.01 C
ATOM 5915 C PRO A1013 131.511 94.389 175.813 1.00 97.01 C
ATOM 5916 O PRO A1013 131.798 93.536 176.658 1.00 97.01 O
ATOM 5917 CB PRO A1013 129.872 95.885 176.959 1.00 97.01 C
ATOM 5918 CG PRO A1013 129.160 97.036 176.350 1.00 97.01 C
ATOM 5919 CD PRO A1013 129.641 97.059 174.953 1.00 97.01 C
ATOM 5920 N PHE A1014 131.431 94.117 174.516 1.00102.22 N
ATOM 5921 CA PHE A1014 131.613 92.793 173.957 1.00102.22 C
ATOM 5922 C PHE A1014 132.908 92.687 173.164 1.00102.22 C
ATOM 5923 O PHE A1014 133.210 91.597 172.659 1.00102.22 O
ATOM 5924 CB PHE A1014 130.421 92.452 173.063 1.00102.22 C
ATOM 5925 CG PHE A1014 129.100 92.395 173.784 1.00102.22 C
ATOM 5926 CD1 PHE A1014 129.025 92.098 175.136 1.00102.22 C
ATOM 5927 CD2 PHE A1014 127.931 92.696 173.104 1.00102.22 C
ATOM 5928 CE1 PHE A1014 127.806 92.066 175.782 1.00102.22 C
ATOM 5929 CE2 PHE A1014 126.712 92.670 173.745 1.00102.22 C
ATOM 5930 CZ PHE A1014 126.650 92.355 175.085 1.00102.22 C
ATOM 5931 N VAL A1015 133.681 93.787 173.071 1.00107.87 N
ATOM 5932 CA VAL A1015 134.834 93.870 172.164 1.00107.87 C
ATOM 5933 C VAL A1015 135.867 92.789 172.467 1.00107.87 C
ATOM 5934 O VAL A1015 136.396 92.145 171.547 1.00107.87 O
ATOM 5935 CB VAL A1015 135.456 95.281 172.224 1.00107.87 C
ATOM 5936 CG1 VAL A1015 136.838 95.314 171.602 1.00107.87 C
ATOM 5937 CG2 VAL A1015 134.602 96.249 171.468 1.00107.87 C
ATOM 5938 N ILE A1016 136.083 92.502 173.755 1.00110.01 N
ATOM 5939 CA ILE A1016 137.105 91.542 174.173 1.00110.01 C
ATOM 5940 C ILE A1016 136.789 90.135 173.681 1.00110.01 C
ATOM 5941 O ILE A1016 137.706 89.326 173.481 1.00110.01 O
ATOM 5942 CB ILE A1016 137.293 91.593 175.702 1.00110.01 C
ATOM 5943 CG1 ILE A1016 138.459 90.707 176.157 1.00110.01 C
ATOM 5944 CG2 ILE A1016 135.996 91.255 176.409 1.00110.01 C
ATOM 5945 CD1 ILE A1016 138.910 90.928 177.581 1.00110.01 C
ATOM 5946 N PHE A1017 135.497 89.834 173.447 1.00113.47 N
ATOM 5947 CA PHE A1017 135.120 88.555 172.847 1.00113.47 C
ATOM 5948 C PHE A1017 135.784 88.363 171.496 1.00113.47 C
ATOM 5949 O PHE A1017 136.388 87.311 171.244 1.00113.47 O
ATOM 5950 CB PHE A1017 133.605 88.450 172.693 1.00113.47 C
ATOM 5951 CG PHE A1017 132.882 88.173 173.968 1.00113.47 C
ATOM 5952 CD1 PHE A1017 133.557 87.694 175.078 1.00113.47 C
ATOM 5953 CD2 PHE A1017 131.519 88.385 174.054 1.00113.47 C
ATOM 5954 CE1 PHE A1017 132.886 87.442 176.253 1.00113.47 C
ATOM 5955 CE2 PHE A1017 130.842 88.136 175.226 1.00113.47 C
ATOM 5956 CZ PHE A1017 131.526 87.663 176.327 1.00113.47 C
ATOM 5957 N ALA A1018 135.748 89.401 170.654 1.00119.86 N
ATOM 5958 CA ALA A1018 136.462 89.359 169.384 1.00119.86 C
ATOM 5959 C ALA A1018 137.958 89.214 169.615 1.00119.86 C
ATOM 5960 O ALA A1018 138.624 88.420 168.936 1.00119.86 O
ATOM 5961 CB ALA A1018 136.158 90.612 168.564 1.00119.86 C
ATOM 5962 N TYR A1019 138.479 89.908 170.638 1.00114.74 N
ATOM 5963 CA TYR A1019 139.888 89.776 170.990 1.00114.74 C
ATOM 5964 C TYR A1019 140.189 88.363 171.454 1.00114.74 C
ATOM 5965 O TYR A1019 141.226 87.792 171.091 1.00114.74 O
ATOM 5966 CB TYR A1019 140.268 90.781 172.077 1.00114.74 C
ATOM 5967 CG TYR A1019 140.296 92.229 171.642 1.00114.74 C
ATOM 5968 CD1 TYR A1019 140.312 92.580 170.298 1.00114.74 C
ATOM 5969 CD2 TYR A1019 140.311 93.248 172.586 1.00114.74 C
ATOM 5970 CE1 TYR A1019 140.335 93.906 169.907 1.00114.74 C
ATOM 5971 CE2 TYR A1019 140.338 94.574 172.206 1.00114.74 C
ATOM 5972 CZ TYR A1019 140.348 94.897 170.868 1.00114.74 C
ATOM 5973 OH TYR A1019 140.373 96.220 170.493 1.00114.74 O
ATOM 5974 N ILE A1020 139.228 87.747 172.156 1.00120.15 N
ATOM 5975 CA ILE A1020 139.400 86.386 172.651 1.00120.15 C
ATOM 5976 C ILE A1020 139.470 85.405 171.491 1.00120.15 C
ATOM 5977 O ILE A1020 140.029 84.310 171.620 1.00120.15 O
ATOM 5978 CB ILE A1020 138.270 86.024 173.631 1.00120.15 C
ATOM 5979 N PHE A1021 138.918 85.783 170.337 1.00127.11 N
ATOM 5980 CA PHE A1021 139.083 84.935 169.168 1.00127.11 C
ATOM 5981 C PHE A1021 140.273 85.379 168.330 1.00127.11 C
ATOM 5982 O PHE A1021 140.920 84.543 167.688 1.00127.11 O
ATOM 5983 CB PHE A1021 137.793 84.917 168.354 1.00127.11 C
ATOM 5984 CG PHE A1021 136.684 84.140 169.009 1.00127.11 C
ATOM 5985 CD1 PHE A1021 136.967 83.200 169.992 1.00127.11 C
ATOM 5986 CD2 PHE A1021 135.363 84.362 168.664 1.00127.11 C
ATOM 5987 CE1 PHE A1021 135.957 82.486 170.605 1.00127.11 C
ATOM 5988 CE2 PHE A1021 134.343 83.650 169.277 1.00127.11 C
ATOM 5989 CZ PHE A1021 134.644 82.711 170.248 1.00127.11 C
ATOM 5990 N MET A1022 140.612 86.677 168.377 1.00133.35 N
ATOM 5991 CA MET A1022 141.550 87.238 167.404 1.00133.35 C
ATOM 5992 C MET A1022 142.961 86.710 167.620 1.00133.35 C
ATOM 5993 O MET A1022 143.596 86.209 166.683 1.00133.35 O
ATOM 5994 CB MET A1022 141.540 88.764 167.473 1.00133.35 C
ATOM 5995 N VAL A1023 143.443 86.764 168.861 1.00139.15 N
ATOM 5996 CA VAL A1023 144.716 86.135 169.195 1.00139.15 C
ATOM 5997 C VAL A1023 144.583 84.616 169.109 1.00139.15 C
ATOM 5998 O VAL A1023 145.548 83.907 168.797 1.00139.15 O
ATOM 5999 CB VAL A1023 145.180 86.615 170.584 1.00139.15 C
ATOM 6000 CG1 VAL A1023 146.561 86.086 170.938 1.00139.15 C
ATOM 6001 CG2 VAL A1023 145.163 88.131 170.637 1.00139.15 C
ATOM 6002 N MET A1024 143.367 84.098 169.327 1.00137.70 N
ATOM 6003 CA MET A1024 143.120 82.680 169.085 1.00137.70 C
ATOM 6004 C MET A1024 143.187 82.366 167.598 1.00137.70 C
ATOM 6005 O MET A1024 143.526 81.244 167.206 1.00137.70 O
ATOM 6006 CB MET A1024 141.765 82.269 169.660 1.00137.70 C
ATOM 6007 N ARG A1025 142.872 83.349 166.752 1.00144.16 N
ATOM 6008 CA ARG A1025 143.020 83.146 165.318 1.00144.16 C
ATOM 6009 C ARG A1025 144.480 83.267 164.906 1.00144.16 C
ATOM 6010 O ARG A1025 144.950 82.535 164.028 1.00144.16 O
ATOM 6011 CB ARG A1025 142.150 84.145 164.554 1.00144.16 C
ATOM 6012 CG ARG A1025 142.113 83.911 163.058 1.00144.16 C
ATOM 6013 CD ARG A1025 141.475 82.565 162.765 1.00144.16 C
ATOM 6014 NE ARG A1025 141.375 82.295 161.335 1.00144.16 N
ATOM 6015 CZ ARG A1025 141.047 81.113 160.822 1.00144.16 C
ATOM 6016 NH1 ARG A1025 140.977 80.953 159.506 1.00144.16 N
ATOM 6017 NH2 ARG A1025 140.794 80.088 161.625 1.00144.16 N
ATOM 6018 N LYS A1026 145.216 84.173 165.540 1.00138.37 N
ATOM 6019 CA LYS A1026 146.631 84.345 165.244 1.00138.37 C
ATOM 6020 C LYS A1026 147.484 83.530 166.209 1.00138.37 C
ATOM 6021 O LYS A1026 147.143 82.395 166.541 1.00138.37 O
ATOM 6022 CB LYS A1026 147.019 85.823 165.312 1.00138.37 C
ATOM 6023 N GLU A1038 150.662 80.364 147.673 1.00125.76 N
ATOM 6024 CA GLU A1038 150.532 80.900 146.324 1.00125.76 C
ATOM 6025 C GLU A1038 149.893 82.286 146.346 1.00125.76 C
ATOM 6026 O GLU A1038 148.690 82.412 146.567 1.00125.76 O
ATOM 6027 CB GLU A1038 149.712 79.955 145.445 1.00125.76 C
ATOM 6028 N PRO A1039 150.703 83.322 146.130 1.00123.05 N
ATOM 6029 CA PRO A1039 150.166 84.688 146.138 1.00123.05 C
ATOM 6030 C PRO A1039 149.352 84.985 144.889 1.00123.05 C
ATOM 6031 O PRO A1039 149.677 84.531 143.790 1.00123.05 O
ATOM 6032 CB PRO A1039 151.424 85.560 146.199 1.00123.05 C
ATOM 6033 CG PRO A1039 152.492 84.660 146.724 1.00123.05 C
ATOM 6034 CD PRO A1039 152.173 83.316 146.157 1.00123.05 C
ATOM 6035 N SER A1040 148.288 85.762 145.070 1.00110.02 N
ATOM 6036 CA SER A1040 147.489 86.216 143.941 1.00110.02 C
ATOM 6037 C SER A1040 148.266 87.235 143.120 1.00110.02 C
ATOM 6038 O SER A1040 149.184 87.890 143.619 1.00110.02 O
ATOM 6039 CB SER A1040 146.172 86.818 144.426 1.00110.02 C
ATOM 6040 OG SER A1040 145.366 85.833 145.047 1.00110.02 O
ATOM 6041 N VAL A1041 147.912 87.348 141.852 1.00 93.04 N
ATOM 6042 CA VAL A1041 148.645 88.190 140.925 1.00 93.04 C
ATOM 6043 C VAL A1041 147.762 89.343 140.463 1.00 93.04 C
ATOM 6044 O VAL A1041 146.574 89.415 140.780 1.00 93.04 O
ATOM 6045 CB VAL A1041 149.155 87.354 139.747 1.00 93.04 C
ATOM 6046 CG1 VAL A1041 150.203 86.378 140.233 1.00 93.04 C
ATOM 6047 CG2 VAL A1041 148.011 86.590 139.164 1.00 93.04 C
ATOM 6048 N CYS A1042 148.355 90.266 139.702 1.00 76.85 N
ATOM 6049 CA CYS A1042 147.658 91.507 139.374 1.00 76.85 C
ATOM 6050 C CYS A1042 146.640 91.318 138.254 1.00 76.85 C
ATOM 6051 O CYS A1042 145.450 91.584 138.450 1.00 76.85 O
ATOM 6052 CB CYS A1042 148.661 92.600 139.007 1.00 76.85 C
ATOM 6053 SG CYS A1042 147.881 94.159 138.511 1.00 76.85 S
ATOM 6054 N CYS A1043 147.071 90.865 137.077 1.00 71.40 N
ATOM 6055 CA CYS A1043 146.219 90.917 135.893 1.00 71.40 C
ATOM 6056 C CYS A1043 146.003 89.565 135.228 1.00 71.40 C
ATOM 6057 O CYS A1043 145.938 89.499 133.998 1.00 71.40 O
ATOM 6058 CB CYS A1043 146.783 91.895 134.861 1.00 71.40 C
ATOM 6059 SG CYS A1043 146.619 93.638 135.256 1.00 71.40 S
ATOM 6060 N SER A1044 145.879 88.480 135.990 1.00 82.90 N
ATOM 6061 CA SER A1044 145.585 87.195 135.373 1.00 82.90 C
ATOM 6062 C SER A1044 144.171 86.699 135.619 1.00 82.90 C
ATOM 6063 O SER A1044 143.722 85.799 134.905 1.00 82.90 O
ATOM 6064 CB SER A1044 146.571 86.123 135.850 1.00 82.90 C
ATOM 6065 OG SER A1044 146.275 84.868 135.267 1.00 82.90 O
ATOM 6066 N ARG A1045 143.465 87.251 136.599 1.00 91.70 N
ATOM 6067 CA ARG A1045 142.085 86.855 136.842 1.00 91.70 C
ATOM 6068 C ARG A1045 141.183 87.402 135.742 1.00 91.70 C
ATOM 6069 O ARG A1045 141.549 88.337 135.027 1.00 91.70 O
ATOM 6070 CB ARG A1045 141.631 87.360 138.205 1.00 91.70 C
ATOM 6071 CG ARG A1045 142.474 86.833 139.343 1.00 91.70 C
ATOM 6072 CD ARG A1045 142.293 85.341 139.506 1.00 91.70 C
ATOM 6073 NE ARG A1045 140.902 85.003 139.787 1.00 91.70 N
ATOM 6074 CZ ARG A1045 140.359 85.016 141.000 1.00 91.70 C
ATOM 6075 NH1 ARG A1045 141.089 85.351 142.055 1.00 91.70 N
ATOM 6076 NH2 ARG A1045 139.084 84.693 141.161 1.00 91.70 N
ATOM 6077 N ASN A1046 139.997 86.808 135.597 1.00 87.36 N
ATOM 6078 CA ASN A1046 139.161 87.140 134.447 1.00 87.36 C
ATOM 6079 C ASN A1046 138.398 88.442 134.666 1.00 87.36 C
ATOM 6080 O ASN A1046 138.299 89.270 133.752 1.00 87.36 O
ATOM 6081 CB ASN A1046 138.198 85.994 134.152 1.00 87.36 C
ATOM 6082 CG ASN A1046 137.584 86.088 132.768 1.00 87.36 C
ATOM 6083 OD1 ASN A1046 137.873 87.004 131.999 1.00 87.36 O
ATOM 6084 ND2 ASN A1046 136.734 85.125 132.441 1.00 87.36 N
ATOM 6085 N GLU A1047 137.846 88.640 135.866 1.00 87.69 N
ATOM 6086 CA GLU A1047 137.094 89.863 136.138 1.00 87.69 C
ATOM 6087 C GLU A1047 138.014 91.077 136.195 1.00 87.69 C
ATOM 6088 O GLU A1047 137.588 92.205 135.907 1.00 87.69 O
ATOM 6089 CB GLU A1047 136.292 89.712 137.434 1.00 87.69 C
ATOM 6090 CG GLU A1047 137.119 89.615 138.707 1.00 87.69 C
ATOM 6091 CD GLU A1047 137.554 88.196 139.038 1.00 87.69 C
ATOM 6092 OE1 GLU A1047 137.459 87.307 138.165 1.00 87.69 O
ATOM 6093 OE2 GLU A1047 138.003 87.971 140.180 1.00 87.69 O
ATOM 6094 N ASP A1048 139.288 90.859 136.530 1.00 83.25 N
ATOM 6095 CA ASP A1048 140.263 91.935 136.454 1.00 83.25 C
ATOM 6096 C ASP A1048 140.494 92.344 135.010 1.00 83.25 C
ATOM 6097 O ASP A1048 140.685 93.524 134.712 1.00 83.25 O
ATOM 6098 CB ASP A1048 141.568 91.511 137.119 1.00 83.25 C
ATOM 6099 CG ASP A1048 141.423 91.347 138.614 1.00 83.25 C
ATOM 6100 OD1 ASP A1048 140.535 92.004 139.190 1.00 83.25 O
ATOM 6101 OD2 ASP A1048 142.192 90.570 139.216 1.00 83.25 O
ATOM 6102 N ASN A1049 140.450 91.380 134.093 1.00 80.95 N
ATOM 6103 CA ASN A1049 140.501 91.727 132.678 1.00 80.95 C
ATOM 6104 C ASN A1049 139.201 92.376 132.224 1.00 80.95 C
ATOM 6105 O ASN A1049 139.189 93.146 131.257 1.00 80.95 O
ATOM 6106 CB ASN A1049 140.802 90.487 131.845 1.00 80.95 C
ATOM 6107 CG ASN A1049 142.227 90.019 132.001 1.00 80.95 C
ATOM 6108 OD1 ASN A1049 143.155 90.824 132.012 1.00 80.95 O
ATOM 6109 ND2 ASN A1049 142.411 88.711 132.129 1.00 80.95 N
ATOM 6110 N GLU A1050 138.095 92.076 132.907 1.00 72.92 N
ATOM 6111 CA GLU A1050 136.818 92.669 132.527 1.00 72.92 C
ATOM 6112 C GLU A1050 136.742 94.140 132.921 1.00 72.92 C
ATOM 6113 O GLU A1050 136.153 94.951 132.200 1.00 72.92 O
ATOM 6114 CB GLU A1050 135.669 91.887 133.157 1.00 72.92 C
ATOM 6115 N ILE A1051 137.323 94.501 134.066 1.00 62.72 N
ATOM 6116 CA ILE A1051 137.242 95.888 134.529 1.00 62.72 C
ATOM 6117 C ILE A1051 138.151 96.796 133.702 1.00 62.72 C
ATOM 6118 O ILE A1051 137.766 97.916 133.327 1.00 62.72 O
ATOM 6119 CB ILE A1051 137.576 95.967 136.029 1.00 62.72 C
ATOM 6120 CG1 ILE A1051 136.545 95.201 136.837 1.00 62.72 C
ATOM 6121 CG2 ILE A1051 137.585 97.387 136.518 1.00 62.72 C
ATOM 6122 CD1 ILE A1051 136.916 95.076 138.282 1.00 62.72 C
ATOM 6123 N LEU A1052 139.362 96.325 133.391 1.00 62.67 N
ATOM 6124 CA LEU A1052 140.381 97.211 132.835 1.00 62.67 C
ATOM 6125 C LEU A1052 140.064 97.613 131.401 1.00 62.67 C
ATOM 6126 O LEU A1052 140.391 98.728 130.979 1.00 62.67 O
ATOM 6127 CB LEU A1052 141.753 96.552 132.914 1.00 62.67 C
ATOM 6128 CG LEU A1052 142.292 96.353 134.329 1.00 62.67 C
ATOM 6129 CD1 LEU A1052 143.618 95.628 134.306 1.00 62.67 C
ATOM 6130 CD2 LEU A1052 142.424 97.666 135.053 1.00 62.67 C
ATOM 6131 N ALA A1053 139.409 96.733 130.642 1.00 61.94 N
ATOM 6132 CA ALA A1053 139.004 97.098 129.287 1.00 61.94 C
ATOM 6133 C ALA A1053 137.923 98.168 129.313 1.00 61.94 C
ATOM 6134 O ALA A1053 137.896 99.065 128.456 1.00 61.94 O
ATOM 6135 CB ALA A1053 138.518 95.866 128.533 1.00 61.94 C
ATOM 6136 N TRP A1054 137.037 98.095 130.304 1.00 60.37 N
ATOM 6137 CA TRP A1054 136.042 99.138 130.502 1.00 60.37 C
ATOM 6138 C TRP A1054 136.700 100.463 130.845 1.00 60.37 C
ATOM 6139 O TRP A1054 136.289 101.522 130.347 1.00 60.37 O
ATOM 6140 CB TRP A1054 135.086 98.709 131.605 1.00 60.37 C
ATOM 6141 CG TRP A1054 134.098 99.715 131.945 1.00 60.37 C
ATOM 6142 CD1 TRP A1054 133.139 100.221 131.138 1.00 60.37 C
ATOM 6143 CD2 TRP A1054 133.945 100.349 133.203 1.00 60.37 C
ATOM 6144 NE1 TRP A1054 132.392 101.145 131.816 1.00 60.37 N
ATOM 6145 CE2 TRP A1054 132.871 101.239 133.092 1.00 60.37 C
ATOM 6146 CE3 TRP A1054 134.614 100.252 134.416 1.00 60.37 C
ATOM 6147 CZ2 TRP A1054 132.451 102.024 134.146 1.00 60.37 C
ATOM 6148 CZ3 TRP A1054 134.201 101.036 135.457 1.00 60.37 C
ATOM 6149 CH2 TRP A1054 133.124 101.902 135.324 1.00 60.37 C
ATOM 6150 N GLU A1055 137.749 100.412 131.669 1.00 60.56 N
ATOM 6151 CA GLU A1055 138.496 101.627 131.980 1.00 60.56 C
ATOM 6152 C GLU A1055 139.187 102.182 130.743 1.00 60.56 C
ATOM 6153 O GLU A1055 139.267 103.400 130.566 1.00 60.56 O
ATOM 6154 CB GLU A1055 139.509 101.363 133.087 1.00 60.56 C
ATOM 6155 CG GLU A1055 140.261 102.607 133.530 1.00 60.56 C
ATOM 6156 CD GLU A1055 141.189 102.352 134.690 1.00 60.56 C
ATOM 6157 OE1 GLU A1055 141.205 101.212 135.186 1.00 60.56 O
ATOM 6158 OE2 GLU A1055 141.922 103.277 135.096 1.00 60.56 O
ATOM 6159 N ALA A1056 139.648 101.303 129.852 1.00 59.67 N
ATOM 6160 CA ALA A1056 140.282 101.758 128.616 1.00 59.67 C
ATOM 6161 C ALA A1056 139.285 102.456 127.699 1.00 59.67 C
ATOM 6162 O ALA A1056 139.605 103.485 127.081 1.00 59.67 O
ATOM 6163 CB ALA A1056 140.932 100.579 127.895 1.00 59.67 C
ATOM 6164 N VAL A1057 138.067 101.916 127.613 1.00 59.06 N
ATOM 6165 CA VAL A1057 137.020 102.552 126.814 1.00 59.06 C
ATOM 6166 C VAL A1057 136.665 103.916 127.388 1.00 59.06 C
ATOM 6167 O VAL A1057 136.508 104.905 126.650 1.00 59.06 O
ATOM 6168 CB VAL A1057 135.792 101.632 126.730 1.00 59.06 C
ATOM 6169 CG1 VAL A1057 134.654 102.324 126.026 1.00 59.06 C
ATOM 6170 CG2 VAL A1057 136.150 100.373 125.996 1.00 59.06 C
ATOM 6171 N MET A1058 136.591 104.006 128.717 1.00 57.61 N
ATOM 6172 CA MET A1058 136.309 105.292 129.342 1.00 57.61 C
ATOM 6173 C MET A1058 137.455 106.278 129.158 1.00 57.61 C
ATOM 6174 O MET A1058 137.228 107.488 129.056 1.00 57.61 O
ATOM 6175 CB MET A1058 135.992 105.104 130.818 1.00 57.61 C
ATOM 6176 CG MET A1058 134.662 104.444 131.036 1.00 57.61 C
ATOM 6177 SD MET A1058 133.388 105.361 130.171 1.00 57.61 S
ATOM 6178 CE MET A1058 133.524 106.945 130.998 1.00 57.61 C
ATOM 6179 N LYS A1059 138.687 105.777 129.072 1.00 56.48 N
ATOM 6180 CA LYS A1059 139.817 106.653 128.790 1.00 56.48 C
ATOM 6181 C LYS A1059 139.729 107.228 127.388 1.00 56.48 C
ATOM 6182 O LYS A1059 140.019 108.412 127.178 1.00 56.48 O
ATOM 6183 CB LYS A1059 141.132 105.902 128.966 1.00 56.48 C
ATOM 6184 CG LYS A1059 142.347 106.749 128.658 1.00 56.48 C
ATOM 6185 CD LYS A1059 143.630 106.026 128.930 1.00 56.48 C
ATOM 6186 CE LYS A1059 144.038 105.151 127.769 1.00 56.48 C
ATOM 6187 NZ LYS A1059 143.478 103.779 127.857 1.00 56.48 N
ATOM 6188 N GLU A1060 139.314 106.414 126.416 1.00 60.34 N
ATOM 6189 CA GLU A1060 139.178 106.946 125.062 1.00 60.34 C
ATOM 6190 C GLU A1060 138.048 107.966 124.975 1.00 60.34 C
ATOM 6191 O GLU A1060 138.167 108.982 124.270 1.00 60.34 O
ATOM 6192 CB GLU A1060 138.965 105.817 124.063 1.00 60.34 C
ATOM 6193 CG GLU A1060 140.186 104.953 123.880 1.00 60.34 C
ATOM 6194 CD GLU A1060 139.991 103.900 122.818 1.00 60.34 C
ATOM 6195 OE1 GLU A1060 138.865 103.795 122.288 1.00 60.34 O
ATOM 6196 OE2 GLU A1060 140.961 103.176 122.512 1.00 60.34 O
ATOM 6197 N ASN A1061 136.965 107.743 125.722 1.00 58.25 N
ATOM 6198 CA ASN A1061 135.888 108.730 125.734 1.00 58.25 C
ATOM 6199 C ASN A1061 136.293 109.996 126.480 1.00 58.25 C
ATOM 6200 O ASN A1061 135.732 111.070 126.240 1.00 58.25 O
ATOM 6201 CB ASN A1061 134.620 108.135 126.332 1.00 58.25 C
ATOM 6202 CG ASN A1061 133.913 107.209 125.373 1.00 58.25 C
ATOM 6203 OD1 ASN A1061 133.832 107.485 124.178 1.00 58.25 O
ATOM 6204 ND2 ASN A1061 133.384 106.111 125.889 1.00 58.25 N
ATOM 6205 N TYR A1062 137.255 109.892 127.395 1.00 55.70 N
ATOM 6206 CA TYR A1062 137.850 111.097 127.968 1.00 55.70 C
ATOM 6207 C TYR A1062 138.697 111.838 126.946 1.00 55.70 C
ATOM 6208 O TYR A1062 138.661 113.074 126.875 1.00 55.70 O
ATOM 6209 CB TYR A1062 138.707 110.737 129.173 1.00 55.70 C
ATOM 6210 CG TYR A1062 139.401 111.917 129.794 1.00 55.70 C
ATOM 6211 CD1 TYR A1062 138.708 112.788 130.606 1.00 55.70 C
ATOM 6212 CD2 TYR A1062 140.753 112.154 129.575 1.00 55.70 C
ATOM 6213 CE1 TYR A1062 139.329 113.859 131.182 1.00 55.70 C
ATOM 6214 CE2 TYR A1062 141.383 113.228 130.143 1.00 55.70 C
ATOM 6215 CZ TYR A1062 140.664 114.077 130.947 1.00 55.70 C
ATOM 6216 OH TYR A1062 141.281 115.155 131.528 1.00 55.70 O
ATOM 6217 N LEU A1063 139.509 111.098 126.186 1.00 59.92 N
ATOM 6218 CA LEU A1063 140.465 111.726 125.279 1.00 59.92 C
ATOM 6219 C LEU A1063 139.769 112.437 124.134 1.00 59.92 C
ATOM 6220 O LEU A1063 140.255 113.466 123.652 1.00 59.92 O
ATOM 6221 CB LEU A1063 141.444 110.698 124.733 1.00 59.92 C
ATOM 6222 CG LEU A1063 142.448 110.206 125.759 1.00 59.92 C
ATOM 6223 CD1 LEU A1063 143.321 109.139 125.148 1.00 59.92 C
ATOM 6224 CD2 LEU A1063 143.276 111.368 126.245 1.00 59.92 C
ATOM 6225 N VAL A1064 138.620 111.919 123.701 1.00 59.89 N
ATOM 6226 CA VAL A1064 137.867 112.616 122.662 1.00 59.89 C
ATOM 6227 C VAL A1064 137.326 113.941 123.193 1.00 59.89 C
ATOM 6228 O VAL A1064 137.421 114.979 122.524 1.00 59.89 O
ATOM 6229 CB VAL A1064 136.752 111.709 122.118 1.00 59.89 C
ATOM 6230 CG1 VAL A1064 135.864 112.466 121.158 1.00 59.89 C
ATOM 6231 CG2 VAL A1064 137.362 110.517 121.412 1.00 59.89 C
ATOM 6232 N LYS A1065 136.824 113.942 124.429 1.00 60.49 N
ATOM 6233 CA LYS A1065 136.287 115.171 125.008 1.00 60.49 C
ATOM 6234 C LYS A1065 137.383 116.180 125.315 1.00 60.49 C
ATOM 6235 O LYS A1065 137.119 117.384 125.378 1.00 60.49 O
ATOM 6236 CB LYS A1065 135.497 114.870 126.277 1.00 60.49 C
ATOM 6237 CG LYS A1065 134.166 114.203 126.045 1.00 60.49 C
ATOM 6238 CD LYS A1065 133.440 113.998 127.360 1.00 60.49 C
ATOM 6239 CE LYS A1065 132.112 113.294 127.152 1.00 60.49 C
ATOM 6240 NZ LYS A1065 131.406 113.057 128.440 1.00 60.49 N
ATOM 6241 N ILE A1066 138.613 115.719 125.535 1.00 63.50 N
ATOM 6242 CA ILE A1066 139.680 116.673 125.830 1.00 63.50 C
ATOM 6243 C ILE A1066 140.383 117.107 124.543 1.00 63.50 C
ATOM 6244 O ILE A1066 141.099 118.114 124.512 1.00 63.50 O
ATOM 6245 CB ILE A1066 140.662 116.091 126.862 1.00 63.50 C
ATOM 6246 CG1 ILE A1066 141.410 117.217 127.571 1.00 63.50 C
ATOM 6247 CG2 ILE A1066 141.668 115.177 126.202 1.00 63.50 C
ATOM 6248 CD1 ILE A1066 142.179 116.771 128.769 1.00 63.50 C
ATOM 6249 N ASN A1067 140.179 116.367 123.449 1.00 70.17 N
ATOM 6250 CA ASN A1067 140.782 116.791 122.190 1.00 70.17 C
ATOM 6251 C ASN A1067 139.819 117.568 121.306 1.00 70.17 C
ATOM 6252 O ASN A1067 140.254 118.142 120.302 1.00 70.17 O
ATOM 6253 CB ASN A1067 141.332 115.589 121.429 1.00 70.17 C
ATOM 6254 CG ASN A1067 142.593 115.043 122.051 1.00 70.17 C
ATOM 6255 OD1 ASN A1067 143.463 115.801 122.474 1.00 70.17 O
ATOM 6256 ND2 ASN A1067 142.701 113.723 122.111 1.00 70.17 N
ATOM 6257 N THR A1068 138.527 117.606 121.645 1.00 74.15 N
ATOM 6258 CA THR A1068 137.620 118.508 120.932 1.00 74.15 C
ATOM 6259 C THR A1068 137.867 119.970 121.292 1.00 74.15 C
ATOM 6260 O THR A1068 137.353 120.870 120.618 1.00 74.15 O
ATOM 6261 CB THR A1068 136.158 118.154 121.207 1.00 74.15 C
ATOM 6262 OG1 THR A1068 135.937 118.057 122.620 1.00 74.15 O
ATOM 6263 CG2 THR A1068 135.745 116.874 120.498 1.00 74.15 C
ATOM 6264 N LYS A1069 138.623 120.227 122.367 1.00 75.89 N
ATOM 6265 CA LYS A1069 138.825 121.591 122.851 1.00 75.89 C
ATOM 6266 C LYS A1069 139.617 122.437 121.860 1.00 75.89 C
ATOM 6267 O LYS A1069 139.410 123.653 121.768 1.00 75.89 O
ATOM 6268 CB LYS A1069 139.530 121.563 124.206 1.00 75.89 C
ATOM 6269 N ALA A1070 140.517 121.818 121.106 1.00 82.00 N
ATOM 6270 CA ALA A1070 141.294 122.545 120.111 1.00 82.00 C
ATOM 6271 C ALA A1070 140.448 122.849 118.881 1.00 82.00 C
ATOM 6272 O ALA A1070 139.348 122.319 118.726 1.00 82.00 O
ATOM 6273 CB ALA A1070 142.531 121.756 119.725 1.00 82.00 C
ATOM 6274 N UNK A1077 141.374 129.530 116.067 1.00299.40 N
ATOM 6275 CA UNK A1077 140.628 130.623 115.453 1.00299.40 C
ATOM 6276 C UNK A1077 141.554 131.529 114.644 1.00299.40 C
ATOM 6277 O UNK A1077 141.214 131.953 113.537 1.00299.40 O
ATOM 6278 CB UNK A1077 139.891 131.434 116.520 1.00299.40 C
ATOM 6279 N UNK A1078 142.720 131.823 115.210 1.00303.56 N
ATOM 6280 CA UNK A1078 143.741 132.603 114.520 1.00303.56 C
ATOM 6281 C UNK A1078 144.315 131.779 113.377 1.00303.56 C
ATOM 6282 O UNK A1078 144.595 132.297 112.294 1.00303.56 O
ATOM 6283 CB UNK A1078 144.850 133.024 115.485 1.00303.56 C
ATOM 6284 N UNK A1079 144.471 130.482 113.627 1.00305.13 N
ATOM 6285 CA UNK A1079 144.909 129.548 112.601 1.00305.13 C
ATOM 6286 C UNK A1079 143.809 129.371 111.561 1.00305.13 C
ATOM 6287 O UNK A1079 144.092 129.208 110.378 1.00305.13 O
ATOM 6288 CB UNK A1079 145.286 128.200 113.218 1.00305.13 C
ATOM 6289 N UNK A1080 142.557 129.434 112.006 1.00305.91 N
ATOM 6290 CA UNK A1080 141.412 129.342 111.106 1.00305.91 C
ATOM 6291 C UNK A1080 141.328 130.569 110.204 1.00305.91 C
ATOM 6292 O UNK A1080 141.071 130.449 109.004 1.00305.91 O
ATOM 6293 CB UNK A1080 140.116 129.184 111.900 1.00305.91 C
ATOM 6294 N UNK A1081 141.568 131.742 110.784 1.00310.60 N
ATOM 6295 CA UNK A1081 141.581 132.991 110.026 1.00310.60 C
ATOM 6296 C UNK A1081 142.761 133.019 109.059 1.00310.60 C
ATOM 6297 O UNK A1081 142.647 133.525 107.945 1.00310.60 O
ATOM 6298 CB UNK A1081 141.640 134.195 110.967 1.00310.60 C
ATOM 6299 N UNK A1082 143.883 132.442 109.482 1.00314.03 N
ATOM 6300 CA UNK A1082 145.059 132.326 108.627 1.00314.03 C
ATOM 6301 C UNK A1082 144.802 131.371 107.463 1.00314.03 C
ATOM 6302 O UNK A1082 145.259 131.610 106.348 1.00314.03 O
ATOM 6303 CB UNK A1082 146.264 131.852 109.439 1.00314.03 C
ATOM 6304 N UNK A1083 144.056 130.304 107.730 1.00315.42 N
ATOM 6305 CA UNK A1083 143.683 129.337 106.703 1.00315.42 C
ATOM 6306 C UNK A1083 142.720 129.960 105.705 1.00315.42 C
ATOM 6307 O UNK A1083 142.799 129.696 104.503 1.00315.42 O
ATOM 6308 CB UNK A1083 143.051 128.096 107.335 1.00315.42 C
ATOM 6309 N UNK A1084 141.819 130.792 106.219 1.00316.91 N
ATOM 6310 CA UNK A1084 140.890 131.543 105.382 1.00316.91 C
ATOM 6311 C UNK A1084 141.648 132.533 104.502 1.00316.91 C
ATOM 6312 O UNK A1084 141.327 132.686 103.323 1.00316.91 O
ATOM 6313 CB UNK A1084 139.859 132.275 106.244 1.00316.91 C
ATOM 6314 N UNK A1085 142.665 133.172 105.078 1.00318.19 N
ATOM 6315 CA UNK A1085 143.533 134.092 104.348 1.00318.19 C
ATOM 6316 C UNK A1085 144.316 133.373 103.251 1.00318.19 C
ATOM 6317 O UNK A1085 144.445 133.887 102.145 1.00318.19 O
ATOM 6318 CB UNK A1085 144.500 134.789 105.307 1.00318.19 C
ATOM 6319 N UNK A1086 144.808 132.176 103.560 1.00321.87 N
ATOM 6320 CA UNK A1086 145.548 131.356 102.599 1.00321.87 C
ATOM 6321 C UNK A1086 144.661 130.873 101.449 1.00321.87 C
ATOM 6322 O UNK A1086 145.081 130.893 100.292 1.00321.87 O
ATOM 6323 CB UNK A1086 146.184 130.155 103.302 1.00321.87 C
ATOM 6324 N UNK A1087 143.438 130.456 101.769 1.00323.49 N
ATOM 6325 CA UNK A1087 142.477 130.032 100.751 1.00323.49 C
ATOM 6326 C UNK A1087 142.045 131.209 99.873 1.00323.49 C
ATOM 6327 O UNK A1087 141.881 131.060 98.659 1.00323.49 O
ATOM 6328 CB UNK A1087 141.254 129.385 101.402 1.00323.49 C
ATOM 6329 N UNK A1088 141.885 132.379 100.489 1.00323.30 N
ATOM 6330 CA UNK A1088 141.545 133.593 99.762 1.00323.30 C
ATOM 6331 C UNK A1088 142.692 134.012 98.855 1.00323.30 C
ATOM 6332 O UNK A1088 142.463 134.483 97.743 1.00323.30 O
ATOM 6333 CB UNK A1088 141.202 134.722 100.733 1.00323.30 C
ATOM 6334 N UNK A1089 143.920 133.816 99.328 1.00325.54 N
ATOM 6335 CA UNK A1089 145.113 134.096 98.537 1.00325.54 C
ATOM 6336 C UNK A1089 145.216 133.132 97.360 1.00325.54 C
ATOM 6337 O UNK A1089 145.618 133.531 96.271 1.00325.54 O
ATOM 6338 CB UNK A1089 146.369 134.008 99.407 1.00325.54 C
ATOM 6339 N UNK A1090 144.828 131.878 97.583 1.00325.81 N
ATOM 6340 CA UNK A1090 144.782 130.875 96.520 1.00325.81 C
ATOM 6341 C UNK A1090 143.754 131.242 95.448 1.00325.81 C
ATOM 6342 O UNK A1090 144.031 131.139 94.250 1.00325.81 O
ATOM 6343 CB UNK A1090 144.461 129.497 97.101 1.00325.81 C
ATOM 6344 N UNK A1091 142.579 131.686 95.887 1.00326.47 N
ATOM 6345 CA UNK A1091 141.521 132.112 94.968 1.00326.47 C
ATOM 6346 C UNK A1091 141.907 133.373 94.192 1.00326.47 C
ATOM 6347 O UNK A1091 141.612 133.487 93.000 1.00326.47 O
ATOM 6348 CB UNK A1091 140.215 132.352 95.727 1.00326.47 C
ATOM 6349 N UNK A1092 142.580 134.304 94.865 1.00326.79 N
ATOM 6350 CA UNK A1092 143.073 135.515 94.220 1.00326.79 C
ATOM 6351 C UNK A1092 144.185 135.188 93.229 1.00326.79 C
ATOM 6352 O UNK A1092 144.285 135.824 92.182 1.00326.79 O
ATOM 6353 CB UNK A1092 143.576 136.515 95.262 1.00326.79 C
ATOM 6354 N UNK A1093 144.993 134.181 93.552 1.00326.86 N
ATOM 6355 CA UNK A1093 146.037 133.698 92.657 1.00326.86 C
ATOM 6356 C UNK A1093 145.430 133.067 91.409 1.00326.86 C
ATOM 6357 O UNK A1093 145.926 133.283 90.303 1.00326.86 O
ATOM 6358 CB UNK A1093 146.934 132.688 93.376 1.00326.86 C
ATOM 6359 N UNK A1094 144.354 132.308 91.597 1.00326.93 N
ATOM 6360 CA UNK A1094 143.620 131.703 90.484 1.00326.93 C
ATOM 6361 C UNK A1094 142.990 132.764 89.583 1.00326.93 C
ATOM 6362 O UNK A1094 143.069 132.669 88.354 1.00326.93 O
ATOM 6363 CB UNK A1094 142.537 130.759 91.006 1.00326.93 C
ATOM 6364 N UNK A1095 142.392 133.778 90.203 1.00325.94 N
ATOM 6365 CA UNK A1095 141.789 134.891 89.472 1.00325.94 C
ATOM 6366 C UNK A1095 142.833 135.718 88.719 1.00325.94 C
ATOM 6367 O UNK A1095 142.568 136.177 87.611 1.00325.94 O
ATOM 6368 CB UNK A1095 141.006 135.794 90.425 1.00325.94 C
ATOM 6369 N UNK A1096 144.014 135.885 89.310 1.00326.09 N
ATOM 6370 CA UNK A1096 145.101 136.614 88.664 1.00326.09 C
ATOM 6371 C UNK A1096 145.716 135.818 87.511 1.00326.09 C
ATOM 6372 O UNK A1096 146.082 136.392 86.484 1.00326.09 O
ATOM 6373 CB UNK A1096 146.183 136.971 89.685 1.00326.09 C
ATOM 6374 N UNK A1097 145.827 134.506 87.683 1.00325.38 N
ATOM 6375 CA UNK A1097 146.393 133.642 86.652 1.00325.38 C
ATOM 6376 C UNK A1097 145.426 133.453 85.488 1.00325.38 C
ATOM 6377 O UNK A1097 145.853 133.237 84.354 1.00325.38 O
ATOM 6378 CB UNK A1097 146.773 132.283 87.244 1.00325.38 C
ATOM 6379 N UNK A1098 144.128 133.531 85.765 1.00320.25 N
ATOM 6380 CA UNK A1098 143.132 133.403 84.710 1.00320.25 C
ATOM 6381 C UNK A1098 142.787 134.758 84.090 1.00320.25 C
ATOM 6382 O UNK A1098 142.245 134.813 82.984 1.00320.25 O
ATOM 6383 CB UNK A1098 141.865 132.737 85.253 1.00320.25 C
ATOM 6384 N UNK A1099 143.108 135.841 84.793 1.00316.21 N
ATOM 6385 CA UNK A1099 142.767 137.184 84.332 1.00316.21 C
ATOM 6386 C UNK A1099 143.903 137.842 83.554 1.00316.21 C
ATOM 6387 O UNK A1099 143.690 138.843 82.868 1.00316.21 O
ATOM 6388 CB UNK A1099 142.378 138.069 85.517 1.00316.21 C
ATOM 6389 N UNK A1100 145.105 137.285 83.663 1.00310.31 N
ATOM 6390 CA UNK A1100 146.256 137.821 82.943 1.00310.31 C
ATOM 6391 C UNK A1100 146.258 137.352 81.489 1.00310.31 C
ATOM 6392 O UNK A1100 145.838 138.079 80.588 1.00310.31 O
ATOM 6393 CB UNK A1100 147.559 137.410 83.632 1.00310.31 C
TER 6394 UNK A1100
ATOM 6395 N UNK B 53 130.133 193.791 115.517 1.00146.36 N
ATOM 6396 CA UNK B 53 130.786 194.719 114.602 1.00146.36 C
ATOM 6397 C UNK B 53 131.200 195.992 115.330 1.00146.36 C
ATOM 6398 O UNK B 53 130.845 197.094 114.917 1.00146.36 O
ATOM 6399 CB UNK B 53 129.862 195.059 113.431 1.00146.36 C
ATOM 6400 N UNK B 54 131.956 195.832 116.411 1.00148.00 N
ATOM 6401 CA UNK B 54 132.378 196.968 117.223 1.00148.00 C
ATOM 6402 C UNK B 54 133.544 197.717 116.592 1.00148.00 C
ATOM 6403 O UNK B 54 134.157 197.260 115.628 1.00148.00 O
ATOM 6404 CB UNK B 54 132.765 196.505 118.628 1.00148.00 C
ATOM 6405 N UNK B 55 133.844 198.881 117.156 1.00141.16 N
ATOM 6406 CA UNK B 55 134.964 199.692 116.701 1.00141.16 C
ATOM 6407 C UNK B 55 136.060 199.696 117.759 1.00141.16 C
ATOM 6408 O UNK B 55 135.782 199.820 118.951 1.00141.16 O
ATOM 6409 CB UNK B 55 134.510 201.120 116.395 1.00141.16 C
ATOM 6410 N UNK B 56 137.304 199.565 117.318 1.00131.26 N
ATOM 6411 CA UNK B 56 138.430 199.482 118.236 1.00131.26 C
ATOM 6412 C UNK B 56 138.763 200.832 118.862 1.00131.26 C
ATOM 6413 O UNK B 56 138.290 201.874 118.410 1.00131.26 O
ATOM 6414 CB UNK B 56 139.657 198.928 117.514 1.00131.26 C
ATOM 6415 N UNK B 57 139.588 200.795 119.903 1.00128.32 N
ATOM 6416 CA UNK B 57 139.992 201.995 120.626 1.00128.32 C
ATOM 6417 C UNK B 57 141.278 201.743 121.401 1.00128.32 C
ATOM 6418 O UNK B 57 141.275 200.973 122.360 1.00128.32 O
ATOM 6419 CB UNK B 57 138.889 202.444 121.587 1.00128.32 C
ATOM 6420 N UNK B 58 142.368 202.386 120.995 1.00129.76 N
ATOM 6421 CA UNK B 58 143.643 202.201 121.677 1.00129.76 C
ATOM 6422 C UNK B 58 144.555 203.416 121.550 1.00129.76 C
ATOM 6423 O UNK B 58 144.171 204.440 120.983 1.00129.76 O
ATOM 6424 CB UNK B 58 144.357 200.963 121.139 1.00129.76 C
ATOM 6425 N UNK B 59 145.770 203.283 122.076 1.00131.22 N
ATOM 6426 CA UNK B 59 146.724 204.388 122.137 1.00131.22 C
ATOM 6427 C UNK B 59 147.299 204.744 120.770 1.00131.22 C
ATOM 6428 O UNK B 59 147.671 203.848 120.012 1.00131.22 O
ATOM 6429 CB UNK B 59 147.864 204.047 123.098 1.00131.22 C
ATOM 6430 N UNK B 60 147.361 206.050 120.491 1.00127.31 N
ATOM 6431 CA UNK B 60 147.858 206.635 119.236 1.00127.31 C
ATOM 6432 C UNK B 60 147.160 206.072 118.003 1.00127.31 C
ATOM 6433 O UNK B 60 147.786 205.887 116.960 1.00127.31 O
ATOM 6434 CB UNK B 60 149.374 206.439 119.108 1.00127.31 C
ATOM 6435 N UNK B 61 145.863 205.812 118.124 1.00125.56 N
ATOM 6436 CA UNK B 61 145.143 205.088 117.089 1.00125.56 C
ATOM 6437 C UNK B 61 143.819 205.733 116.710 1.00125.56 C
ATOM 6438 O UNK B 61 142.854 205.683 117.470 1.00125.56 O
ATOM 6439 CB UNK B 61 144.893 203.652 117.544 1.00125.56 C
ATOM 6440 N UNK B 62 143.778 206.330 115.525 1.00125.06 N
ATOM 6441 CA UNK B 62 142.529 206.830 114.974 1.00125.06 C
ATOM 6442 C UNK B 62 141.717 205.650 114.460 1.00125.06 C
ATOM 6443 O UNK B 62 142.251 204.788 113.766 1.00125.06 O
ATOM 6444 CB UNK B 62 142.791 207.836 113.854 1.00125.06 C
ATOM 6445 N UNK B 63 140.436 205.601 114.802 1.00121.17 N
ATOM 6446 CA UNK B 63 139.592 204.488 114.386 1.00121.17 C
ATOM 6447 C UNK B 63 138.857 204.799 113.087 1.00121.17 C
ATOM 6448 O UNK B 63 138.862 205.933 112.604 1.00121.17 O
ATOM 6449 CB UNK B 63 138.589 204.136 115.485 1.00121.17 C
ATOM 6450 N UNK B 64 138.230 203.775 112.522 1.00127.95 N
ATOM 6451 CA UNK B 64 137.455 203.917 111.299 1.00127.95 C
ATOM 6452 C UNK B 64 136.409 202.816 111.253 1.00127.95 C
ATOM 6453 O UNK B 64 136.564 201.788 111.908 1.00127.95 O
ATOM 6454 CB UNK B 64 138.356 203.855 110.066 1.00127.95 C
ATOM 6455 N UNK B 65 135.352 203.026 110.480 1.00130.05 N
ATOM 6456 CA UNK B 65 134.260 202.063 110.417 1.00130.05 C
ATOM 6457 C UNK B 65 134.611 200.871 109.536 1.00130.05 C
ATOM 6458 O UNK B 65 135.644 200.856 108.863 1.00130.05 O
ATOM 6459 CB UNK B 65 132.984 202.732 109.903 1.00130.05 C
ATOM 6460 N UNK B 66 133.739 199.870 109.551 1.00140.73 N
ATOM 6461 CA UNK B 66 133.910 198.694 108.712 1.00140.73 C
ATOM 6462 C UNK B 66 133.420 198.980 107.300 1.00140.73 C
ATOM 6463 O UNK B 66 132.708 198.170 106.707 1.00140.73 O
ATOM 6464 CB UNK B 66 133.157 197.500 109.298 1.00140.73 C
ATOM 6465 N UNK B 105 138.503 195.109 121.873 1.00125.02 N
ATOM 6466 CA UNK B 105 139.838 194.781 121.382 1.00125.02 C
ATOM 6467 C UNK B 105 140.669 196.034 121.150 1.00125.02 C
ATOM 6468 O UNK B 105 140.574 196.655 120.093 1.00125.02 O
ATOM 6469 CB UNK B 105 139.747 193.978 120.086 1.00125.02 C
ATOM 6470 N UNK B 106 141.485 196.397 122.136 1.00130.02 N
ATOM 6471 CA UNK B 106 142.350 197.562 122.024 1.00130.02 C
ATOM 6472 C UNK B 106 143.489 197.290 121.048 1.00130.02 C
ATOM 6473 O UNK B 106 144.451 196.597 121.378 1.00130.02 O
ATOM 6474 CB UNK B 106 142.906 197.951 123.392 1.00130.02 C
ATOM 6475 N UNK B 107 143.371 197.842 119.845 1.00126.69 N
ATOM 6476 CA UNK B 107 144.332 197.583 118.783 1.00126.69 C
ATOM 6477 C UNK B 107 145.202 198.803 118.505 1.00126.69 C
ATOM 6478 O UNK B 107 144.723 199.799 117.965 1.00126.69 O
ATOM 6479 CB UNK B 107 143.603 197.156 117.509 1.00126.69 C
ATOM 6480 N UNK B 108 146.477 198.722 118.872 1.00120.94 N
ATOM 6481 CA UNK B 108 147.402 199.837 118.692 1.00120.94 C
ATOM 6482 C UNK B 108 147.827 200.002 117.235 1.00120.94 C
ATOM 6483 O UNK B 108 148.936 199.618 116.864 1.00120.94 O
ATOM 6484 CB UNK B 108 148.639 199.646 119.570 1.00120.94 C
ATOM 6485 N UNK B 109 146.958 200.594 116.422 1.00120.31 N
ATOM 6486 CA UNK B 109 147.213 200.733 114.992 1.00120.31 C
ATOM 6487 C UNK B 109 148.213 201.843 114.685 1.00120.31 C
ATOM 6488 O UNK B 109 148.778 202.461 115.586 1.00120.31 O
ATOM 6489 CB UNK B 109 145.906 200.993 114.242 1.00120.31 C
ATOM 6490 N UNK B 110 148.434 202.089 113.398 1.00120.85 N
ATOM 6491 CA UNK B 110 149.349 203.139 112.969 1.00120.85 C
ATOM 6492 C UNK B 110 148.912 203.712 111.627 1.00120.85 C
ATOM 6493 O UNK B 110 149.742 204.121 110.815 1.00120.85 O
ATOM 6494 CB UNK B 110 150.780 202.609 112.876 1.00120.85 C
ATOM 6495 N UNK B 111 147.602 203.738 111.408 1.00117.29 N
ATOM 6496 CA UNK B 111 147.030 204.257 110.172 1.00117.29 C
ATOM 6497 C UNK B 111 147.177 205.772 110.084 1.00117.29 C
ATOM 6498 O UNK B 111 146.932 206.367 109.032 1.00117.29 O
ATOM 6499 CB UNK B 111 145.556 203.868 110.065 1.00117.29 C
ATOM 6500 N LYS B 116 148.717 193.827 119.284 1.00113.28 N
ATOM 6501 CA LYS B 116 147.687 193.861 118.255 1.00113.28 C
ATOM 6502 C LYS B 116 147.928 195.013 117.293 1.00113.28 C
ATOM 6503 O LYS B 116 146.996 195.718 116.915 1.00113.28 O
ATOM 6504 CB LYS B 116 146.302 193.982 118.888 1.00113.28 C
ATOM 6505 N TYR B 117 149.190 195.189 116.905 1.00112.66 N
ATOM 6506 CA TYR B 117 149.574 196.313 116.063 1.00112.66 C
ATOM 6507 C TYR B 117 149.033 196.144 114.650 1.00112.66 C
ATOM 6508 O TYR B 117 149.089 195.059 114.070 1.00112.66 O
ATOM 6509 CB TYR B 117 151.095 196.447 116.028 1.00112.66 C
ATOM 6510 N ILE B 118 148.498 197.227 114.100 1.00114.90 N
ATOM 6511 CA ILE B 118 147.914 197.236 112.766 1.00114.90 C
ATOM 6512 C ILE B 118 148.638 198.284 111.939 1.00114.90 C
ATOM 6513 O ILE B 118 148.748 199.441 112.357 1.00114.90 O
ATOM 6514 CB ILE B 118 146.405 197.532 112.808 1.00114.90 C
ATOM 6515 CG1 ILE B 118 145.670 196.448 113.587 1.00114.90 C
ATOM 6516 CG2 ILE B 118 145.839 197.641 111.403 1.00114.90 C
ATOM 6517 CD1 ILE B 118 144.230 196.789 113.867 1.00114.90 C
ATOM 6518 N ARG B 119 149.133 197.884 110.774 1.00118.68 N
ATOM 6519 CA ARG B 119 149.738 198.811 109.830 1.00118.68 C
ATOM 6520 C ARG B 119 149.021 198.700 108.495 1.00118.68 C
ATOM 6521 O ARG B 119 148.932 197.609 107.923 1.00118.68 O
ATOM 6522 CB ARG B 119 151.231 198.529 109.657 1.00118.68 C
ATOM 6523 N LEU B 120 148.501 199.822 108.008 1.00128.32 N
ATOM 6524 CA LEU B 120 147.994 199.886 106.646 1.00128.32 C
ATOM 6525 C LEU B 120 149.148 200.238 105.720 1.00128.32 C
ATOM 6526 O LEU B 120 149.996 201.066 106.066 1.00128.32 O
ATOM 6527 CB LEU B 120 146.876 200.921 106.529 1.00128.32 C
ATOM 6528 N SER B 121 149.189 199.609 104.549 1.00133.31 N
ATOM 6529 CA SER B 121 150.373 199.712 103.712 1.00133.31 C
ATOM 6530 C SER B 121 149.990 199.742 102.241 1.00133.31 C
ATOM 6531 O SER B 121 148.996 199.146 101.822 1.00133.31 O
ATOM 6532 CB SER B 121 151.337 198.551 103.978 1.00133.31 C
ATOM 6533 OG SER B 121 150.753 197.317 103.596 1.00133.31 O
ATOM 6534 N CYS B 122 150.800 200.453 101.463 1.00129.30 N
ATOM 6535 CA CYS B 122 150.721 200.367 100.016 1.00129.30 C
ATOM 6536 C CYS B 122 151.543 199.180 99.520 1.00129.30 C
ATOM 6537 O CYS B 122 152.463 198.704 100.189 1.00129.30 O
ATOM 6538 CB CYS B 122 151.213 201.662 99.373 1.00129.30 C
ATOM 6539 N ASP B 123 151.205 198.707 98.322 1.00123.46 N
ATOM 6540 CA ASP B 123 151.798 197.485 97.781 1.00123.46 C
ATOM 6541 C ASP B 123 153.197 197.788 97.249 1.00123.46 C
ATOM 6542 O ASP B 123 153.408 198.028 96.058 1.00123.46 O
ATOM 6543 CB ASP B 123 150.904 196.898 96.698 1.00123.46 C
ATOM 6544 N THR B 124 154.173 197.749 98.160 1.00132.57 N
ATOM 6545 CA THR B 124 155.576 197.969 97.820 1.00132.57 C
ATOM 6546 C THR B 124 156.457 197.403 98.929 1.00132.57 C
ATOM 6547 O THR B 124 156.008 197.196 100.059 1.00132.57 O
ATOM 6548 CB THR B 124 155.884 199.458 97.610 1.00132.57 C
ATOM 6549 N ASP B 125 157.727 197.155 98.573 1.00134.63 N
ATOM 6550 CA ASP B 125 158.840 196.941 99.514 1.00134.63 C
ATOM 6551 C ASP B 125 158.632 195.741 100.439 1.00134.63 C
ATOM 6552 O ASP B 125 158.476 195.884 101.653 1.00134.63 O
ATOM 6553 CB ASP B 125 159.108 198.208 100.330 1.00134.63 C
ATOM 6554 N SER B 126 158.624 194.543 99.846 1.00136.98 N
ATOM 6555 CA SER B 126 158.434 193.321 100.625 1.00136.98 C
ATOM 6556 C SER B 126 159.623 193.049 101.541 1.00136.98 C
ATOM 6557 O SER B 126 159.451 192.598 102.681 1.00136.98 O
ATOM 6558 CB SER B 126 158.210 192.136 99.686 1.00136.98 C
ATOM 6559 OG SER B 126 157.027 192.302 98.930 1.00136.98 O
ATOM 6560 N GLU B 127 160.838 193.311 101.051 1.00132.35 N
ATOM 6561 CA GLU B 127 162.031 193.068 101.855 1.00132.35 C
ATOM 6562 C GLU B 127 162.107 194.031 103.032 1.00132.35 C
ATOM 6563 O GLU B 127 162.448 193.626 104.149 1.00132.35 O
ATOM 6564 CB GLU B 127 163.283 193.184 100.985 1.00132.35 C
ATOM 6565 N THR B 128 161.758 195.300 102.803 1.00131.45 N
ATOM 6566 CA THR B 128 161.685 196.261 103.898 1.00131.45 C
ATOM 6567 C THR B 128 160.563 195.907 104.863 1.00131.45 C
ATOM 6568 O THR B 128 160.679 196.143 106.070 1.00131.45 O
ATOM 6569 CB THR B 128 161.488 197.672 103.346 1.00131.45 C
ATOM 6570 N LEU B 129 159.482 195.310 104.350 1.00130.87 N
ATOM 6571 CA LEU B 129 158.373 194.878 105.198 1.00130.87 C
ATOM 6572 C LEU B 129 158.788 193.756 106.140 1.00130.87 C
ATOM 6573 O LEU B 129 158.493 193.800 107.344 1.00130.87 O
ATOM 6574 CB LEU B 129 157.204 194.430 104.327 1.00130.87 C
ATOM 6575 CG LEU B 129 155.982 193.901 105.064 1.00130.87 C
ATOM 6576 CD1 LEU B 129 155.412 194.969 105.968 1.00130.87 C
ATOM 6577 CD2 LEU B 129 154.946 193.430 104.066 1.00130.87 C
ATOM 6578 N TYR B 130 159.474 192.741 105.609 1.00132.30 N
ATOM 6579 CA TYR B 130 159.959 191.661 106.459 1.00132.30 C
ATOM 6580 C TYR B 130 161.047 192.150 107.405 1.00132.30 C
ATOM 6581 O TYR B 130 161.134 191.684 108.547 1.00132.30 O
ATOM 6582 CB TYR B 130 160.463 190.499 105.606 1.00132.30 C
ATOM 6583 CG TYR B 130 161.013 189.345 106.414 1.00132.30 C
ATOM 6584 CD1 TYR B 130 160.167 188.508 107.128 1.00132.30 C
ATOM 6585 CD2 TYR B 130 162.378 189.087 106.454 1.00132.30 C
ATOM 6586 CE1 TYR B 130 160.666 187.455 107.869 1.00132.30 C
ATOM 6587 CE2 TYR B 130 162.886 188.034 107.190 1.00132.30 C
ATOM 6588 CZ TYR B 130 162.024 187.222 107.893 1.00132.30 C
ATOM 6589 OH TYR B 130 162.523 186.175 108.628 1.00132.30 O
ATOM 6590 N ASP B 131 161.868 193.108 106.958 1.00130.49 N
ATOM 6591 CA ASP B 131 162.873 193.697 107.836 1.00130.49 C
ATOM 6592 C ASP B 131 162.224 194.454 108.990 1.00130.49 C
ATOM 6593 O ASP B 131 162.714 194.409 110.122 1.00130.49 O
ATOM 6594 CB ASP B 131 163.789 194.622 107.037 1.00130.49 C
ATOM 6595 N LEU B 132 161.101 195.124 108.723 1.00131.15 N
ATOM 6596 CA LEU B 132 160.363 195.800 109.784 1.00131.15 C
ATOM 6597 C LEU B 132 159.737 194.801 110.747 1.00131.15 C
ATOM 6598 O LEU B 132 159.771 195.000 111.966 1.00131.15 O
ATOM 6599 CB LEU B 132 159.290 196.706 109.183 1.00131.15 C
ATOM 6600 N MET B 133 159.174 193.711 110.221 1.00132.58 N
ATOM 6601 CA MET B 133 158.535 192.725 111.093 1.00132.58 C
ATOM 6602 C MET B 133 159.562 191.957 111.921 1.00132.58 C
ATOM 6603 O MET B 133 159.244 191.436 112.997 1.00132.58 O
ATOM 6604 CB MET B 133 157.677 191.768 110.274 1.00132.58 C
ATOM 6605 CG MET B 133 156.435 192.409 109.709 1.00132.58 C
ATOM 6606 SD MET B 133 155.386 191.215 108.871 1.00132.58 S
ATOM 6607 CE MET B 133 156.335 190.943 107.379 1.00132.58 C
ATOM 6608 N THR B 134 160.801 191.869 111.435 1.00133.60 N
ATOM 6609 CA THR B 134 161.852 191.252 112.239 1.00133.60 C
ATOM 6610 C THR B 134 162.416 192.228 113.264 1.00133.60 C
ATOM 6611 O THR B 134 162.622 191.868 114.428 1.00133.60 O
ATOM 6612 CB THR B 134 162.969 190.719 111.345 1.00133.60 C
ATOM 6613 OG1 THR B 134 163.421 191.755 110.467 1.00133.60 O
ATOM 6614 CG2 THR B 134 162.502 189.510 110.551 1.00133.60 C
ATOM 6615 N GLN B 135 162.686 193.468 112.847 1.00132.56 N
ATOM 6616 CA GLN B 135 163.375 194.408 113.724 1.00132.56 C
ATOM 6617 C GLN B 135 162.456 194.937 114.816 1.00132.56 C
ATOM 6618 O GLN B 135 162.898 195.174 115.946 1.00132.56 O
ATOM 6619 CB GLN B 135 163.945 195.562 112.902 1.00132.56 C
ATOM 6620 N HIS B 136 161.175 195.136 114.503 1.00134.98 N
ATOM 6621 CA HIS B 136 160.289 195.785 115.461 1.00134.98 C
ATOM 6622 C HIS B 136 159.656 194.785 116.422 1.00134.98 C
ATOM 6623 O HIS B 136 159.744 194.958 117.643 1.00134.98 O
ATOM 6624 CB HIS B 136 159.224 196.590 114.720 1.00134.98 C
ATOM 6625 CG HIS B 136 159.776 197.764 113.971 1.00134.98 C
ATOM 6626 ND1 HIS B 136 160.214 198.907 114.603 1.00134.98 N
ATOM 6627 CD2 HIS B 136 159.965 197.973 112.647 1.00134.98 C
ATOM 6628 CE1 HIS B 136 160.649 199.768 113.701 1.00134.98 C
ATOM 6629 NE2 HIS B 136 160.510 199.225 112.505 1.00134.98 N
ATOM 6630 N TRP B 137 159.019 193.733 115.907 1.00132.91 N
ATOM 6631 CA TRP B 137 158.259 192.863 116.798 1.00132.91 C
ATOM 6632 C TRP B 137 158.815 191.448 116.934 1.00132.91 C
ATOM 6633 O TRP B 137 159.147 191.015 118.044 1.00132.91 O
ATOM 6634 CB TRP B 137 156.811 192.747 116.323 1.00132.91 C
ATOM 6635 CG TRP B 137 156.015 194.007 116.337 1.00132.91 C
ATOM 6636 CD1 TRP B 137 155.357 194.549 117.398 1.00132.91 C
ATOM 6637 CD2 TRP B 137 155.726 194.844 115.213 1.00132.91 C
ATOM 6638 NE1 TRP B 137 154.703 195.695 117.014 1.00132.91 N
ATOM 6639 CE2 TRP B 137 154.912 195.893 115.675 1.00132.91 C
ATOM 6640 CE3 TRP B 137 156.088 194.812 113.864 1.00132.91 C
ATOM 6641 CZ2 TRP B 137 154.458 196.907 114.836 1.00132.91 C
ATOM 6642 CZ3 TRP B 137 155.636 195.815 113.035 1.00132.91 C
ATOM 6643 CH2 TRP B 137 154.829 196.848 113.522 1.00132.91 C
ATOM 6644 N HIS B 138 158.932 190.724 115.825 1.00125.03 N
ATOM 6645 CA HIS B 138 158.989 189.270 115.865 1.00125.03 C
ATOM 6646 C HIS B 138 160.385 188.738 115.577 1.00125.03 C
ATOM 6647 O HIS B 138 161.173 189.352 114.856 1.00125.03 O
ATOM 6648 CB HIS B 138 158.004 188.665 114.866 1.00125.03 C
ATOM 6649 N LEU B 139 160.674 187.571 116.150 1.00117.22 N
ATOM 6650 CA LEU B 139 161.937 186.884 115.924 1.00117.22 C
ATOM 6651 C LEU B 139 161.892 186.076 114.630 1.00117.22 C
ATOM 6652 O LEU B 139 160.837 185.890 114.020 1.00117.22 O
ATOM 6653 CB LEU B 139 162.269 185.997 117.127 1.00117.22 C
ATOM 6654 CG LEU B 139 161.234 185.003 117.670 1.00117.22 C
ATOM 6655 CD1 LEU B 139 161.325 183.626 117.043 1.00117.22 C
ATOM 6656 CD2 LEU B 139 161.353 184.902 119.182 1.00117.22 C
ATOM 6657 N LYS B 140 163.064 185.606 114.204 1.00114.05 N
ATOM 6658 CA LYS B 140 163.148 184.799 112.993 1.00114.05 C
ATOM 6659 C LYS B 140 162.544 183.426 113.239 1.00114.05 C
ATOM 6660 O LYS B 140 162.834 182.774 114.245 1.00114.05 O
ATOM 6661 CB LYS B 140 164.601 184.661 112.542 1.00114.05 C
ATOM 6662 N THR B 141 161.709 182.976 112.305 1.00112.59 N
ATOM 6663 CA THR B 141 160.909 181.801 112.630 1.00112.59 C
ATOM 6664 C THR B 141 161.188 180.654 111.674 1.00112.59 C
ATOM 6665 O THR B 141 161.271 180.869 110.457 1.00112.59 O
ATOM 6666 CB THR B 141 159.429 182.146 112.599 1.00112.59 C
ATOM 6667 OG1 THR B 141 159.108 182.762 111.348 1.00112.59 O
ATOM 6668 CG2 THR B 141 159.086 183.075 113.750 1.00112.59 C
ATOM 6669 N PRO B 142 161.312 179.432 112.199 1.00110.32 N
ATOM 6670 CA PRO B 142 161.778 178.319 111.360 1.00110.32 C
ATOM 6671 C PRO B 142 160.728 177.796 110.403 1.00110.32 C
ATOM 6672 O PRO B 142 161.072 177.118 109.431 1.00110.32 O
ATOM 6673 CB PRO B 142 162.166 177.248 112.390 1.00110.32 C
ATOM 6674 CG PRO B 142 162.302 177.984 113.684 1.00110.32 C
ATOM 6675 CD PRO B 142 161.300 179.073 113.625 1.00110.32 C
ATOM 6676 N ASN B 143 159.454 178.074 110.653 1.00111.94 N
ATOM 6677 CA ASN B 143 158.379 177.499 109.860 1.00111.94 C
ATOM 6678 C ASN B 143 157.342 178.576 109.584 1.00111.94 C
ATOM 6679 O ASN B 143 157.250 179.563 110.315 1.00111.94 O
ATOM 6680 CB ASN B 143 157.742 176.309 110.589 1.00111.94 C
ATOM 6681 CG ASN B 143 156.893 175.453 109.683 1.00111.94 C
ATOM 6682 OD1 ASN B 143 156.773 175.720 108.491 1.00111.94 O
ATOM 6683 ND2 ASN B 143 156.299 174.411 110.243 1.00111.94 N
ATOM 6684 N LEU B 144 156.573 178.390 108.514 1.00107.67 N
ATOM 6685 CA LEU B 144 155.431 179.248 108.229 1.00107.67 C
ATOM 6686 C LEU B 144 154.405 178.478 107.411 1.00107.67 C
ATOM 6687 O LEU B 144 154.750 177.819 106.427 1.00107.67 O
ATOM 6688 CB LEU B 144 155.869 180.537 107.526 1.00107.67 C
ATOM 6689 CG LEU B 144 156.587 180.549 106.184 1.00107.67 C
ATOM 6690 CD1 LEU B 144 155.612 180.721 105.031 1.00107.67 C
ATOM 6691 CD2 LEU B 144 157.601 181.659 106.208 1.00107.67 C
ATOM 6692 N VAL B 145 153.149 178.550 107.837 1.00106.15 N
ATOM 6693 CA VAL B 145 152.048 177.835 107.211 1.00106.15 C
ATOM 6694 C VAL B 145 151.087 178.857 106.629 1.00106.15 C
ATOM 6695 O VAL B 145 150.519 179.668 107.366 1.00106.15 O
ATOM 6696 CB VAL B 145 151.328 176.931 108.226 1.00106.15 C
ATOM 6697 CG1 VAL B 145 150.113 176.291 107.603 1.00106.15 C
ATOM 6698 CG2 VAL B 145 152.266 175.874 108.751 1.00106.15 C
ATOM 6699 N ILE B 146 150.898 178.819 105.316 1.00112.43 N
ATOM 6700 CA ILE B 146 149.888 179.622 104.637 1.00112.43 C
ATOM 6701 C ILE B 146 148.676 178.748 104.350 1.00112.43 C
ATOM 6702 O ILE B 146 148.794 177.689 103.725 1.00112.43 O
ATOM 6703 CB ILE B 146 150.439 180.269 103.350 1.00112.43 C
ATOM 6704 CG1 ILE B 146 149.419 181.229 102.723 1.00112.43 C
ATOM 6705 CG2 ILE B 146 150.941 179.233 102.379 1.00112.43 C
ATOM 6706 CD1 ILE B 146 149.956 182.117 101.666 1.00112.43 C
ATOM 6707 N SER B 147 147.517 179.182 104.831 1.00110.62 N
ATOM 6708 CA SER B 147 146.262 178.483 104.616 1.00110.62 C
ATOM 6709 C SER B 147 145.268 179.427 103.964 1.00110.62 C
ATOM 6710 O SER B 147 145.180 180.600 104.336 1.00110.62 O
ATOM 6711 CB SER B 147 145.696 177.957 105.930 1.00110.62 C
ATOM 6712 OG SER B 147 145.331 179.028 106.776 1.00110.62 O
ATOM 6713 N VAL B 148 144.532 178.914 102.988 1.00119.15 N
ATOM 6714 CA VAL B 148 143.485 179.682 102.336 1.00119.15 C
ATOM 6715 C VAL B 148 142.134 179.023 102.568 1.00119.15 C
ATOM 6716 O VAL B 148 141.905 177.889 102.145 1.00119.15 O
ATOM 6717 CB VAL B 148 143.760 179.837 100.837 1.00119.15 C
ATOM 6718 CG1 VAL B 148 142.611 180.561 100.172 1.00119.15 C
ATOM 6719 CG2 VAL B 148 145.061 180.582 100.615 1.00119.15 C
ATOM 6720 N LYS B 153 132.069 183.339 101.673 1.00129.46 N
ATOM 6721 CA LYS B 153 133.003 182.238 101.867 1.00129.46 C
ATOM 6722 C LYS B 153 132.694 181.477 103.150 1.00129.46 C
ATOM 6723 O LYS B 153 133.598 180.973 103.814 1.00129.46 O
ATOM 6724 CB LYS B 153 134.441 182.754 101.899 1.00129.46 C
ATOM 6725 N ASN B 154 131.412 181.399 103.494 1.00129.68 N
ATOM 6726 CA ASN B 154 131.002 180.706 104.707 1.00129.68 C
ATOM 6727 C ASN B 154 131.031 179.198 104.503 1.00129.68 C
ATOM 6728 O ASN B 154 130.814 178.698 103.396 1.00129.68 O
ATOM 6729 CB ASN B 154 129.603 181.150 105.128 1.00129.68 C
ATOM 6730 N PHE B 155 131.308 178.471 105.583 1.00127.06 N
ATOM 6731 CA PHE B 155 131.379 177.019 105.551 1.00127.06 C
ATOM 6732 C PHE B 155 130.883 176.466 106.878 1.00127.06 C
ATOM 6733 O PHE B 155 130.593 177.210 107.817 1.00127.06 O
ATOM 6734 CB PHE B 155 132.804 176.524 105.270 1.00127.06 C
ATOM 6735 N ALA B 156 130.784 175.142 106.943 1.00124.64 N
ATOM 6736 CA ALA B 156 130.306 174.439 108.126 1.00124.64 C
ATOM 6737 C ALA B 156 131.400 173.512 108.635 1.00124.64 C
ATOM 6738 O ALA B 156 132.125 172.904 107.840 1.00124.64 O
ATOM 6739 CB ALA B 156 129.033 173.653 107.818 1.00124.64 C
ATOM 6740 N LEU B 157 131.519 173.410 109.955 1.00122.55 N
ATOM 6741 CA LEU B 157 132.532 172.549 110.543 1.00122.55 C
ATOM 6742 C LEU B 157 132.060 171.101 110.553 1.00122.55 C
ATOM 6743 O LEU B 157 130.876 170.815 110.742 1.00122.55 O
ATOM 6744 CB LEU B 157 132.871 173.019 111.963 1.00122.55 C
ATOM 6745 CG LEU B 157 131.878 172.941 113.133 1.00122.55 C
ATOM 6746 CD1 LEU B 157 132.064 171.676 113.976 1.00122.55 C
ATOM 6747 CD2 LEU B 157 131.957 174.187 114.004 1.00122.55 C
ATOM 6748 N LYS B 158 132.999 170.189 110.344 1.00129.76 N
ATOM 6749 CA LYS B 158 132.763 168.762 110.506 1.00129.76 C
ATOM 6750 C LYS B 158 133.263 168.372 111.891 1.00129.76 C
ATOM 6751 O LYS B 158 134.032 169.129 112.494 1.00129.76 O
ATOM 6752 CB LYS B 158 133.476 167.977 109.400 1.00129.76 C
ATOM 6753 N PRO B 159 132.856 167.225 112.444 1.00128.04 N
ATOM 6754 CA PRO B 159 133.448 166.815 113.730 1.00128.04 C
ATOM 6755 C PRO B 159 134.879 166.312 113.615 1.00128.04 C
ATOM 6756 O PRO B 159 135.562 166.190 114.638 1.00128.04 O
ATOM 6757 CB PRO B 159 132.490 165.724 114.224 1.00128.04 C
ATOM 6758 CG PRO B 159 131.829 165.214 113.001 1.00128.04 C
ATOM 6759 CD PRO B 159 131.690 166.394 112.093 1.00128.04 C
ATOM 6760 N ARG B 160 135.358 166.005 112.407 1.00128.62 N
ATOM 6761 CA ARG B 160 136.743 165.570 112.230 1.00128.62 C
ATOM 6762 C ARG B 160 137.678 166.749 111.978 1.00128.62 C
ATOM 6763 O ARG B 160 138.789 166.791 112.518 1.00128.62 O
ATOM 6764 CB ARG B 160 136.855 164.566 111.078 1.00128.62 C
ATOM 6765 CG ARG B 160 138.237 163.944 110.972 1.00128.62 C
ATOM 6766 CD ARG B 160 138.375 163.033 109.775 1.00128.62 C
ATOM 6767 NE ARG B 160 138.377 163.787 108.528 1.00128.62 N
ATOM 6768 CZ ARG B 160 138.349 163.229 107.324 1.00128.62 C
ATOM 6769 NH1 ARG B 160 138.321 161.909 107.204 1.00128.62 N1+
ATOM 6770 NH2 ARG B 160 138.353 163.990 106.238 1.00128.62 N
ATOM 6771 N MET B 161 137.245 167.699 111.142 1.00128.49 N
ATOM 6772 CA MET B 161 138.034 168.853 110.713 1.00128.49 C
ATOM 6773 C MET B 161 138.501 169.727 111.872 1.00128.49 C
ATOM 6774 O MET B 161 139.577 170.337 111.805 1.00128.49 O
ATOM 6775 CB MET B 161 137.220 169.695 109.734 1.00128.49 C
ATOM 6776 CG MET B 161 136.911 168.990 108.430 1.00128.49 C
ATOM 6777 SD MET B 161 138.383 168.591 107.474 1.00128.49 S
ATOM 6778 CE MET B 161 138.900 170.225 106.954 1.00128.49 C
ATOM 6779 N ARG B 162 137.685 169.790 112.930 1.00126.55 N
ATOM 6780 CA ARG B 162 138.054 170.515 114.142 1.00126.55 C
ATOM 6781 C ARG B 162 139.296 169.920 114.791 1.00126.55 C
ATOM 6782 O ARG B 162 140.204 170.655 115.205 1.00126.55 O
ATOM 6783 CB ARG B 162 136.884 170.498 115.121 1.00126.55 C
ATOM 6784 N LYS B 163 139.355 168.586 114.869 1.00128.67 N
ATOM 6785 CA LYS B 163 140.541 167.897 115.371 1.00128.67 C
ATOM 6786 C LYS B 163 141.751 168.155 114.483 1.00128.67 C
ATOM 6787 O LYS B 163 142.868 168.329 114.985 1.00128.67 O
ATOM 6788 CB LYS B 163 140.246 166.398 115.483 1.00128.67 C
ATOM 6789 CG LYS B 163 141.394 165.514 115.952 1.00128.67 C
ATOM 6790 CD LYS B 163 141.976 164.706 114.796 1.00128.67 C
ATOM 6791 CE LYS B 163 143.055 163.757 115.272 1.00128.67 C
ATOM 6792 NZ LYS B 163 142.501 162.715 116.177 1.00128.67 N1+
ATOM 6793 N ILE B 164 141.538 168.226 113.166 1.00122.87 N
ATOM 6794 CA ILE B 164 142.634 168.453 112.225 1.00122.87 C
ATOM 6795 C ILE B 164 143.229 169.843 112.410 1.00122.87 C
ATOM 6796 O ILE B 164 144.453 170.008 112.474 1.00122.87 O
ATOM 6797 CB ILE B 164 142.138 168.238 110.786 1.00122.87 C
ATOM 6798 CG1 ILE B 164 141.660 166.801 110.618 1.00122.87 C
ATOM 6799 CG2 ILE B 164 143.232 168.544 109.785 1.00122.87 C
ATOM 6800 CD1 ILE B 164 140.927 166.556 109.332 1.00122.87 C
ATOM 6801 N PHE B 165 142.377 170.855 112.549 1.00123.24 N
ATOM 6802 CA PHE B 165 142.896 172.215 112.657 1.00123.24 C
ATOM 6803 C PHE B 165 143.461 172.494 114.046 1.00123.24 C
ATOM 6804 O PHE B 165 144.430 173.257 114.181 1.00123.24 O
ATOM 6805 CB PHE B 165 141.805 173.204 112.270 1.00123.24 C
ATOM 6806 CG PHE B 165 141.503 173.197 110.803 1.00123.24 C
ATOM 6807 CD1 PHE B 165 142.449 172.749 109.894 1.00123.24 C
ATOM 6808 CD2 PHE B 165 140.263 173.583 110.331 1.00123.24 C
ATOM 6809 CE1 PHE B 165 142.177 172.721 108.542 1.00123.24 C
ATOM 6810 CE2 PHE B 165 139.984 173.550 108.975 1.00123.24 C
ATOM 6811 CZ PHE B 165 140.944 173.123 108.082 1.00123.24 C
ATOM 6812 N SER B 166 142.907 171.856 115.084 1.00123.57 N
ATOM 6813 CA SER B 166 143.524 171.945 116.404 1.00123.57 C
ATOM 6814 C SER B 166 144.886 171.261 116.417 1.00123.57 C
ATOM 6815 O SER B 166 145.830 171.752 117.048 1.00123.57 O
ATOM 6816 CB SER B 166 142.607 171.330 117.457 1.00123.57 C
ATOM 6817 OG SER B 166 142.482 169.935 117.263 1.00123.57 O
ATOM 6818 N ARG B 167 145.010 170.147 115.688 1.00118.92 N
ATOM 6819 CA ARG B 167 146.294 169.477 115.534 1.00118.92 C
ATOM 6820 C ARG B 167 147.296 170.363 114.807 1.00118.92 C
ATOM 6821 O ARG B 167 148.474 170.423 115.184 1.00118.92 O
ATOM 6822 CB ARG B 167 146.086 168.168 114.777 1.00118.92 C
ATOM 6823 CG ARG B 167 147.337 167.359 114.566 1.00118.92 C
ATOM 6824 CD ARG B 167 147.860 166.867 115.889 1.00118.92 C
ATOM 6825 NE ARG B 167 146.908 165.969 116.528 1.00118.92 N
ATOM 6826 CZ ARG B 167 146.993 165.569 117.790 1.00118.92 C
ATOM 6827 NH1 ARG B 167 147.991 165.987 118.554 1.00118.92 N
ATOM 6828 NH2 ARG B 167 146.079 164.750 118.288 1.00118.92 N
ATOM 6829 N LEU B 168 146.833 171.078 113.777 1.00113.41 N
ATOM 6830 CA LEU B 168 147.716 171.949 113.008 1.00113.41 C
ATOM 6831 C LEU B 168 148.227 173.107 113.854 1.00113.41 C
ATOM 6832 O LEU B 168 149.419 173.432 113.816 1.00113.41 O
ATOM 6833 CB LEU B 168 146.978 172.460 111.771 1.00113.41 C
ATOM 6834 CG LEU B 168 147.755 173.152 110.652 1.00113.41 C
ATOM 6835 CD1 LEU B 168 147.088 172.810 109.348 1.00113.41 C
ATOM 6836 CD2 LEU B 168 147.791 174.662 110.805 1.00113.41 C
ATOM 6837 N ILE B 169 147.344 173.729 114.637 1.00113.49 N
ATOM 6838 CA ILE B 169 147.778 174.842 115.478 1.00113.49 C
ATOM 6839 C ILE B 169 148.657 174.341 116.624 1.00113.49 C
ATOM 6840 O ILE B 169 149.592 175.033 117.055 1.00113.49 O
ATOM 6841 CB ILE B 169 146.549 175.634 115.963 1.00113.49 C
ATOM 6842 CG1 ILE B 169 145.834 176.232 114.759 1.00113.49 C
ATOM 6843 CG2 ILE B 169 146.923 176.777 116.884 1.00113.49 C
ATOM 6844 CD1 ILE B 169 144.523 176.876 115.093 1.00113.49 C
ATOM 6845 N TYR B 170 148.431 173.104 117.078 1.00115.22 N
ATOM 6846 CA TYR B 170 149.307 172.520 118.089 1.00115.22 C
ATOM 6847 C TYR B 170 150.717 172.296 117.552 1.00115.22 C
ATOM 6848 O TYR B 170 151.705 172.578 118.244 1.00115.22 O
ATOM 6849 CB TYR B 170 148.713 171.208 118.591 1.00115.22 C
ATOM 6850 CG TYR B 170 149.522 170.575 119.687 1.00115.22 C
ATOM 6851 CD1 TYR B 170 149.514 171.108 120.970 1.00115.22 C
ATOM 6852 CD2 TYR B 170 150.290 169.446 119.446 1.00115.22 C
ATOM 6853 CE1 TYR B 170 150.250 170.538 121.984 1.00115.22 C
ATOM 6854 CE2 TYR B 170 151.033 168.866 120.455 1.00115.22 C
ATOM 6855 CZ TYR B 170 151.008 169.418 121.723 1.00115.22 C
ATOM 6856 OH TYR B 170 151.743 168.849 122.737 1.00115.22 O
ATOM 6857 N ILE B 171 150.826 171.808 116.312 1.00111.46 N
ATOM 6858 CA ILE B 171 152.132 171.658 115.668 1.00111.46 C
ATOM 6859 C ILE B 171 152.790 173.018 115.467 1.00111.46 C
ATOM 6860 O ILE B 171 153.999 173.179 115.681 1.00111.46 O
ATOM 6861 CB ILE B 171 151.979 170.894 114.340 1.00111.46 C
ATOM 6862 CG1 ILE B 171 151.544 169.459 114.608 1.00111.46 C
ATOM 6863 CG2 ILE B 171 153.267 170.881 113.543 1.00111.46 C
ATOM 6864 CD1 ILE B 171 151.089 168.736 113.373 1.00111.46 C
ATOM 6865 N ALA B 172 151.992 174.024 115.099 1.00107.79 N
ATOM 6866 CA ALA B 172 152.529 175.361 114.861 1.00107.79 C
ATOM 6867 C ALA B 172 153.049 175.999 116.142 1.00107.79 C
ATOM 6868 O ALA B 172 153.987 176.803 116.107 1.00107.79 O
ATOM 6869 CB ALA B 172 151.462 176.246 114.226 1.00107.79 C
ATOM 6870 N GLN B 173 152.450 175.664 117.283 1.00113.29 N
ATOM 6871 CA GLN B 173 152.985 176.168 118.543 1.00113.29 C
ATOM 6872 C GLN B 173 154.203 175.368 118.983 1.00113.29 C
ATOM 6873 O GLN B 173 155.136 175.925 119.574 1.00113.29 O
ATOM 6874 CB GLN B 173 151.911 176.148 119.627 1.00113.29 C
ATOM 6875 CG GLN B 173 152.338 176.791 120.937 1.00113.29 C
ATOM 6876 CD GLN B 173 151.234 176.811 121.967 1.00113.29 C
ATOM 6877 OE1 GLN B 173 150.128 176.331 121.718 1.00113.29 O
ATOM 6878 NE2 GLN B 173 151.529 177.357 123.137 1.00113.29 N
ATOM 6879 N SER B 174 154.214 174.061 118.702 1.00109.84 N
ATOM 6880 CA SER B 174 155.323 173.220 119.143 1.00109.84 C
ATOM 6881 C SER B 174 156.610 173.545 118.396 1.00109.84 C
ATOM 6882 O SER B 174 157.673 173.673 119.013 1.00109.84 O
ATOM 6883 CB SER B 174 154.968 171.748 118.965 1.00109.84 C
ATOM 6884 OG SER B 174 154.859 171.427 117.593 1.00109.84 O
ATOM 6885 N LYS B 175 156.542 173.686 117.073 1.00100.44 N
ATOM 6886 CA LYS B 175 157.753 174.028 116.334 1.00100.44 C
ATOM 6887 C LYS B 175 158.075 175.511 116.439 1.00100.44 C
ATOM 6888 O LYS B 175 159.248 175.889 116.509 1.00100.44 O
ATOM 6889 CB LYS B 175 157.613 173.637 114.867 1.00100.44 C
ATOM 6890 CG LYS B 175 157.408 172.164 114.636 1.00100.44 C
ATOM 6891 CD LYS B 175 158.636 171.380 115.024 1.00100.44 C
ATOM 6892 CE LYS B 175 158.487 169.924 114.629 1.00100.44 C
ATOM 6893 NZ LYS B 175 157.462 169.230 115.453 1.00100.44 N
ATOM 6894 N GLY B 176 157.054 176.361 116.425 1.00106.52 N
ATOM 6895 CA GLY B 176 157.256 177.793 116.375 1.00106.52 C
ATOM 6896 C GLY B 176 157.140 178.249 114.938 1.00106.52 C
ATOM 6897 O GLY B 176 158.076 178.060 114.157 1.00106.52 O
ATOM 6898 N ALA B 177 156.011 178.839 114.570 1.00108.71 N
ATOM 6899 CA ALA B 177 155.710 179.079 113.169 1.00108.71 C
ATOM 6900 C ALA B 177 154.860 180.327 112.982 1.00108.71 C
ATOM 6901 O ALA B 177 154.475 180.997 113.941 1.00108.71 O
ATOM 6902 CB ALA B 177 154.987 177.881 112.551 1.00108.71 C
ATOM 6903 N TRP B 178 154.578 180.624 111.721 1.00105.82 N
ATOM 6904 CA TRP B 178 153.709 181.723 111.336 1.00105.82 C
ATOM 6905 C TRP B 178 152.516 181.183 110.567 1.00105.82 C
ATOM 6906 O TRP B 178 152.671 180.328 109.692 1.00105.82 O
ATOM 6907 CB TRP B 178 154.452 182.745 110.486 1.00105.82 C
ATOM 6908 CG TRP B 178 155.323 183.632 111.275 1.00105.82 C
ATOM 6909 CD1 TRP B 178 155.389 183.703 112.625 1.00105.82 C
ATOM 6910 CD2 TRP B 178 156.235 184.609 110.775 1.00105.82 C
ATOM 6911 NE1 TRP B 178 156.288 184.661 113.004 1.00105.82 N
ATOM 6912 CE2 TRP B 178 156.829 185.227 111.883 1.00105.82 C
ATOM 6913 CE3 TRP B 178 156.613 185.016 109.492 1.00105.82 C
ATOM 6914 CZ2 TRP B 178 157.784 186.230 111.755 1.00105.82 C
ATOM 6915 CZ3 TRP B 178 157.559 186.011 109.365 1.00105.82 C
ATOM 6916 CH2 TRP B 178 158.133 186.607 110.489 1.00105.82 C
ATOM 6917 N ILE B 179 151.332 181.674 110.904 1.00103.75 N
ATOM 6918 CA ILE B 179 150.113 181.349 110.184 1.00103.75 C
ATOM 6919 C ILE B 179 149.703 182.575 109.381 1.00103.75 C
ATOM 6920 O ILE B 179 149.554 183.667 109.940 1.00103.75 O
ATOM 6921 CB ILE B 179 148.990 180.909 111.135 1.00103.75 C
ATOM 6922 CG1 ILE B 179 149.349 179.598 111.830 1.00103.75 C
ATOM 6923 CG2 ILE B 179 147.683 180.778 110.386 1.00103.75 C
ATOM 6924 CD1 ILE B 179 148.380 179.218 112.917 1.00103.75 C
ATOM 6925 N PHE B 180 149.539 182.401 108.074 1.00105.37 N
ATOM 6926 CA PHE B 180 149.015 183.435 107.200 1.00105.37 C
ATOM 6927 C PHE B 180 147.625 183.027 106.744 1.00105.37 C
ATOM 6928 O PHE B 180 147.458 181.989 106.101 1.00105.37 O
ATOM 6929 CB PHE B 180 149.935 183.659 106.006 1.00105.37 C
ATOM 6930 CG PHE B 180 151.220 184.337 106.359 1.00105.37 C
ATOM 6931 CD1 PHE B 180 151.281 185.711 106.450 1.00105.37 C
ATOM 6932 CD2 PHE B 180 152.358 183.604 106.627 1.00105.37 C
ATOM 6933 CE1 PHE B 180 152.458 186.347 106.785 1.00105.37 C
ATOM 6934 CE2 PHE B 180 153.541 184.232 106.963 1.00105.37 C
ATOM 6935 CZ PHE B 180 153.589 185.608 107.042 1.00105.37 C
ATOM 6936 N THR B 181 146.630 183.833 107.096 1.00113.95 N
ATOM 6937 CA THR B 181 145.245 183.480 106.842 1.00113.95 C
ATOM 6938 C THR B 181 144.571 184.610 106.087 1.00113.95 C
ATOM 6939 O THR B 181 145.173 185.651 105.818 1.00113.95 O
ATOM 6940 CB THR B 181 144.483 183.192 108.137 1.00113.95 C
ATOM 6941 N GLY B 182 143.299 184.389 105.753 1.00124.47 N
ATOM 6942 CA GLY B 182 142.575 185.358 104.945 1.00124.47 C
ATOM 6943 C GLY B 182 142.230 186.627 105.701 1.00124.47 C
ATOM 6944 O GLY B 182 142.027 187.682 105.096 1.00124.47 O
ATOM 6945 N GLY B 183 142.154 186.544 107.026 1.00125.75 N
ATOM 6946 CA GLY B 183 141.767 187.703 107.812 1.00125.75 C
ATOM 6947 C GLY B 183 140.310 188.069 107.663 1.00125.75 C
ATOM 6948 O GLY B 183 139.952 189.244 107.788 1.00125.75 O
ATOM 6949 N THR B 184 139.453 187.084 107.407 1.00132.79 N
ATOM 6950 CA THR B 184 138.054 187.299 107.059 1.00132.79 C
ATOM 6951 C THR B 184 137.269 187.738 108.285 1.00132.79 C
ATOM 6952 O THR B 184 137.808 187.758 109.399 1.00132.79 O
ATOM 6953 CB THR B 184 137.440 186.034 106.462 1.00132.79 C
ATOM 6954 N HIS B 185 136.016 188.134 108.064 1.00136.89 N
ATOM 6955 CA HIS B 185 135.087 188.526 109.126 1.00136.89 C
ATOM 6956 C HIS B 185 134.892 187.327 110.051 1.00136.89 C
ATOM 6957 O HIS B 185 135.425 187.343 111.168 1.00136.89 O
ATOM 6958 CB HIS B 185 133.820 189.063 108.481 1.00136.89 C
ATOM 6959 N TYR B 186 134.230 186.264 109.605 1.00134.27 N
ATOM 6960 CA TYR B 186 133.999 185.062 110.392 1.00134.27 C
ATOM 6961 C TYR B 186 133.811 183.899 109.435 1.00134.27 C
ATOM 6962 O TYR B 186 133.320 184.080 108.317 1.00134.27 O
ATOM 6963 CB TYR B 186 132.778 185.186 111.315 1.00134.27 C
ATOM 6964 CG TYR B 186 132.986 186.115 112.485 1.00134.27 C
ATOM 6965 CD1 TYR B 186 133.711 185.705 113.596 1.00134.27 C
ATOM 6966 CD2 TYR B 186 132.480 187.407 112.472 1.00134.27 C
ATOM 6967 CE1 TYR B 186 133.918 186.552 114.667 1.00134.27 C
ATOM 6968 CE2 TYR B 186 132.681 188.265 113.541 1.00134.27 C
ATOM 6969 CZ TYR B 186 133.400 187.830 114.635 1.00134.27 C
ATOM 6970 OH TYR B 186 133.603 188.677 115.701 1.00134.27 O
ATOM 6971 N GLY B 187 134.219 182.718 109.875 1.00133.71 N
ATOM 6972 CA GLY B 187 134.137 181.520 109.073 1.00133.71 C
ATOM 6973 C GLY B 187 135.142 180.504 109.564 1.00133.71 C
ATOM 6974 O GLY B 187 135.210 180.201 110.759 1.00133.71 O
ATOM 6975 N LEU B 188 135.941 179.980 108.637 1.00128.29 N
ATOM 6976 CA LEU B 188 136.979 179.031 109.011 1.00128.29 C
ATOM 6977 C LEU B 188 138.127 179.743 109.722 1.00128.29 C
ATOM 6978 O LEU B 188 138.704 179.210 110.683 1.00128.29 O
ATOM 6979 CB LEU B 188 137.450 178.297 107.755 1.00128.29 C
ATOM 6980 N MET B 189 138.455 180.956 109.269 1.00123.61 N
ATOM 6981 CA MET B 189 139.519 181.740 109.890 1.00123.61 C
ATOM 6982 C MET B 189 139.136 182.165 111.300 1.00123.61 C
ATOM 6983 O MET B 189 139.996 182.304 112.177 1.00123.61 O
ATOM 6984 CB MET B 189 139.838 182.958 109.024 1.00123.61 C
ATOM 6985 N LYS B 190 137.839 182.357 111.538 1.00121.53 N
ATOM 6986 CA LYS B 190 137.321 182.615 112.875 1.00121.53 C
ATOM 6987 C LYS B 190 137.580 181.437 113.799 1.00121.53 C
ATOM 6988 O LYS B 190 137.971 181.622 114.956 1.00121.53 O
ATOM 6989 CB LYS B 190 135.825 182.903 112.824 1.00121.53 C
ATOM 6990 N TYR B 191 137.379 180.222 113.290 1.00118.93 N
ATOM 6991 CA TYR B 191 137.610 179.037 114.107 1.00118.93 C
ATOM 6992 C TYR B 191 139.095 178.845 114.386 1.00118.93 C
ATOM 6993 O TYR B 191 139.480 178.423 115.484 1.00118.93 O
ATOM 6994 CB TYR B 191 137.024 177.800 113.431 1.00118.93 C
ATOM 6995 CG TYR B 191 137.168 176.575 114.287 1.00118.93 C
ATOM 6996 CD1 TYR B 191 136.406 176.428 115.436 1.00118.93 C
ATOM 6997 CD2 TYR B 191 138.065 175.572 113.957 1.00118.93 C
ATOM 6998 CE1 TYR B 191 136.533 175.321 116.234 1.00118.93 C
ATOM 6999 CE2 TYR B 191 138.198 174.454 114.750 1.00118.93 C
ATOM 7000 CZ TYR B 191 137.428 174.336 115.887 1.00118.93 C
ATOM 7001 OH TYR B 191 137.549 173.236 116.696 1.00118.93 O
ATOM 7002 N ILE B 192 139.942 179.159 113.398 1.00119.23 N
ATOM 7003 CA ILE B 192 141.388 179.112 113.613 1.00119.23 C
ATOM 7004 C ILE B 192 141.806 180.123 114.675 1.00119.23 C
ATOM 7005 O ILE B 192 142.587 179.797 115.576 1.00119.23 O
ATOM 7006 CB ILE B 192 142.146 179.326 112.289 1.00119.23 C
ATOM 7007 CG1 ILE B 192 141.951 178.132 111.361 1.00119.23 C
ATOM 7008 CG2 ILE B 192 143.629 179.530 112.517 1.00119.23 C
ATOM 7009 CD1 ILE B 192 142.591 178.326 110.007 1.00119.23 C
ATOM 7010 N GLY B 193 141.259 181.341 114.618 1.00114.79 N
ATOM 7011 CA GLY B 193 141.561 182.334 115.642 1.00114.79 C
ATOM 7012 C GLY B 193 141.066 181.934 117.020 1.00114.79 C
ATOM 7013 O GLY B 193 141.722 182.209 118.031 1.00114.79 O
ATOM 7014 N GLU B 194 139.926 181.241 117.074 1.00110.99 N
ATOM 7015 CA GLU B 194 139.407 180.748 118.347 1.00110.99 C
ATOM 7016 C GLU B 194 140.318 179.681 118.946 1.00110.99 C
ATOM 7017 O GLU B 194 140.612 179.712 120.149 1.00110.99 O
ATOM 7018 CB GLU B 194 137.994 180.201 118.157 1.00110.99 C
ATOM 7019 N VAL B 195 140.787 178.742 118.121 1.00108.66 N
ATOM 7020 CA VAL B 195 141.671 177.691 118.627 1.00108.66 C
ATOM 7021 C VAL B 195 143.036 178.272 118.997 1.00108.66 C
ATOM 7022 O VAL B 195 143.684 177.815 119.949 1.00108.66 O
ATOM 7023 CB VAL B 195 141.759 176.543 117.599 1.00108.66 C
ATOM 7024 CG1 VAL B 195 142.716 175.451 118.033 1.00108.66 C
ATOM 7025 CG2 VAL B 195 140.392 175.929 117.401 1.00108.66 C
ATOM 7026 N VAL B 196 143.461 179.331 118.296 1.00108.66 N
ATOM 7027 CA VAL B 196 144.674 180.059 118.673 1.00108.66 C
ATOM 7028 C VAL B 196 144.527 180.682 120.054 1.00108.66 C
ATOM 7029 O VAL B 196 145.419 180.544 120.902 1.00108.66 O
ATOM 7030 CB VAL B 196 145.022 181.115 117.605 1.00108.66 C
ATOM 7031 CG1 VAL B 196 145.998 182.139 118.143 1.00108.66 C
ATOM 7032 CG2 VAL B 196 145.664 180.441 116.420 1.00108.66 C
ATOM 7033 N ARG B 197 143.397 181.352 120.310 1.00106.04 N
ATOM 7034 CA ARG B 197 143.165 181.947 121.626 1.00106.04 C
ATOM 7035 C ARG B 197 143.103 180.884 122.713 1.00106.04 C
ATOM 7036 O ARG B 197 143.655 181.067 123.807 1.00106.04 O
ATOM 7037 CB ARG B 197 141.878 182.768 121.617 1.00106.04 C
ATOM 7038 CG ARG B 197 141.583 183.478 122.929 1.00106.04 C
ATOM 7039 CD ARG B 197 140.324 184.328 122.837 1.00106.04 C
ATOM 7040 NE ARG B 197 139.125 183.533 122.587 1.00106.04 N
ATOM 7041 CZ ARG B 197 138.407 182.941 123.535 1.00106.04 C
ATOM 7042 NH1 ARG B 197 138.763 183.055 124.807 1.00106.04 N
ATOM 7043 NH2 ARG B 197 137.330 182.239 123.213 1.00106.04 N
ATOM 7044 N ASP B 198 142.492 179.738 122.394 1.00102.75 N
ATOM 7045 CA ASP B 198 142.399 178.638 123.345 1.00102.75 C
ATOM 7046 C ASP B 198 143.771 178.066 123.683 1.00102.75 C
ATOM 7047 O ASP B 198 144.062 177.785 124.850 1.00102.75 O
ATOM 7048 CB ASP B 198 141.489 177.547 122.784 1.00102.75 C
ATOM 7049 N ASN B 199 144.639 177.910 122.685 1.00107.09 N
ATOM 7050 CA ASN B 199 145.950 177.335 122.962 1.00107.09 C
ATOM 7051 C ASN B 199 146.891 178.355 123.590 1.00107.09 C
ATOM 7052 O ASN B 199 147.875 177.979 124.237 1.00107.09 O
ATOM 7053 CB ASN B 199 146.549 176.745 121.689 1.00107.09 C
ATOM 7054 CG ASN B 199 145.884 175.440 121.287 1.00107.09 C
ATOM 7055 OD1 ASN B 199 145.596 174.596 122.132 1.00107.09 O
ATOM 7056 ND2 ASN B 199 145.642 175.271 119.996 1.00107.09 N
ATOM 7057 N THR B 200 146.620 179.650 123.414 1.00103.21 N
ATOM 7058 CA THR B 200 147.392 180.640 124.159 1.00103.21 C
ATOM 7059 C THR B 200 147.005 180.648 125.628 1.00103.21 C
ATOM 7060 O THR B 200 147.870 180.792 126.498 1.00103.21 O
ATOM 7061 CB THR B 200 147.231 182.042 123.578 1.00103.21 C
ATOM 7062 OG1 THR B 200 145.842 182.375 123.490 1.00103.21 O
ATOM 7063 CG2 THR B 200 147.909 182.160 122.230 1.00103.21 C
ATOM 7064 N ILE B 201 145.713 180.508 125.936 1.00 96.25 N
ATOM 7065 CA ILE B 201 145.342 180.486 127.350 1.00 96.25 C
ATOM 7066 C ILE B 201 145.594 179.106 127.950 1.00 96.25 C
ATOM 7067 O ILE B 201 145.577 178.936 129.174 1.00 96.25 O
ATOM 7068 CB ILE B 201 143.890 180.970 127.559 1.00 96.25 C
ATOM 7069 CG1 ILE B 201 142.857 180.137 126.798 1.00 96.25 C
ATOM 7070 CG2 ILE B 201 143.764 182.432 127.171 1.00 96.25 C
ATOM 7071 CD1 ILE B 201 142.172 179.054 127.607 1.00 96.25 C
ATOM 7072 N SER B 202 145.834 178.101 127.107 1.00101.02 N
ATOM 7073 CA SER B 202 146.139 176.770 127.619 1.00101.02 C
ATOM 7074 C SER B 202 147.581 176.674 128.106 1.00101.02 C
ATOM 7075 O SER B 202 147.825 176.377 129.281 1.00101.02 O
ATOM 7076 CB SER B 202 145.869 175.724 126.541 1.00101.02 C
ATOM 7077 OG SER B 202 146.209 174.429 126.998 1.00101.02 O
ATOM 7078 N ARG B 203 148.547 176.930 127.223 1.00109.45 N
ATOM 7079 CA ARG B 203 149.965 176.726 127.499 1.00109.45 C
ATOM 7080 C ARG B 203 150.655 178.064 127.708 1.00109.45 C
ATOM 7081 O ARG B 203 150.113 179.113 127.345 1.00109.45 O
ATOM 7082 CB ARG B 203 150.653 175.975 126.354 1.00109.45 C
ATOM 7083 CG ARG B 203 150.295 174.508 126.256 1.00109.45 C
ATOM 7084 CD ARG B 203 151.097 173.826 125.160 1.00109.45 C
ATOM 7085 N SER B 204 151.848 178.024 128.302 1.00115.41 N
ATOM 7086 CA SER B 204 152.660 179.223 128.502 1.00115.41 C
ATOM 7087 C SER B 204 153.786 179.256 127.465 1.00115.41 C
ATOM 7088 O SER B 204 154.942 178.916 127.725 1.00115.41 O
ATOM 7089 CB SER B 204 153.200 179.269 129.924 1.00115.41 C
ATOM 7090 N SER B 205 153.419 179.675 126.256 1.00117.94 N
ATOM 7091 CA SER B 205 154.376 179.861 125.176 1.00117.94 C
ATOM 7092 C SER B 205 153.917 181.031 124.324 1.00117.94 C
ATOM 7093 O SER B 205 152.840 181.593 124.537 1.00117.94 O
ATOM 7094 CB SER B 205 154.530 178.601 124.318 1.00117.94 C
ATOM 7095 N GLU B 206 154.746 181.399 123.355 1.00116.96 N
ATOM 7096 CA GLU B 206 154.481 182.544 122.499 1.00116.96 C
ATOM 7097 C GLU B 206 154.431 182.093 121.049 1.00116.96 C
ATOM 7098 O GLU B 206 155.414 181.557 120.527 1.00116.96 O
ATOM 7099 CB GLU B 206 155.546 183.625 122.686 1.00116.96 C
ATOM 7100 N GLU B 207 153.289 182.308 120.405 1.00114.01 N
ATOM 7101 CA GLU B 207 153.127 182.025 118.989 1.00114.01 C
ATOM 7102 C GLU B 207 152.139 183.017 118.405 1.00114.01 C
ATOM 7103 O GLU B 207 151.283 183.544 119.120 1.00114.01 O
ATOM 7104 CB GLU B 207 152.669 180.581 118.751 1.00114.01 C
ATOM 7105 CG GLU B 207 151.317 180.209 119.313 1.00114.01 C
ATOM 7106 CD GLU B 207 150.219 180.383 118.302 1.00114.01 C
ATOM 7107 OE1 GLU B 207 150.548 180.488 117.103 1.00114.01 O
ATOM 7108 OE2 GLU B 207 149.039 180.410 118.701 1.00114.01 O1-
ATOM 7109 N ASN B 208 152.250 183.260 117.105 1.00108.93 N
ATOM 7110 CA ASN B 208 151.592 184.386 116.463 1.00108.93 C
ATOM 7111 C ASN B 208 150.970 183.979 115.137 1.00108.93 C
ATOM 7112 O ASN B 208 151.286 182.917 114.597 1.00108.93 O
ATOM 7113 CB ASN B 208 152.593 185.516 116.259 1.00108.93 C
ATOM 7114 CG ASN B 208 153.888 185.028 115.650 1.00108.93 C
ATOM 7115 OD1 ASN B 208 154.040 183.841 115.367 1.00108.93 O
ATOM 7116 ND2 ASN B 208 154.828 185.940 115.449 1.00108.93 N
ATOM 7117 N VAL B 209 150.086 184.830 114.627 1.00106.98 N
ATOM 7118 CA VAL B 209 149.390 184.616 113.364 1.00106.98 C
ATOM 7119 C VAL B 209 149.218 185.967 112.677 1.00106.98 C
ATOM 7120 O VAL B 209 148.686 186.923 113.253 1.00106.98 O
ATOM 7121 CB VAL B 209 148.055 183.886 113.561 1.00106.98 C
ATOM 7122 N VAL B 210 149.709 186.071 111.452 1.00106.10 N
ATOM 7123 CA VAL B 210 149.567 187.297 110.683 1.00106.10 C
ATOM 7124 C VAL B 210 148.440 187.115 109.678 1.00106.10 C
ATOM 7125 O VAL B 210 148.550 186.312 108.747 1.00106.10 O
ATOM 7126 CB VAL B 210 150.887 187.650 109.987 1.00106.10 C
ATOM 7127 CG1 VAL B 210 150.724 188.896 109.145 1.00106.10 C
ATOM 7128 CG2 VAL B 210 151.979 187.826 111.017 1.00106.10 C
ATOM 7129 N ALA B 211 147.356 187.865 109.853 1.00113.62 N
ATOM 7130 CA ALA B 211 146.158 187.717 109.034 1.00113.62 C
ATOM 7131 C ALA B 211 146.027 188.898 108.084 1.00113.62 C
ATOM 7132 O ALA B 211 145.433 189.921 108.438 1.00113.62 O
ATOM 7133 CB ALA B 211 144.911 187.601 109.908 1.00113.62 C
ATOM 7134 N ILE B 212 146.556 188.746 106.877 1.00117.96 N
ATOM 7135 CA ILE B 212 146.501 189.796 105.873 1.00117.96 C
ATOM 7136 C ILE B 212 145.110 189.899 105.269 1.00117.96 C
ATOM 7137 O ILE B 212 144.610 188.938 104.691 1.00117.96 O
ATOM 7138 CB ILE B 212 147.552 189.561 104.785 1.00117.96 C
ATOM 7139 CG1 ILE B 212 148.954 189.718 105.367 1.00117.96 C
ATOM 7140 CG2 ILE B 212 147.343 190.502 103.618 1.00117.96 C
ATOM 7141 CD1 ILE B 212 150.050 189.252 104.442 1.00117.96 C
ATOM 7142 N ARG B 247 142.806 202.049 104.728 1.00142.24 N
ATOM 7143 CA ARG B 247 142.541 202.304 103.316 1.00142.24 C
ATOM 7144 C ARG B 247 141.837 201.122 102.663 1.00142.24 C
ATOM 7145 O ARG B 247 141.078 201.298 101.702 1.00142.24 O
ATOM 7146 CB ARG B 247 143.844 202.623 102.584 1.00142.24 C
ATOM 7147 N ASP B 248 142.084 199.917 103.156 1.00140.63 N
ATOM 7148 CA ASP B 248 141.374 198.757 102.645 1.00140.63 C
ATOM 7149 C ASP B 248 139.919 198.801 103.104 1.00140.63 C
ATOM 7150 O ASP B 248 139.652 198.994 104.297 1.00140.63 O
ATOM 7151 CB ASP B 248 142.040 197.466 103.126 1.00140.63 C
ATOM 7152 N PRO B 249 138.961 198.647 102.198 1.00145.90 N
ATOM 7153 CA PRO B 249 137.553 198.621 102.612 1.00145.90 C
ATOM 7154 C PRO B 249 137.184 197.318 103.303 1.00145.90 C
ATOM 7155 O PRO B 249 136.559 196.435 102.707 1.00145.90 O
ATOM 7156 CB PRO B 249 136.797 198.799 101.291 1.00145.90 C
ATOM 7157 CG PRO B 249 137.739 198.287 100.251 1.00145.90 C
ATOM 7158 CD PRO B 249 139.117 198.620 100.734 1.00145.90 C
ATOM 7159 N LEU B 250 137.563 197.196 104.569 1.00144.67 N
ATOM 7160 CA LEU B 250 137.383 195.945 105.285 1.00144.67 C
ATOM 7161 C LEU B 250 135.968 195.825 105.831 1.00144.67 C
ATOM 7162 O LEU B 250 135.251 196.818 105.978 1.00144.67 O
ATOM 7163 CB LEU B 250 138.390 195.841 106.428 1.00144.67 C
ATOM 7164 N TYR B 251 135.575 194.595 106.137 1.00148.13 N
ATOM 7165 CA TYR B 251 134.313 194.295 106.796 1.00148.13 C
ATOM 7166 C TYR B 251 134.536 194.343 108.307 1.00148.13 C
ATOM 7167 O TYR B 251 135.513 194.930 108.778 1.00148.13 O
ATOM 7168 CB TYR B 251 133.787 192.941 106.317 1.00148.13 C
ATOM 7169 CG TYR B 251 133.497 192.912 104.841 1.00148.13 C
ATOM 7170 CD1 TYR B 251 132.344 193.491 104.331 1.00148.13 C
ATOM 7171 CD2 TYR B 251 134.378 192.304 103.956 1.00148.13 C
ATOM 7172 CE1 TYR B 251 132.074 193.471 102.976 1.00148.13 C
ATOM 7173 CE2 TYR B 251 134.118 192.275 102.600 1.00148.13 C
ATOM 7174 CZ TYR B 251 132.964 192.860 102.116 1.00148.13 C
ATOM 7175 OH TYR B 251 132.698 192.833 100.766 1.00148.13 O
ATOM 7176 N CYS B 252 133.614 193.779 109.085 1.00142.30 N
ATOM 7177 CA CYS B 252 133.889 193.523 110.493 1.00142.30 C
ATOM 7178 C CYS B 252 135.020 192.508 110.625 1.00142.30 C
ATOM 7179 O CYS B 252 135.274 191.720 109.715 1.00142.30 O
ATOM 7180 CB CYS B 252 132.632 193.018 111.200 1.00142.30 C
ATOM 7181 SG CYS B 252 131.994 191.451 110.568 1.00142.30 S
ATOM 7182 N LEU B 253 135.718 192.540 111.752 1.00131.86 N
ATOM 7183 CA LEU B 253 136.929 191.750 111.924 1.00131.86 C
ATOM 7184 C LEU B 253 136.719 190.688 112.990 1.00131.86 C
ATOM 7185 O LEU B 253 135.919 190.875 113.913 1.00131.86 O
ATOM 7186 CB LEU B 253 138.122 192.628 112.313 1.00131.86 C
ATOM 7187 CG LEU B 253 138.935 193.370 111.251 1.00131.86 C
ATOM 7188 CD1 LEU B 253 138.188 194.553 110.674 1.00131.86 C
ATOM 7189 CD2 LEU B 253 140.241 193.826 111.864 1.00131.86 C
ATOM 7190 N ASP B 254 137.439 189.579 112.857 1.00125.63 N
ATOM 7191 CA ASP B 254 137.596 188.626 113.945 1.00125.63 C
ATOM 7192 C ASP B 254 138.725 189.133 114.829 1.00125.63 C
ATOM 7193 O ASP B 254 139.899 189.057 114.451 1.00125.63 O
ATOM 7194 CB ASP B 254 137.901 187.227 113.417 1.00125.63 C
ATOM 7195 N ASN B 255 138.371 189.650 116.000 1.00121.25 N
ATOM 7196 CA ASN B 255 139.326 190.360 116.849 1.00121.25 C
ATOM 7197 C ASN B 255 140.039 189.387 117.786 1.00121.25 C
ATOM 7198 O ASN B 255 139.901 189.424 119.006 1.00121.25 O
ATOM 7199 CB ASN B 255 138.617 191.462 117.624 1.00121.25 C
ATOM 7200 N ASN B 256 140.817 188.493 117.178 1.00110.90 N
ATOM 7201 CA ASN B 256 141.531 187.480 117.932 1.00110.90 C
ATOM 7202 C ASN B 256 142.977 187.300 117.494 1.00110.90 C
ATOM 7203 O ASN B 256 143.758 186.701 118.238 1.00110.90 O
ATOM 7204 CB ASN B 256 140.802 186.137 117.817 1.00110.90 C
ATOM 7205 CG ASN B 256 140.933 185.299 119.059 1.00110.90 C
ATOM 7206 OD1 ASN B 256 140.198 184.333 119.239 1.00110.90 O
ATOM 7207 ND2 ASN B 256 141.837 185.686 119.948 1.00110.90 N
ATOM 7208 N HIS B 257 143.347 187.793 116.318 1.00109.22 N
ATOM 7209 CA HIS B 257 144.690 187.627 115.796 1.00109.22 C
ATOM 7210 C HIS B 257 145.675 188.543 116.520 1.00109.22 C
ATOM 7211 O HIS B 257 145.293 189.456 117.252 1.00109.22 O
ATOM 7212 CB HIS B 257 144.705 187.906 114.297 1.00109.22 C
ATOM 7213 CG HIS B 257 143.922 186.915 113.492 1.00109.22 C
ATOM 7214 ND1 HIS B 257 144.401 185.659 113.193 1.00109.22 N
ATOM 7215 CD2 HIS B 257 142.694 186.993 112.930 1.00109.22 C
ATOM 7216 CE1 HIS B 257 143.506 185.008 112.473 1.00109.22 C
ATOM 7217 NE2 HIS B 257 142.459 185.794 112.301 1.00109.22 N
ATOM 7218 N THR B 258 146.963 188.277 116.309 1.00106.75 N
ATOM 7219 CA THR B 258 148.031 189.048 116.934 1.00106.75 C
ATOM 7220 C THR B 258 148.518 190.184 116.040 1.00106.75 C
ATOM 7221 O THR B 258 148.813 191.278 116.529 1.00106.75 O
ATOM 7222 CB THR B 258 149.189 188.116 117.304 1.00106.75 C
ATOM 7223 OG1 THR B 258 148.703 187.095 118.180 1.00106.75 O
ATOM 7224 CG2 THR B 258 150.300 188.855 118.024 1.00106.75 C
ATOM 7225 N HIS B 259 148.581 189.967 114.731 1.00109.10 N
ATOM 7226 CA HIS B 259 148.956 191.018 113.791 1.00109.10 C
ATOM 7227 C HIS B 259 148.070 190.875 112.568 1.00109.10 C
ATOM 7228 O HIS B 259 147.822 189.756 112.115 1.00109.10 O
ATOM 7229 CB HIS B 259 150.427 190.925 113.403 1.00109.10 C
ATOM 7230 CG HIS B 259 151.362 191.088 114.556 1.00109.10 C
ATOM 7231 ND1 HIS B 259 151.638 192.312 115.121 1.00109.10 N
ATOM 7232 CD2 HIS B 259 152.073 190.177 115.259 1.00109.10 C
ATOM 7233 CE1 HIS B 259 152.488 192.151 116.119 1.00109.10 C
ATOM 7234 NE2 HIS B 259 152.767 190.864 116.225 1.00109.10 N
ATOM 7235 N LEU B 260 147.578 191.990 112.045 1.00114.81 N
ATOM 7236 CA LEU B 260 146.765 191.977 110.833 1.00114.81 C
ATOM 7237 C LEU B 260 147.101 193.219 110.015 1.00114.81 C
ATOM 7238 O LEU B 260 147.111 194.340 110.525 1.00114.81 O
ATOM 7239 CB LEU B 260 145.280 191.861 111.191 1.00114.81 C
ATOM 7240 CG LEU B 260 144.588 192.862 112.112 1.00114.81 C
ATOM 7241 CD1 LEU B 260 143.943 193.989 111.322 1.00114.81 C
ATOM 7242 CD2 LEU B 260 143.566 192.149 112.980 1.00114.81 C
ATOM 7243 N LEU B 261 147.425 193.001 108.745 1.00122.61 N
ATOM 7244 CA LEU B 261 147.921 194.050 107.856 1.00122.61 C
ATOM 7245 C LEU B 261 147.071 194.039 106.590 1.00122.61 C
ATOM 7246 O LEU B 261 147.035 193.052 105.857 1.00122.61 O
ATOM 7247 CB LEU B 261 149.395 193.840 107.533 1.00122.61 C
ATOM 7248 CG LEU B 261 150.471 194.272 108.532 1.00122.61 C
ATOM 7249 CD1 LEU B 261 150.607 193.323 109.718 1.00122.61 C
ATOM 7250 CD2 LEU B 261 151.801 194.418 107.818 1.00122.61 C
ATOM 7251 N LEU B 262 146.391 195.150 106.322 1.00129.41 N
ATOM 7252 CA LEU B 262 145.548 195.278 105.141 1.00129.41 C
ATOM 7253 C LEU B 262 146.038 196.417 104.262 1.00129.41 C
ATOM 7254 O LEU B 262 146.638 197.378 104.756 1.00129.41 O
ATOM 7255 CB LEU B 262 144.088 195.491 105.529 1.00129.41 C
ATOM 7256 CG LEU B 262 143.442 194.248 106.134 1.00129.41 C
ATOM 7257 CD1 LEU B 262 142.049 194.565 106.636 1.00129.41 C
ATOM 7258 CD2 LEU B 262 143.404 193.132 105.099 1.00129.41 C
ATOM 7259 N VAL B 263 145.783 196.299 102.964 1.00131.01 N
ATOM 7260 CA VAL B 263 146.241 197.279 101.989 1.00131.01 C
ATOM 7261 C VAL B 263 145.076 198.113 101.473 1.00131.01 C
ATOM 7262 O VAL B 263 144.798 198.138 100.273 1.00131.01 O
ATOM 7263 CB VAL B 263 146.969 196.595 100.822 1.00131.01 C
ATOM 7264 N ILE B 273 140.251 193.337 94.978 1.00140.28 N
ATOM 7265 CA ILE B 273 140.481 192.233 95.896 1.00140.28 C
ATOM 7266 C ILE B 273 141.599 191.350 95.371 1.00140.28 C
ATOM 7267 O ILE B 273 141.418 190.149 95.188 1.00140.28 O
ATOM 7268 CB ILE B 273 139.201 191.415 96.120 1.00140.28 C
ATOM 7269 N GLU B 274 142.758 191.953 95.128 1.00144.47 N
ATOM 7270 CA GLU B 274 143.937 191.239 94.657 1.00144.47 C
ATOM 7271 C GLU B 274 144.911 191.078 95.812 1.00144.47 C
ATOM 7272 O GLU B 274 145.142 192.033 96.562 1.00144.47 O
ATOM 7273 CB GLU B 274 144.605 191.986 93.501 1.00144.47 C
ATOM 7274 N ALA B 275 145.444 189.860 95.978 1.00140.89 N
ATOM 7275 CA ALA B 275 146.394 189.609 97.059 1.00140.89 C
ATOM 7276 C ALA B 275 147.680 190.400 96.866 1.00140.89 C
ATOM 7277 O ALA B 275 147.977 191.309 97.651 1.00140.89 O
ATOM 7278 CB ALA B 275 146.693 188.113 97.148 1.00140.89 C
ATOM 7279 N LYS B 276 148.476 190.042 95.855 1.00140.90 N
ATOM 7280 CA LYS B 276 149.524 190.862 95.239 1.00140.90 C
ATOM 7281 C LYS B 276 150.695 191.262 96.138 1.00140.90 C
ATOM 7282 O LYS B 276 151.654 191.872 95.658 1.00140.90 O
ATOM 7283 CB LYS B 276 148.904 192.130 94.641 1.00140.90 C
ATOM 7284 N VAL B 277 150.632 190.950 97.430 1.00134.46 N
ATOM 7285 CA VAL B 277 151.763 191.071 98.341 1.00134.46 C
ATOM 7286 C VAL B 277 151.946 189.800 99.155 1.00134.46 C
ATOM 7287 O VAL B 277 153.028 189.549 99.687 1.00134.46 O
ATOM 7288 CB VAL B 277 151.608 192.297 99.268 1.00134.46 C
ATOM 7289 CG1 VAL B 277 151.748 193.599 98.499 1.00134.46 C
ATOM 7290 CG2 VAL B 277 150.273 192.254 99.990 1.00134.46 C
ATOM 7291 N ARG B 278 150.875 189.011 99.257 1.00130.43 N
ATOM 7292 CA ARG B 278 150.821 187.723 99.933 1.00130.43 C
ATOM 7293 C ARG B 278 151.829 186.784 99.290 1.00130.43 C
ATOM 7294 O ARG B 278 152.799 186.343 99.923 1.00130.43 O
ATOM 7295 CB ARG B 278 149.400 187.167 99.812 1.00130.43 C
ATOM 7296 CG ARG B 278 149.016 185.990 100.685 1.00130.43 C
ATOM 7297 CD ARG B 278 147.573 185.626 100.354 1.00130.43 C
ATOM 7298 NE ARG B 278 147.001 184.576 101.190 1.00130.43 N
ATOM 7299 CZ ARG B 278 146.299 184.816 102.292 1.00130.43 C
ATOM 7300 NH1 ARG B 278 146.087 186.063 102.678 1.00130.43 N1+
ATOM 7301 NH2 ARG B 278 145.795 183.818 103.001 1.00130.43 N
ATOM 7302 N THR B 279 151.605 186.520 98.006 1.00131.97 N
ATOM 7303 CA THR B 279 152.488 185.721 97.172 1.00131.97 C
ATOM 7304 C THR B 279 153.874 186.340 97.066 1.00131.97 C
ATOM 7305 O THR B 279 154.872 185.616 97.001 1.00131.97 O
ATOM 7306 CB THR B 279 151.878 185.564 95.786 1.00131.97 C
ATOM 7307 OG1 THR B 279 151.729 186.856 95.187 1.00131.97 O
ATOM 7308 CG2 THR B 279 150.517 184.904 95.888 1.00131.97 C
ATOM 7309 N GLN B 280 153.947 187.673 97.058 1.00132.45 N
ATOM 7310 CA GLN B 280 155.240 188.342 96.965 1.00132.45 C
ATOM 7311 C GLN B 280 156.061 188.146 98.234 1.00132.45 C
ATOM 7312 O GLN B 280 157.269 187.887 98.165 1.00132.45 O
ATOM 7313 CB GLN B 280 155.041 189.828 96.675 1.00132.45 C
ATOM 7314 CG GLN B 280 154.402 190.103 95.329 1.00132.45 C
ATOM 7315 CD GLN B 280 155.292 189.709 94.174 1.00132.45 C
ATOM 7316 OE1 GLN B 280 156.506 189.896 94.221 1.00132.45 O
ATOM 7317 NE2 GLN B 280 154.693 189.158 93.126 1.00132.45 N
ATOM 7318 N LEU B 281 155.417 188.243 99.399 1.00129.02 N
ATOM 7319 CA LEU B 281 156.091 187.948 100.659 1.00129.02 C
ATOM 7320 C LEU B 281 156.524 186.491 100.744 1.00129.02 C
ATOM 7321 O LEU B 281 157.634 186.202 101.216 1.00129.02 O
ATOM 7322 CB LEU B 281 155.175 188.283 101.835 1.00129.02 C
ATOM 7323 CG LEU B 281 155.736 188.052 103.237 1.00129.02 C
ATOM 7324 CD1 LEU B 281 156.918 188.967 103.491 1.00129.02 C
ATOM 7325 CD2 LEU B 281 154.660 188.250 104.287 1.00129.02 C
ATOM 7326 N GLU B 282 155.677 185.572 100.272 1.00131.26 N
ATOM 7327 CA GLU B 282 156.037 184.160 100.282 1.00131.26 C
ATOM 7328 C GLU B 282 157.202 183.862 99.343 1.00131.26 C
ATOM 7329 O GLU B 282 158.067 183.041 99.666 1.00131.26 O
ATOM 7330 CB GLU B 282 154.818 183.322 99.917 1.00131.26 C
ATOM 7331 CG GLU B 282 153.715 183.422 100.946 1.00131.26 C
ATOM 7332 CD GLU B 282 154.163 182.999 102.326 1.00131.26 C
ATOM 7333 OE1 GLU B 282 154.917 182.012 102.436 1.00131.26 O
ATOM 7334 OE2 GLU B 282 153.750 183.650 103.304 1.00131.26 O1-
ATOM 7335 N LYS B 283 157.258 184.537 98.192 1.00130.27 N
ATOM 7336 CA LYS B 283 158.386 184.350 97.285 1.00130.27 C
ATOM 7337 C LYS B 283 159.645 185.014 97.826 1.00130.27 C
ATOM 7338 O LYS B 283 160.762 184.599 97.496 1.00130.27 O
ATOM 7339 CB LYS B 283 158.044 184.890 95.898 1.00130.27 C
ATOM 7340 N TYR B 284 159.488 186.053 98.653 1.00130.94 N
ATOM 7341 CA TYR B 284 160.654 186.643 99.307 1.00130.94 C
ATOM 7342 C TYR B 284 161.241 185.704 100.347 1.00130.94 C
ATOM 7343 O TYR B 284 162.461 185.516 100.404 1.00130.94 O
ATOM 7344 CB TYR B 284 160.301 187.973 99.963 1.00130.94 C
ATOM 7345 CG TYR B 284 161.462 188.552 100.744 1.00130.94 C
ATOM 7346 CD1 TYR B 284 162.568 189.077 100.092 1.00130.94 C
ATOM 7347 CD2 TYR B 284 161.452 188.571 102.135 1.00130.94 C
ATOM 7348 CE1 TYR B 284 163.634 189.601 100.799 1.00130.94 C
ATOM 7349 CE2 TYR B 284 162.514 189.094 102.851 1.00130.94 C
ATOM 7350 CZ TYR B 284 163.599 189.609 102.177 1.00130.94 C
ATOM 7351 OH TYR B 284 164.653 190.132 102.887 1.00130.94 O
ATOM 7352 N ILE B 285 160.391 185.114 101.185 1.00127.42 N
ATOM 7353 CA ILE B 285 160.896 184.224 102.229 1.00127.42 C
ATOM 7354 C ILE B 285 161.335 182.892 101.620 1.00127.42 C
ATOM 7355 O ILE B 285 162.136 182.152 102.205 1.00127.42 O
ATOM 7356 CB ILE B 285 159.833 184.058 103.331 1.00127.42 C
ATOM 7357 CG1 ILE B 285 159.400 185.432 103.819 1.00127.42 C
ATOM 7358 CG2 ILE B 285 160.407 183.404 104.560 1.00127.42 C
ATOM 7359 CD1 ILE B 285 158.175 185.402 104.683 1.00127.42 C
ATOM 7360 N SER B 286 160.849 182.587 100.409 1.00131.69 N
ATOM 7361 CA SER B 286 161.412 181.491 99.624 1.00131.69 C
ATOM 7362 C SER B 286 162.884 181.728 99.310 1.00131.69 C
ATOM 7363 O SER B 286 163.679 180.782 99.280 1.00131.69 O
ATOM 7364 CB SER B 286 160.623 181.315 98.328 1.00131.69 C
ATOM 7365 OG SER B 286 159.281 180.948 98.583 1.00131.69 O
ATOM 7366 N GLU B 287 163.263 182.980 99.076 1.00131.07 N
ATOM 7367 CA GLU B 287 164.643 183.338 98.788 1.00131.07 C
ATOM 7368 C GLU B 287 165.419 183.763 100.029 1.00131.07 C
ATOM 7369 O GLU B 287 166.507 184.336 99.899 1.00131.07 O
ATOM 7370 CB GLU B 287 164.685 184.450 97.738 1.00131.07 C
ATOM 7371 N ARG B 288 164.896 183.502 101.221 1.00134.98 N
ATOM 7372 CA ARG B 288 165.565 183.916 102.441 1.00134.98 C
ATOM 7373 C ARG B 288 166.732 182.981 102.747 1.00134.98 C
ATOM 7374 O ARG B 288 166.676 181.776 102.494 1.00134.98 O
ATOM 7375 CB ARG B 288 164.566 183.936 103.600 1.00134.98 C
ATOM 7376 CG ARG B 288 165.102 184.454 104.925 1.00134.98 C
ATOM 7377 CD ARG B 288 165.443 185.925 104.842 1.00134.98 C
ATOM 7378 NE ARG B 288 165.914 186.436 106.124 1.00134.98 N
ATOM 7379 CZ ARG B 288 166.431 187.646 106.297 1.00134.98 C
ATOM 7380 NH1 ARG B 288 166.543 188.471 105.265 1.00134.98 N1+
ATOM 7381 NH2 ARG B 288 166.836 188.032 107.499 1.00134.98 N
ATOM 7382 N VAL B 289 167.806 183.552 103.288 1.00138.91 N
ATOM 7383 CA VAL B 289 168.988 182.796 103.686 1.00138.91 C
ATOM 7384 C VAL B 289 169.094 182.818 105.210 1.00138.91 C
ATOM 7385 O VAL B 289 168.800 183.835 105.848 1.00138.91 O
ATOM 7386 CB VAL B 289 170.263 183.337 102.997 1.00138.91 C
ATOM 7387 CG1 VAL B 289 170.541 184.797 103.348 1.00138.91 C
ATOM 7388 CG2 VAL B 289 171.475 182.462 103.302 1.00138.91 C
ATOM 7389 N ILE B 290 169.427 181.665 105.793 1.00143.82 N
ATOM 7390 CA ILE B 290 169.701 181.545 107.216 1.00143.82 C
ATOM 7391 C ILE B 290 170.988 180.743 107.364 1.00143.82 C
ATOM 7392 O ILE B 290 171.130 179.689 106.738 1.00143.82 O
ATOM 7393 CB ILE B 290 168.555 180.872 107.993 1.00143.82 C
ATOM 7394 CG1 ILE B 290 167.333 181.785 108.047 1.00143.82 C
ATOM 7395 CG2 ILE B 290 168.974 180.484 109.410 1.00143.82 C
ATOM 7396 CD1 ILE B 290 166.146 181.148 108.694 1.00143.82 C
ATOM 7397 N PRO B 291 171.968 181.210 108.149 1.00144.90 N
ATOM 7398 CA PRO B 291 173.220 180.447 108.290 1.00144.90 C
ATOM 7399 C PRO B 291 173.067 179.126 109.031 1.00144.90 C
ATOM 7400 O PRO B 291 173.510 178.089 108.522 1.00144.90 O
ATOM 7401 CB PRO B 291 174.134 181.425 109.041 1.00144.90 C
ATOM 7402 CG PRO B 291 173.202 182.352 109.755 1.00144.90 C
ATOM 7403 CD PRO B 291 172.010 182.496 108.868 1.00144.90 C
ATOM 7404 N GLU B 292 172.454 179.121 110.214 1.00141.32 N
ATOM 7405 CA GLU B 292 172.277 177.884 110.974 1.00141.32 C
ATOM 7406 C GLU B 292 170.880 177.319 110.714 1.00141.32 C
ATOM 7407 O GLU B 292 170.012 177.269 111.587 1.00141.32 O
ATOM 7408 CB GLU B 292 172.519 178.131 112.457 1.00141.32 C
ATOM 7409 N SER B 293 170.681 176.875 109.476 1.00137.20 N
ATOM 7410 CA SER B 293 169.404 176.334 109.030 1.00137.20 C
ATOM 7411 C SER B 293 169.552 174.849 108.741 1.00137.20 C
ATOM 7412 O SER B 293 170.400 174.450 107.936 1.00137.20 O
ATOM 7413 CB SER B 293 168.903 177.067 107.782 1.00137.20 C
ATOM 7414 N ASN B 294 168.724 174.037 109.392 1.00128.99 N
ATOM 7415 CA ASN B 294 168.712 172.598 109.173 1.00128.99 C
ATOM 7416 C ASN B 294 168.036 172.214 107.870 1.00128.99 C
ATOM 7417 O ASN B 294 168.205 171.082 107.408 1.00128.99 O
ATOM 7418 CB ASN B 294 168.012 171.892 110.339 1.00128.99 C
ATOM 7419 N TYR B 295 167.287 173.129 107.263 1.00126.32 N
ATOM 7420 CA TYR B 295 166.588 172.880 106.015 1.00126.32 C
ATOM 7421 C TYR B 295 167.487 173.099 104.805 1.00126.32 C
ATOM 7422 O TYR B 295 167.158 172.648 103.704 1.00126.32 O
ATOM 7423 CB TYR B 295 165.349 173.776 105.945 1.00126.32 C
ATOM 7424 CG TYR B 295 164.473 173.547 104.746 1.00126.32 C
ATOM 7425 CD1 TYR B 295 163.673 172.423 104.660 1.00126.32 C
ATOM 7426 CD2 TYR B 295 164.454 174.453 103.699 1.00126.32 C
ATOM 7427 CE1 TYR B 295 162.875 172.205 103.565 1.00126.32 C
ATOM 7428 CE2 TYR B 295 163.656 174.248 102.596 1.00126.32 C
ATOM 7429 CZ TYR B 295 162.866 173.121 102.535 1.00126.32 C
ATOM 7430 OH TYR B 295 162.064 172.905 101.440 1.00126.32 O
ATOM 7431 N GLY B 296 168.635 173.738 104.995 1.00132.07 N
ATOM 7432 CA GLY B 296 169.557 173.972 103.908 1.00132.07 C
ATOM 7433 C GLY B 296 169.786 175.422 103.560 1.00132.07 C
ATOM 7434 O GLY B 296 170.221 175.709 102.439 1.00132.07 O
ATOM 7435 N GLY B 297 169.498 176.347 104.470 1.00132.29 N
ATOM 7436 CA GLY B 297 169.708 177.751 104.189 1.00132.29 C
ATOM 7437 C GLY B 297 168.437 178.422 103.721 1.00132.29 C
ATOM 7438 O GLY B 297 168.469 179.517 103.154 1.00132.29 O
ATOM 7439 N LYS B 298 167.307 177.757 103.937 1.00126.85 N
ATOM 7440 CA LYS B 298 166.002 178.272 103.557 1.00126.85 C
ATOM 7441 C LYS B 298 165.027 178.047 104.702 1.00126.85 C
ATOM 7442 O LYS B 298 165.403 177.598 105.787 1.00126.85 O
ATOM 7443 CB LYS B 298 165.482 177.603 102.280 1.00126.85 C
ATOM 7444 CG LYS B 298 166.269 177.950 101.033 1.00126.85 C
ATOM 7445 CD LYS B 298 165.687 177.270 99.810 1.00126.85 C
ATOM 7446 CE LYS B 298 166.484 177.619 98.562 1.00126.85 C
ATOM 7447 NZ LYS B 298 165.917 176.997 97.334 1.00126.85 N
ATOM 7448 N ILE B 299 163.769 178.392 104.461 1.00117.09 N
ATOM 7449 CA ILE B 299 162.691 178.187 105.424 1.00117.09 C
ATOM 7450 C ILE B 299 161.603 177.363 104.745 1.00117.09 C
ATOM 7451 O ILE B 299 161.228 177.679 103.606 1.00117.09 O
ATOM 7452 CB ILE B 299 162.135 179.521 105.937 1.00117.09 C
ATOM 7453 CG1 ILE B 299 163.201 180.259 106.730 1.00117.09 C
ATOM 7454 CG2 ILE B 299 160.927 179.310 106.818 1.00117.09 C
ATOM 7455 CD1 ILE B 299 162.826 181.665 107.077 1.00117.09 C
ATOM 7456 N PRO B 300 161.097 176.307 105.379 1.00115.62 N
ATOM 7457 CA PRO B 300 159.974 175.558 104.811 1.00115.62 C
ATOM 7458 C PRO B 300 158.696 176.382 104.737 1.00115.62 C
ATOM 7459 O PRO B 300 158.371 177.149 105.643 1.00115.62 O
ATOM 7460 CB PRO B 300 159.820 174.382 105.777 1.00115.62 C
ATOM 7461 CG PRO B 300 160.476 174.825 107.037 1.00115.62 C
ATOM 7462 CD PRO B 300 161.614 175.680 106.602 1.00115.62 C
ATOM 7463 N ILE B 301 157.973 176.213 103.632 1.00117.59 N
ATOM 7464 CA ILE B 301 156.746 176.947 103.347 1.00117.59 C
ATOM 7465 C ILE B 301 155.703 175.946 102.872 1.00117.59 C
ATOM 7466 O ILE B 301 155.917 175.254 101.872 1.00117.59 O
ATOM 7467 CB ILE B 301 156.961 178.027 102.270 1.00117.59 C
ATOM 7468 CG1 ILE B 301 157.982 179.072 102.723 1.00117.59 C
ATOM 7469 CG2 ILE B 301 155.649 178.684 101.916 1.00117.59 C
ATOM 7470 CD1 ILE B 301 158.448 179.980 101.625 1.00117.59 C
ATOM 7471 N VAL B 302 154.575 175.872 103.572 1.00111.91 N
ATOM 7472 CA VAL B 302 153.543 174.887 103.277 1.00111.91 C
ATOM 7473 C VAL B 302 152.232 175.599 102.980 1.00111.91 C
ATOM 7474 O VAL B 302 151.676 176.280 103.848 1.00111.91 O
ATOM 7475 CB VAL B 302 153.355 173.895 104.440 1.00111.91 C
ATOM 7476 CG1 VAL B 302 152.209 172.956 104.138 1.00111.91 C
ATOM 7477 CG2 VAL B 302 154.626 173.119 104.689 1.00111.91 C
ATOM 7478 N CYS B 303 151.728 175.421 101.760 1.00115.18 N
ATOM 7479 CA CYS B 303 150.432 175.949 101.349 1.00115.18 C
ATOM 7480 C CYS B 303 149.360 174.921 101.663 1.00115.18 C
ATOM 7481 O CYS B 303 149.592 173.718 101.527 1.00115.18 O
ATOM 7482 CB CYS B 303 150.410 176.279 99.860 1.00115.18 C
ATOM 7483 SG CYS B 303 151.520 177.610 99.402 1.00115.18 S
ATOM 7484 N PHE B 304 148.191 175.394 102.071 1.00110.01 N
ATOM 7485 CA PHE B 304 147.157 174.536 102.622 1.00110.01 C
ATOM 7486 C PHE B 304 145.843 174.828 101.909 1.00110.01 C
ATOM 7487 O PHE B 304 145.536 175.990 101.626 1.00110.01 O
ATOM 7488 CB PHE B 304 147.028 174.788 104.119 1.00110.01 C
ATOM 7489 CG PHE B 304 146.363 173.690 104.866 1.00110.01 C
ATOM 7490 CD1 PHE B 304 147.095 172.595 105.286 1.00110.01 C
ATOM 7491 CD2 PHE B 304 145.011 173.739 105.145 1.00110.01 C
ATOM 7492 CE1 PHE B 304 146.499 171.574 105.984 1.00110.01 C
ATOM 7493 CE2 PHE B 304 144.401 172.715 105.841 1.00110.01 C
ATOM 7494 CZ PHE B 304 145.148 171.631 106.263 1.00110.01 C
ATOM 7495 N ALA B 305 145.068 173.780 101.608 1.00116.52 N
ATOM 7496 CA ALA B 305 143.817 173.932 100.867 1.00116.52 C
ATOM 7497 C ALA B 305 142.707 173.160 101.580 1.00116.52 C
ATOM 7498 O ALA B 305 142.705 171.929 101.622 1.00116.52 O
ATOM 7499 CB ALA B 305 143.976 173.471 99.421 1.00116.52 C
ATOM 7500 N GLN B 306 141.753 173.898 102.135 1.00118.98 N
ATOM 7501 CA GLN B 306 140.595 173.296 102.779 1.00118.98 C
ATOM 7502 C GLN B 306 139.374 174.202 102.672 1.00118.98 C
ATOM 7503 O GLN B 306 138.256 173.733 102.464 1.00118.98 O
ATOM 7504 CB GLN B 306 140.896 172.990 104.245 1.00118.98 C
ATOM 7505 N GLY B 309 138.200 177.778 95.556 1.00154.32 N
ATOM 7506 CA GLY B 309 137.829 179.058 94.985 1.00154.32 C
ATOM 7507 C GLY B 309 138.691 179.472 93.810 1.00154.32 C
ATOM 7508 O GLY B 309 139.708 178.841 93.516 1.00154.32 O
ATOM 7509 N LYS B 310 138.266 180.539 93.131 1.00157.96 N
ATOM 7510 CA LYS B 310 139.019 181.050 91.990 1.00157.96 C
ATOM 7511 C LYS B 310 140.323 181.695 92.435 1.00157.96 C
ATOM 7512 O LYS B 310 141.385 181.431 91.858 1.00157.96 O
ATOM 7513 CB LYS B 310 138.162 182.048 91.213 1.00157.96 C
ATOM 7514 CG LYS B 310 138.841 182.662 90.008 1.00157.96 C
ATOM 7515 CD LYS B 310 137.870 183.540 89.250 1.00157.96 C
ATOM 7516 CE LYS B 310 137.573 184.808 90.025 1.00157.96 C
ATOM 7517 NZ LYS B 310 136.702 185.733 89.258 1.00157.96 N
ATOM 7518 N GLU B 311 140.262 182.539 93.468 1.00156.81 N
ATOM 7519 CA GLU B 311 141.479 183.111 94.033 1.00156.81 C
ATOM 7520 C GLU B 311 142.310 182.040 94.725 1.00156.81 C
ATOM 7521 O GLU B 311 143.541 182.145 94.786 1.00156.81 O
ATOM 7522 CB GLU B 311 141.132 184.235 95.008 1.00156.81 C
ATOM 7523 N THR B 312 141.653 180.994 95.239 1.00154.00 N
ATOM 7524 CA THR B 312 142.370 179.853 95.797 1.00154.00 C
ATOM 7525 C THR B 312 143.186 179.142 94.729 1.00154.00 C
ATOM 7526 O THR B 312 144.364 178.836 94.941 1.00154.00 O
ATOM 7527 CB THR B 312 141.388 178.877 96.448 1.00154.00 C
ATOM 7528 N LEU B 313 142.585 178.898 93.563 1.00153.14 N
ATOM 7529 CA LEU B 313 143.318 178.268 92.471 1.00153.14 C
ATOM 7530 C LEU B 313 144.394 179.193 91.915 1.00153.14 C
ATOM 7531 O LEU B 313 145.449 178.727 91.468 1.00153.14 O
ATOM 7532 CB LEU B 313 142.340 177.828 91.378 1.00153.14 C
ATOM 7533 CG LEU B 313 142.873 177.059 90.165 1.00153.14 C
ATOM 7534 CD1 LEU B 313 141.908 175.971 89.781 1.00153.14 C
ATOM 7535 CD2 LEU B 313 143.048 177.987 88.977 1.00153.14 C
ATOM 7536 N LYS B 314 144.143 180.507 91.934 1.00151.42 N
ATOM 7537 CA LYS B 314 145.163 181.465 91.515 1.00151.42 C
ATOM 7538 C LYS B 314 146.370 181.423 92.444 1.00151.42 C
ATOM 7539 O LYS B 314 147.521 181.417 91.984 1.00151.42 O
ATOM 7540 CB LYS B 314 144.567 182.871 91.467 1.00151.42 C
ATOM 7541 N SER B 315 146.121 181.352 93.754 1.00148.54 N
ATOM 7542 CA SER B 315 147.207 181.239 94.722 1.00148.54 C
ATOM 7543 C SER B 315 147.925 179.902 94.596 1.00148.54 C
ATOM 7544 O SER B 315 149.141 179.829 94.792 1.00148.54 O
ATOM 7545 CB SER B 315 146.664 181.428 96.136 1.00148.54 C
ATOM 7546 OG SER B 315 147.690 181.287 97.100 1.00148.54 O
ATOM 7547 N ILE B 316 147.188 178.839 94.250 1.00142.81 N
ATOM 7548 CA ILE B 316 147.795 177.528 94.003 1.00142.81 C
ATOM 7549 C ILE B 316 148.754 177.594 92.819 1.00142.81 C
ATOM 7550 O ILE B 316 149.895 177.120 92.895 1.00142.81 O
ATOM 7551 CB ILE B 316 146.700 176.464 93.797 1.00142.81 C
ATOM 7552 CG1 ILE B 316 146.067 176.088 95.139 1.00142.81 C
ATOM 7553 CG2 ILE B 316 147.224 175.238 93.063 1.00142.81 C
ATOM 7554 CD1 ILE B 316 144.822 175.252 95.012 1.00142.81 C
ATOM 7555 N ASN B 317 148.307 178.213 91.720 1.00139.11 N
ATOM 7556 CA ASN B 317 149.139 178.328 90.525 1.00139.11 C
ATOM 7557 C ASN B 317 150.374 179.185 90.774 1.00139.11 C
ATOM 7558 O ASN B 317 151.475 178.841 90.327 1.00139.11 O
ATOM 7559 CB ASN B 317 148.320 178.906 89.371 1.00139.11 C
ATOM 7560 N VAL B 318 150.220 180.280 91.524 1.00138.64 N
ATOM 7561 CA VAL B 318 151.361 181.153 91.796 1.00138.64 C
ATOM 7562 C VAL B 318 152.333 180.487 92.768 1.00138.64 C
ATOM 7563 O VAL B 318 153.558 180.590 92.615 1.00138.64 O
ATOM 7564 CB VAL B 318 150.867 182.522 92.305 1.00138.64 C
ATOM 7565 CG1 VAL B 318 152.020 183.399 92.750 1.00138.64 C
ATOM 7566 CG2 VAL B 318 150.107 183.234 91.202 1.00138.64 C
ATOM 7567 N ALA B 319 151.809 179.753 93.753 1.00136.17 N
ATOM 7568 CA ALA B 319 152.667 179.132 94.754 1.00136.17 C
ATOM 7569 C ALA B 319 153.460 177.970 94.172 1.00136.17 C
ATOM 7570 O ALA B 319 154.660 177.837 94.437 1.00136.17 O
ATOM 7571 CB ALA B 319 151.822 178.664 95.934 1.00136.17 C
ATOM 7572 N ILE B 320 152.810 177.121 93.371 1.00134.82 N
ATOM 7573 CA ILE B 320 153.532 176.034 92.716 1.00134.82 C
ATOM 7574 C ILE B 320 154.459 176.597 91.644 1.00134.82 C
ATOM 7575 O ILE B 320 155.531 176.041 91.369 1.00134.82 O
ATOM 7576 CB ILE B 320 152.529 175.003 92.164 1.00134.82 C
ATOM 7577 CG1 ILE B 320 151.716 174.424 93.317 1.00134.82 C
ATOM 7578 CG2 ILE B 320 153.215 173.843 91.468 1.00134.82 C
ATOM 7579 CD1 ILE B 320 150.568 173.570 92.875 1.00134.82 C
ATOM 7580 N LYS B 321 154.090 177.749 91.070 1.00135.88 N
ATOM 7581 CA LYS B 321 154.971 178.455 90.147 1.00135.88 C
ATOM 7582 C LYS B 321 156.249 178.917 90.837 1.00135.88 C
ATOM 7583 O LYS B 321 157.318 178.965 90.217 1.00135.88 O
ATOM 7584 CB LYS B 321 154.220 179.641 89.538 1.00135.88 C
ATOM 7585 CG LYS B 321 154.967 180.416 88.473 1.00135.88 C
ATOM 7586 CD LYS B 321 154.082 181.502 87.900 1.00135.88 C
ATOM 7587 CE LYS B 321 154.805 182.310 86.845 1.00135.88 C
ATOM 7588 NZ LYS B 321 153.927 183.369 86.278 1.00135.88 N
ATOM 7589 N SER B 322 156.171 179.232 92.126 1.00134.09 N
ATOM 7590 CA SER B 322 157.357 179.616 92.876 1.00134.09 C
ATOM 7591 C SER B 322 157.995 178.448 93.627 1.00134.09 C
ATOM 7592 O SER B 322 158.775 178.702 94.554 1.00134.09 O
ATOM 7593 CB SER B 322 157.020 180.748 93.849 1.00134.09 C
ATOM 7594 OG SER B 322 158.169 181.151 94.575 1.00134.09 O
ATOM 7595 N LYS B 323 157.675 177.210 93.235 1.00131.83 N
ATOM 7596 CA LYS B 323 158.262 175.970 93.762 1.00131.83 C
ATOM 7597 C LYS B 323 158.052 175.838 95.275 1.00131.83 C
ATOM 7598 O LYS B 323 158.986 175.841 96.075 1.00131.83 O
ATOM 7599 CB LYS B 323 159.747 175.861 93.395 1.00131.83 C
ATOM 7600 N ILE B 324 156.779 175.735 95.643 1.00129.27 N
ATOM 7601 CA ILE B 324 156.370 175.540 97.031 1.00129.27 C
ATOM 7602 C ILE B 324 155.427 174.342 97.088 1.00129.27 C
ATOM 7603 O ILE B 324 154.499 174.254 96.272 1.00129.27 O
ATOM 7604 CB ILE B 324 155.718 176.814 97.596 1.00129.27 C
ATOM 7605 CG1 ILE B 324 156.760 177.919 97.774 1.00129.27 C
ATOM 7606 CG2 ILE B 324 155.006 176.551 98.906 1.00129.27 C
ATOM 7607 CD1 ILE B 324 156.168 179.259 98.136 1.00129.27 C
ATOM 7608 N PRO B 325 155.635 173.394 98.002 1.00124.94 N
ATOM 7609 CA PRO B 325 154.718 172.252 98.108 1.00124.94 C
ATOM 7610 C PRO B 325 153.354 172.671 98.636 1.00124.94 C
ATOM 7611 O PRO B 325 153.204 173.719 99.264 1.00124.94 O
ATOM 7612 CB PRO B 325 155.436 171.319 99.086 1.00124.94 C
ATOM 7613 CG PRO B 325 156.295 172.223 99.898 1.00124.94 C
ATOM 7614 CD PRO B 325 156.743 173.302 98.966 1.00124.94 C
ATOM 7615 N CYS B 326 152.349 171.840 98.378 1.00124.15 N
ATOM 7616 CA CYS B 326 150.983 172.142 98.767 1.00124.15 C
ATOM 7617 C CYS B 326 150.324 170.905 99.352 1.00124.15 C
ATOM 7618 O CYS B 326 150.663 169.776 98.993 1.00124.15 O
ATOM 7619 CB CYS B 326 150.167 172.640 97.581 1.00124.15 C
ATOM 7620 SG CYS B 326 150.772 174.173 96.856 1.00124.15 S
ATOM 7621 N VAL B 327 149.375 171.132 100.255 1.00120.59 N
ATOM 7622 CA VAL B 327 148.626 170.072 100.916 1.00120.59 C
ATOM 7623 C VAL B 327 147.146 170.321 100.670 1.00120.59 C
ATOM 7624 O VAL B 327 146.657 171.435 100.887 1.00120.59 O
ATOM 7625 CB VAL B 327 148.926 170.018 102.427 1.00120.59 C
ATOM 7626 CG1 VAL B 327 148.028 169.021 103.123 1.00120.59 C
ATOM 7627 CG2 VAL B 327 150.370 169.651 102.660 1.00120.59 C
ATOM 7628 N VAL B 328 146.445 169.296 100.194 1.00124.25 N
ATOM 7629 CA VAL B 328 145.027 169.380 99.864 1.00124.25 C
ATOM 7630 C VAL B 328 144.291 168.275 100.608 1.00124.25 C
ATOM 7631 O VAL B 328 144.691 167.106 100.548 1.00124.25 O
ATOM 7632 CB VAL B 328 144.800 169.265 98.345 1.00124.25 C
ATOM 7633 CG1 VAL B 328 143.322 169.193 98.020 1.00124.25 C
ATOM 7634 CG2 VAL B 328 145.437 170.438 97.621 1.00124.25 C
ATOM 7635 N VAL B 329 143.216 168.640 101.301 1.00126.99 N
ATOM 7636 CA VAL B 329 142.396 167.692 102.044 1.00126.99 C
ATOM 7637 C VAL B 329 141.304 167.176 101.117 1.00126.99 C
ATOM 7638 O VAL B 329 140.585 167.965 100.491 1.00126.99 O
ATOM 7639 CB VAL B 329 141.787 168.345 103.296 1.00126.99 C
ATOM 7640 CG1 VAL B 329 140.917 167.352 104.055 1.00126.99 C
ATOM 7641 CG2 VAL B 329 142.880 168.891 104.179 1.00126.99 C
ATOM 7642 N GLU B 330 141.179 165.855 101.021 1.00134.66 N
ATOM 7643 CA GLU B 330 140.117 165.261 100.223 1.00134.66 C
ATOM 7644 C GLU B 330 138.779 165.355 100.947 1.00134.66 C
ATOM 7645 O GLU B 330 138.688 165.160 102.162 1.00134.66 O
ATOM 7646 CB GLU B 330 140.432 163.798 99.910 1.00134.66 C
ATOM 7647 N GLY B 331 137.732 165.651 100.183 1.00144.13 N
ATOM 7648 CA GLY B 331 136.391 165.704 100.723 1.00144.13 C
ATOM 7649 C GLY B 331 135.953 167.050 101.255 1.00144.13 C
ATOM 7650 O GLY B 331 135.059 167.097 102.111 1.00144.13 O
ATOM 7651 N SER B 332 136.550 168.146 100.785 1.00148.30 N
ATOM 7652 CA SER B 332 136.159 169.464 101.275 1.00148.30 C
ATOM 7653 C SER B 332 134.840 169.917 100.662 1.00148.30 C
ATOM 7654 O SER B 332 134.205 170.853 101.160 1.00148.30 O
ATOM 7655 CB SER B 332 137.266 170.478 100.984 1.00148.30 C
ATOM 7656 OG SER B 332 136.911 171.770 101.445 1.00148.30 O
ATOM 7657 N GLY B 333 134.411 169.272 99.579 1.00151.53 N
ATOM 7658 CA GLY B 333 133.224 169.701 98.870 1.00151.53 C
ATOM 7659 C GLY B 333 133.453 170.843 97.911 1.00151.53 C
ATOM 7660 O GLY B 333 132.485 171.472 97.472 1.00151.53 O
ATOM 7661 N ARG B 334 134.706 171.124 97.568 1.00154.58 N
ATOM 7662 CA ARG B 334 135.053 172.283 96.760 1.00154.58 C
ATOM 7663 C ARG B 334 135.877 171.861 95.554 1.00154.58 C
ATOM 7664 O ARG B 334 135.946 170.674 95.223 1.00154.58 O
ATOM 7665 CB ARG B 334 135.818 173.310 97.596 1.00154.58 C
ATOM 7666 N ILE B 335 136.492 172.843 94.889 1.00156.76 N
ATOM 7667 CA ILE B 335 137.364 172.584 93.744 1.00156.76 C
ATOM 7668 C ILE B 335 138.586 171.763 94.159 1.00156.76 C
ATOM 7669 O ILE B 335 139.184 171.051 93.339 1.00156.76 O
ATOM 7670 CB ILE B 335 137.747 173.924 93.081 1.00156.76 C
ATOM 7671 CG1 ILE B 335 138.440 173.725 91.737 1.00156.76 C
ATOM 7672 CG2 ILE B 335 138.606 174.784 93.993 1.00156.76 C
ATOM 7673 CD1 ILE B 335 138.537 174.995 90.953 1.00156.76 C
ATOM 7674 N ALA B 336 138.956 171.823 95.445 1.00154.19 N
ATOM 7675 CA ALA B 336 140.064 171.026 95.959 1.00154.19 C
ATOM 7676 C ALA B 336 139.763 169.534 95.884 1.00154.19 C
ATOM 7677 O ALA B 336 140.672 168.721 95.680 1.00154.19 O
ATOM 7678 CB ALA B 336 140.376 171.440 97.395 1.00154.19 C
ATOM 7679 N ASP B 337 138.488 169.157 96.024 1.00152.33 N
ATOM 7680 CA ASP B 337 138.098 167.765 95.825 1.00152.33 C
ATOM 7681 C ASP B 337 138.307 167.349 94.373 1.00152.33 C
ATOM 7682 O ASP B 337 138.702 166.211 94.094 1.00152.33 O
ATOM 7683 CB ASP B 337 136.638 167.573 96.236 1.00152.33 C
ATOM 7684 CG ASP B 337 136.252 166.112 96.398 1.00152.33 C
ATOM 7685 OD1 ASP B 337 137.117 165.224 96.263 1.00152.33 O
ATOM 7686 OD2 ASP B 337 135.061 165.851 96.659 1.00152.33 O
ATOM 7687 N VAL B 338 138.076 168.270 93.436 1.00156.91 N
ATOM 7688 CA VAL B 338 138.295 167.969 92.026 1.00156.91 C
ATOM 7689 C VAL B 338 139.782 167.830 91.734 1.00156.91 C
ATOM 7690 O VAL B 338 140.193 166.992 90.920 1.00156.91 O
ATOM 7691 CB VAL B 338 137.643 169.047 91.141 1.00156.91 C
ATOM 7692 N ILE B 339 140.611 168.638 92.401 1.00157.72 N
ATOM 7693 CA ILE B 339 142.059 168.514 92.231 1.00157.72 C
ATOM 7694 C ILE B 339 142.552 167.211 92.853 1.00157.72 C
ATOM 7695 O ILE B 339 143.479 166.571 92.341 1.00157.72 O
ATOM 7696 CB ILE B 339 142.773 169.746 92.821 1.00157.72 C
ATOM 7697 CG1 ILE B 339 142.238 171.026 92.180 1.00157.72 C
ATOM 7698 CG2 ILE B 339 144.277 169.688 92.590 1.00157.72 C
ATOM 7699 CD1 ILE B 339 142.427 171.087 90.681 1.00157.72 C
ATOM 7700 N ALA B 340 141.905 166.775 93.937 1.00155.41 N
ATOM 7701 CA ALA B 340 142.273 165.510 94.567 1.00155.41 C
ATOM 7702 C ALA B 340 141.876 164.319 93.704 1.00155.41 C
ATOM 7703 O ALA B 340 142.616 163.331 93.618 1.00155.41 O
ATOM 7704 CB ALA B 340 141.626 165.407 95.947 1.00155.41 C
ATOM 7705 N SER B 341 140.709 164.390 93.063 1.00157.72 N
ATOM 7706 CA SER B 341 140.267 163.291 92.211 1.00157.72 C
ATOM 7707 C SER B 341 141.067 163.237 90.915 1.00157.72 C
ATOM 7708 O SER B 341 141.363 162.150 90.406 1.00157.72 O
ATOM 7709 CB SER B 341 138.774 163.423 91.914 1.00157.72 C
ATOM 7710 N LEU B 342 141.429 164.401 90.367 1.00161.90 N
ATOM 7711 CA LEU B 342 142.195 164.429 89.124 1.00161.90 C
ATOM 7712 C LEU B 342 143.639 163.994 89.346 1.00161.90 C
ATOM 7713 O LEU B 342 144.320 163.579 88.402 1.00161.90 O
ATOM 7714 CB LEU B 342 142.151 165.828 88.510 1.00161.90 C
ATOM 7715 N VAL B 343 144.126 164.092 90.580 1.00157.20 N
ATOM 7716 CA VAL B 343 145.498 163.712 90.896 1.00157.20 C
ATOM 7717 C VAL B 343 145.662 162.198 90.873 1.00157.20 C
ATOM 7718 O VAL B 343 146.695 161.684 90.443 1.00157.20 O
ATOM 7719 CB VAL B 343 145.931 164.277 92.256 1.00157.20 C
ATOM 7720 N SER B 351 141.869 168.790 80.667 1.00244.11 N
ATOM 7721 CA SER B 351 142.014 168.450 79.257 1.00244.11 C
ATOM 7722 C SER B 351 140.754 167.770 78.738 1.00244.11 C
ATOM 7723 O SER B 351 140.830 166.722 78.093 1.00244.11 O
ATOM 7724 CB SER B 351 143.230 167.547 79.046 1.00244.11 C
ATOM 7725 N SER B 352 139.603 168.352 79.107 1.00249.84 N
ATOM 7726 CA SER B 352 138.228 168.021 78.707 1.00249.84 C
ATOM 7727 C SER B 352 137.718 166.711 79.311 1.00249.84 C
ATOM 7728 O SER B 352 136.527 166.403 79.204 1.00249.84 O
ATOM 7729 CB SER B 352 138.065 167.991 77.178 1.00249.84 C
ATOM 7730 OG SER B 352 138.723 166.880 76.595 1.00249.84 O
ATOM 7731 N CYS B 353 138.597 165.940 79.952 1.00245.00 N
ATOM 7732 CA CYS B 353 138.145 164.966 80.935 1.00245.00 C
ATOM 7733 C CYS B 353 138.184 165.583 82.321 1.00245.00 C
ATOM 7734 O CYS B 353 137.387 165.230 83.199 1.00245.00 O
ATOM 7735 CB CYS B 353 139.008 163.708 80.874 1.00245.00 C
ATOM 7736 SG CYS B 353 138.857 162.781 79.334 1.00245.00 S
ATOM 7737 N VAL B 354 139.114 166.519 82.524 1.00247.09 N
ATOM 7738 CA VAL B 354 139.126 167.345 83.724 1.00247.09 C
ATOM 7739 C VAL B 354 137.877 168.216 83.772 1.00247.09 C
ATOM 7740 O VAL B 354 137.237 168.353 84.821 1.00247.09 O
ATOM 7741 CB VAL B 354 140.415 168.188 83.763 1.00247.09 C
ATOM 7742 CG1 VAL B 354 140.429 169.109 84.970 1.00247.09 C
ATOM 7743 CG2 VAL B 354 141.642 167.286 83.757 1.00247.09 C
ATOM 7744 N LYS B 355 137.502 168.800 82.629 1.00247.50 N
ATOM 7745 CA LYS B 355 136.295 169.618 82.564 1.00247.50 C
ATOM 7746 C LYS B 355 135.040 168.772 82.739 1.00247.50 C
ATOM 7747 O LYS B 355 134.022 169.258 83.246 1.00247.50 O
ATOM 7748 CB LYS B 355 136.245 170.376 81.239 1.00247.50 C
ATOM 7749 N GLU B 356 135.092 167.507 82.320 1.00247.92 N
ATOM 7750 CA GLU B 356 133.992 166.593 82.605 1.00247.92 C
ATOM 7751 C GLU B 356 133.952 166.234 84.085 1.00247.92 C
ATOM 7752 O GLU B 356 132.876 166.010 84.651 1.00247.92 O
ATOM 7753 CB GLU B 356 134.121 165.333 81.752 1.00247.92 C
ATOM 7754 N SER B 357 135.120 166.179 84.729 1.00243.04 N
ATOM 7755 CA SER B 357 135.172 165.855 86.150 1.00243.04 C
ATOM 7756 C SER B 357 134.756 167.045 87.008 1.00243.04 C
ATOM 7757 O SER B 357 134.394 166.875 88.178 1.00243.04 O
ATOM 7758 CB SER B 357 136.576 165.388 86.521 1.00243.04 C
ATOM 7759 OG SER B 357 136.661 165.101 87.903 1.00243.04 O
ATOM 7760 N LEU B 358 134.845 168.257 86.450 1.00249.57 N
ATOM 7761 CA LEU B 358 134.443 169.471 87.162 1.00249.57 C
ATOM 7762 C LEU B 358 132.963 169.450 87.532 1.00249.57 C
ATOM 7763 O LEU B 358 132.573 169.907 88.612 1.00249.57 O
ATOM 7764 CB LEU B 358 134.747 170.713 86.315 1.00249.57 C
ATOM 7765 CG LEU B 358 136.189 171.176 86.099 1.00249.57 C
ATOM 7766 CD1 LEU B 358 136.237 172.350 85.135 1.00249.57 C
ATOM 7767 CD2 LEU B 358 136.832 171.547 87.421 1.00249.57 C
ATOM 7768 N LEU B 359 132.125 168.939 86.629 1.00250.62 N
ATOM 7769 CA LEU B 359 130.679 168.893 86.824 1.00250.62 C
ATOM 7770 C LEU B 359 130.282 167.984 87.979 1.00250.62 C
ATOM 7771 O LEU B 359 129.270 168.227 88.647 1.00250.62 O
ATOM 7772 CB LEU B 359 129.989 168.438 85.538 1.00250.62 C
ATOM 7773 N ARG B 360 131.065 166.927 88.213 1.00248.23 N
ATOM 7774 CA ARG B 360 130.790 166.030 89.330 1.00248.23 C
ATOM 7775 C ARG B 360 131.058 166.712 90.666 1.00248.23 C
ATOM 7776 O ARG B 360 130.387 166.426 91.665 1.00248.23 O
ATOM 7777 CB ARG B 360 131.627 164.757 89.199 1.00248.23 C
ATOM 7778 N PHE B 361 132.036 167.619 90.704 1.00249.72 N
ATOM 7779 CA PHE B 361 132.379 168.283 91.957 1.00249.72 C
ATOM 7780 C PHE B 361 131.393 169.397 92.287 1.00249.72 C
ATOM 7781 O PHE B 361 130.730 169.360 93.330 1.00249.72 O
ATOM 7782 CB PHE B 361 133.804 168.830 91.881 1.00249.72 C
ATOM 7783 N LEU B 362 131.279 170.396 91.410 1.00260.28 N
ATOM 7784 CA LEU B 362 130.413 171.540 91.672 1.00260.28 C
ATOM 7785 C LEU B 362 129.821 172.075 90.373 1.00260.28 C
ATOM 7786 O LEU B 362 130.514 172.756 89.606 1.00260.28 O
ATOM 7787 CB LEU B 362 131.186 172.642 92.399 1.00260.28 C
ATOM 7788 N PRO B 363 128.549 171.791 90.093 1.00260.46 N
ATOM 7789 CA PRO B 363 127.936 172.287 88.855 1.00260.46 C
ATOM 7790 C PRO B 363 127.492 173.739 88.954 1.00260.46 C
ATOM 7791 O PRO B 363 127.218 174.377 87.934 1.00260.46 O
ATOM 7792 CB PRO B 363 126.741 171.348 88.661 1.00260.46 C
ATOM 7793 CG PRO B 363 126.374 170.942 90.044 1.00260.46 C
ATOM 7794 CD PRO B 363 127.662 170.863 90.817 1.00260.46 C
ATOM 7795 N ARG B 364 127.405 174.264 90.179 1.00260.49 N
ATOM 7796 CA ARG B 364 126.912 175.626 90.367 1.00260.49 C
ATOM 7797 C ARG B 364 127.939 176.656 89.917 1.00260.49 C
ATOM 7798 O ARG B 364 127.579 177.706 89.373 1.00260.49 O
ATOM 7799 CB ARG B 364 126.537 175.850 91.832 1.00260.49 C
ATOM 7800 N THR B 365 129.224 176.373 90.135 1.00259.44 N
ATOM 7801 CA THR B 365 130.263 177.333 89.779 1.00259.44 C
ATOM 7802 C THR B 365 130.506 177.360 88.275 1.00259.44 C
ATOM 7803 O THR B 365 130.789 178.419 87.703 1.00259.44 O
ATOM 7804 CB THR B 365 131.557 177.005 90.521 1.00259.44 C
ATOM 7805 N ILE B 366 130.399 176.205 87.616 1.00258.74 N
ATOM 7806 CA ILE B 366 130.650 176.145 86.178 1.00258.74 C
ATOM 7807 C ILE B 366 129.437 176.638 85.399 1.00258.74 C
ATOM 7808 O ILE B 366 129.510 176.853 84.182 1.00258.74 O
ATOM 7809 CB ILE B 366 131.045 174.718 85.760 1.00258.74 C
ATOM 7810 CG1 ILE B 366 129.880 173.754 85.973 1.00258.74 C
ATOM 7811 CG2 ILE B 366 132.253 174.254 86.552 1.00258.74 C
ATOM 7812 CD1 ILE B 366 130.103 172.385 85.370 1.00258.74 C
ATOM 7813 N SER B 367 128.301 176.812 86.082 1.00258.60 N
ATOM 7814 CA SER B 367 127.074 177.218 85.404 1.00258.60 C
ATOM 7815 C SER B 367 127.133 178.674 84.958 1.00258.60 C
ATOM 7816 O SER B 367 127.006 178.972 83.765 1.00258.60 O
ATOM 7817 CB SER B 367 125.873 176.988 86.322 1.00258.60 C
ATOM 7818 OG SER B 367 125.936 177.832 87.459 1.00258.60 O
ATOM 7819 N ARG B 368 127.345 179.595 85.901 1.00253.10 N
ATOM 7820 CA ARG B 368 127.355 181.014 85.557 1.00253.10 C
ATOM 7821 C ARG B 368 128.662 181.417 84.886 1.00253.10 C
ATOM 7822 O ARG B 368 128.767 182.516 84.331 1.00253.10 O
ATOM 7823 CB ARG B 368 127.114 181.857 86.807 1.00253.10 C
ATOM 7824 N LEU B 369 129.674 180.550 84.946 1.00249.95 N
ATOM 7825 CA LEU B 369 130.964 180.849 84.343 1.00249.95 C
ATOM 7826 C LEU B 369 130.864 180.852 82.823 1.00249.95 C
ATOM 7827 O LEU B 369 129.975 180.226 82.240 1.00249.95 O
ATOM 7828 CB LEU B 369 132.008 179.828 84.799 1.00249.95 C
ATOM 7829 N SER B 370 131.779 181.575 82.184 1.00240.71 N
ATOM 7830 CA SER B 370 131.812 181.676 80.735 1.00240.71 C
ATOM 7831 C SER B 370 132.693 180.565 80.161 1.00240.71 C
ATOM 7832 O SER B 370 133.250 179.739 80.890 1.00240.71 O
ATOM 7833 CB SER B 370 132.293 183.064 80.316 1.00240.71 C
ATOM 7834 N GLU B 371 132.822 180.536 78.833 1.00238.12 N
ATOM 7835 CA GLU B 371 133.646 179.519 78.191 1.00238.12 C
ATOM 7836 C GLU B 371 135.126 179.874 78.275 1.00238.12 C
ATOM 7837 O GLU B 371 135.977 178.983 78.389 1.00238.12 O
ATOM 7838 CB GLU B 371 133.216 179.339 76.736 1.00238.12 C
ATOM 7839 N GLU B 372 135.453 181.169 78.211 1.00233.16 N
ATOM 7840 CA GLU B 372 136.840 181.594 78.366 1.00233.16 C
ATOM 7841 C GLU B 372 137.331 181.355 79.788 1.00233.16 C
ATOM 7842 O GLU B 372 138.510 181.051 80.004 1.00233.16 O
ATOM 7843 CB GLU B 372 136.985 183.066 77.986 1.00233.16 C
ATOM 7844 N GLU B 373 136.430 181.460 80.771 1.00235.51 N
ATOM 7845 CA GLU B 373 136.786 181.132 82.148 1.00235.51 C
ATOM 7846 C GLU B 373 137.035 179.638 82.308 1.00235.51 C
ATOM 7847 O GLU B 373 137.933 179.226 83.052 1.00235.51 O
ATOM 7848 CB GLU B 373 135.687 181.598 83.103 1.00235.51 C
ATOM 7849 N THR B 374 136.254 178.811 81.604 1.00232.66 N
ATOM 7850 CA THR B 374 136.492 177.370 81.617 1.00232.66 C
ATOM 7851 C THR B 374 137.815 177.026 80.942 1.00232.66 C
ATOM 7852 O THR B 374 138.539 176.135 81.401 1.00232.66 O
ATOM 7853 CB THR B 374 135.336 176.639 80.936 1.00232.66 C
ATOM 7854 N GLU B 375 138.157 177.743 79.866 1.00229.64 N
ATOM 7855 CA GLU B 375 139.440 177.528 79.199 1.00229.64 C
ATOM 7856 C GLU B 375 140.604 177.955 80.085 1.00229.64 C
ATOM 7857 O GLU B 375 141.647 177.287 80.118 1.00229.64 O
ATOM 7858 CB GLU B 375 139.477 178.282 77.870 1.00229.64 C
ATOM 7859 N SER B 376 140.435 179.054 80.825 1.00226.41 N
ATOM 7860 CA SER B 376 141.467 179.488 81.760 1.00226.41 C
ATOM 7861 C SER B 376 141.624 178.502 82.912 1.00226.41 C
ATOM 7862 O SER B 376 142.747 178.244 83.362 1.00226.41 O
ATOM 7863 CB SER B 376 141.143 180.883 82.289 1.00226.41 C
ATOM 7864 OG SER B 376 142.119 181.310 83.223 1.00226.41 O
ATOM 7865 N TRP B 377 140.511 177.927 83.388 1.00225.01 N
ATOM 7866 CA TRP B 377 140.586 176.905 84.432 1.00225.01 C
ATOM 7867 C TRP B 377 141.294 175.652 83.940 1.00225.01 C
ATOM 7868 O TRP B 377 142.106 175.071 84.668 1.00225.01 O
ATOM 7869 CB TRP B 377 139.196 176.529 84.937 1.00225.01 C
ATOM 7870 CG TRP B 377 138.546 177.531 85.808 1.00225.01 C
ATOM 7871 CD1 TRP B 377 139.048 178.735 86.197 1.00225.01 C
ATOM 7872 CD2 TRP B 377 137.285 177.388 86.461 1.00225.01 C
ATOM 7873 NE1 TRP B 377 138.157 179.370 87.026 1.00225.01 N
ATOM 7874 CE2 TRP B 377 137.066 178.559 87.208 1.00225.01 C
ATOM 7875 CE3 TRP B 377 136.309 176.386 86.476 1.00225.01 C
ATOM 7876 CZ2 TRP B 377 135.909 178.758 87.965 1.00225.01 C
ATOM 7877 CZ3 TRP B 377 135.164 176.582 87.224 1.00225.01 C
ATOM 7878 CH2 TRP B 377 134.973 177.759 87.959 1.00225.01 C
ATOM 7879 N ILE B 378 140.987 175.212 82.717 1.00219.14 N
ATOM 7880 CA ILE B 378 141.656 174.044 82.151 1.00219.14 C
ATOM 7881 C ILE B 378 143.147 174.302 81.960 1.00219.14 C
ATOM 7882 O ILE B 378 143.972 173.446 82.308 1.00219.14 O
ATOM 7883 CB ILE B 378 140.969 173.631 80.836 1.00219.14 C
ATOM 7884 CG1 ILE B 378 139.575 173.073 81.119 1.00219.14 C
ATOM 7885 CG2 ILE B 378 141.788 172.599 80.070 1.00219.14 C
ATOM 7886 CD1 ILE B 378 138.738 172.889 79.876 1.00219.14 C
ATOM 7887 N LYS B 379 143.515 175.499 81.487 1.00210.68 N
ATOM 7888 CA LYS B 379 144.925 175.846 81.322 1.00210.68 C
ATOM 7889 C LYS B 379 145.651 175.912 82.662 1.00210.68 C
ATOM 7890 O LYS B 379 146.776 175.412 82.790 1.00210.68 O
ATOM 7891 CB LYS B 379 145.050 177.176 80.580 1.00210.68 C
ATOM 7892 N TRP B 380 145.007 176.475 83.687 1.00203.85 N
ATOM 7893 CA TRP B 380 145.669 176.623 84.978 1.00203.85 C
ATOM 7894 C TRP B 380 145.771 175.293 85.715 1.00203.85 C
ATOM 7895 O TRP B 380 146.753 175.048 86.422 1.00203.85 O
ATOM 7896 CB TRP B 380 144.933 177.656 85.828 1.00203.85 C
ATOM 7897 N ILE B 381 144.774 174.418 85.565 1.00196.74 N
ATOM 7898 CA ILE B 381 144.846 173.102 86.195 1.00196.74 C
ATOM 7899 C ILE B 381 145.867 172.223 85.478 1.00196.74 C
ATOM 7900 O ILE B 381 146.602 171.457 86.116 1.00196.74 O
ATOM 7901 CB ILE B 381 143.440 172.468 86.254 1.00196.74 C
ATOM 7902 CG1 ILE B 381 142.584 173.196 87.291 1.00196.74 C
ATOM 7903 CG2 ILE B 381 143.476 170.984 86.581 1.00196.74 C
ATOM 7904 CD1 ILE B 381 141.135 172.796 87.272 1.00196.74 C
ATOM 7905 N LYS B 382 145.974 172.363 84.151 1.00199.14 N
ATOM 7906 CA LYS B 382 147.007 171.636 83.415 1.00199.14 C
ATOM 7907 C LYS B 382 148.400 172.154 83.759 1.00199.14 C
ATOM 7908 O LYS B 382 149.376 171.395 83.737 1.00199.14 O
ATOM 7909 CB LYS B 382 146.749 171.740 81.912 1.00199.14 C
ATOM 7910 N GLU B 383 148.509 173.443 84.082 1.00191.88 N
ATOM 7911 CA GLU B 383 149.766 173.960 84.606 1.00191.88 C
ATOM 7912 C GLU B 383 150.000 173.488 86.040 1.00191.88 C
ATOM 7913 O GLU B 383 151.146 173.367 86.484 1.00191.88 O
ATOM 7914 CB GLU B 383 149.774 175.486 84.530 1.00191.88 C
ATOM 7915 N VAL B 384 148.921 173.214 86.774 1.00185.99 N
ATOM 7916 CA VAL B 384 148.998 172.817 88.176 1.00185.99 C
ATOM 7917 C VAL B 384 149.437 171.365 88.290 1.00185.99 C
ATOM 7918 O VAL B 384 150.336 171.036 89.072 1.00185.99 O
ATOM 7919 CB VAL B 384 147.651 173.029 88.890 1.00185.99 C
ATOM 7920 N LEU B 385 148.812 170.486 87.505 1.00177.88 N
ATOM 7921 CA LEU B 385 149.060 169.051 87.605 1.00177.88 C
ATOM 7922 C LEU B 385 150.226 168.648 86.699 1.00177.88 C
ATOM 7923 O LEU B 385 150.411 167.468 86.384 1.00177.88 O
ATOM 7924 CB LEU B 385 147.767 168.287 87.278 1.00177.88 C
ATOM 7925 CG LEU B 385 147.554 166.819 87.669 1.00177.88 C
ATOM 7926 CD1 LEU B 385 147.609 166.670 89.175 1.00177.88 C
ATOM 7927 CD2 LEU B 385 146.236 166.292 87.133 1.00177.88 C
ATOM 7928 N GLU B 386 151.024 169.633 86.272 1.00175.89 N
ATOM 7929 CA GLU B 386 152.241 169.339 85.524 1.00175.89 C
ATOM 7930 C GLU B 386 153.256 168.601 86.388 1.00175.89 C
ATOM 7931 O GLU B 386 153.996 167.742 85.895 1.00175.89 O
ATOM 7932 CB GLU B 386 152.842 170.634 84.975 1.00175.89 C
ATOM 7933 N SER B 387 153.304 168.921 87.677 1.00164.25 N
ATOM 7934 CA SER B 387 154.210 168.266 88.613 1.00164.25 C
ATOM 7935 C SER B 387 153.403 167.573 89.703 1.00164.25 C
ATOM 7936 O SER B 387 152.918 168.249 90.627 1.00164.25 O
ATOM 7937 CB SER B 387 155.171 169.284 89.225 1.00164.25 C
ATOM 7938 OG SER B 387 154.461 170.228 90.005 1.00164.25 O
ATOM 7939 N PRO B 388 153.224 166.249 89.645 1.00155.59 N
ATOM 7940 CA PRO B 388 152.442 165.580 90.698 1.00155.59 C
ATOM 7941 C PRO B 388 153.174 165.498 92.019 1.00155.59 C
ATOM 7942 O PRO B 388 152.531 165.424 93.074 1.00155.59 O
ATOM 7943 CB PRO B 388 152.188 164.184 90.111 1.00155.59 C
ATOM 7944 CG PRO B 388 152.404 164.333 88.649 1.00155.59 C
ATOM 7945 CD PRO B 388 153.487 165.354 88.509 1.00155.59 C
ATOM 7946 N HIS B 389 154.509 165.511 91.989 1.00143.01 N
ATOM 7947 CA HIS B 389 155.290 165.262 93.197 1.00143.01 C
ATOM 7948 C HIS B 389 155.209 166.427 94.173 1.00143.01 C
ATOM 7949 O HIS B 389 155.387 166.242 95.382 1.00143.01 O
ATOM 7950 CB HIS B 389 156.743 164.983 92.824 1.00143.01 C
ATOM 7951 CG HIS B 389 157.433 166.149 92.197 1.00143.01 C
ATOM 7952 ND1 HIS B 389 157.281 166.474 90.868 1.00143.01 N
ATOM 7953 CD2 HIS B 389 158.268 167.076 92.720 1.00143.01 C
ATOM 7954 CE1 HIS B 389 158.000 167.549 90.597 1.00143.01 C
ATOM 7955 NE2 HIS B 389 158.610 167.932 91.703 1.00143.01 N
ATOM 7956 N LEU B 390 154.942 167.635 93.674 1.00138.91 N
ATOM 7957 CA LEU B 390 154.946 168.799 94.552 1.00138.91 C
ATOM 7958 C LEU B 390 153.685 168.863 95.405 1.00138.91 C
ATOM 7959 O LEU B 390 153.730 169.323 96.551 1.00138.91 O
ATOM 7960 CB LEU B 390 155.116 170.078 93.738 1.00138.91 C
ATOM 7961 CG LEU B 390 156.490 170.239 93.087 1.00138.91 C
ATOM 7962 CD1 LEU B 390 156.545 171.493 92.242 1.00138.91 C
ATOM 7963 CD2 LEU B 390 157.575 170.266 94.142 1.00138.91 C
ATOM 7964 N LEU B 391 152.555 168.420 94.874 1.00134.92 N
ATOM 7965 CA LEU B 391 151.339 168.432 95.666 1.00134.92 C
ATOM 7966 C LEU B 391 151.233 167.158 96.491 1.00134.92 C
ATOM 7967 O LEU B 391 151.815 166.125 96.155 1.00134.92 O
ATOM 7968 CB LEU B 391 150.112 168.608 94.771 1.00134.92 C
ATOM 7969 CG LEU B 391 149.691 167.564 93.734 1.00134.92 C
ATOM 7970 CD1 LEU B 391 148.650 166.575 94.272 1.00134.92 C
ATOM 7971 CD2 LEU B 391 149.176 168.262 92.489 1.00134.92 C
ATOM 7972 N THR B 392 150.461 167.238 97.569 1.00128.06 N
ATOM 7973 CA THR B 392 150.237 166.104 98.454 1.00128.06 C
ATOM 7974 C THR B 392 148.805 166.152 98.967 1.00128.06 C
ATOM 7975 O THR B 392 148.323 167.207 99.378 1.00128.06 O
ATOM 7976 CB THR B 392 151.198 166.120 99.654 1.00128.06 C
ATOM 7977 OG1 THR B 392 152.551 166.099 99.186 1.00128.06 O
ATOM 7978 CG2 THR B 392 150.955 164.914 100.545 1.00128.06 C
ATOM 7979 N VAL B 393 148.122 165.014 98.941 1.00126.95 N
ATOM 7980 CA VAL B 393 146.740 164.965 99.401 1.00126.95 C
ATOM 7981 C VAL B 393 146.555 164.047 100.602 1.00126.95 C
ATOM 7982 O VAL B 393 146.986 162.895 100.591 1.00126.95 O
ATOM 7983 CB VAL B 393 145.791 164.518 98.277 1.00126.95 C
ATOM 7984 CG1 VAL B 393 144.356 164.487 98.780 1.00126.95 C
ATOM 7985 CG2 VAL B 393 145.923 165.445 97.079 1.00126.95 C
ATOM 7986 N ILE B 394 145.910 164.571 101.638 1.00124.36 N
ATOM 7987 CA ILE B 394 145.651 163.809 102.849 1.00124.36 C
ATOM 7988 C ILE B 394 144.663 162.682 102.571 1.00124.36 C
ATOM 7989 O ILE B 394 143.696 162.863 101.834 1.00124.36 O
ATOM 7990 CB ILE B 394 145.083 164.712 103.959 1.00124.36 C
ATOM 7991 CG1 ILE B 394 145.906 165.997 104.068 1.00124.36 C
ATOM 7992 CG2 ILE B 394 145.052 163.975 105.290 1.00124.36 C
ATOM 7993 CD1 ILE B 394 145.415 166.947 105.139 1.00124.36 C
ATOM 7994 N LYS B 395 144.909 161.521 103.167 1.00124.52 N
ATOM 7995 CA LYS B 395 144.033 160.370 102.991 1.00124.52 C
ATOM 7996 C LYS B 395 142.678 160.627 103.639 1.00124.52 C
ATOM 7997 O LYS B 395 142.591 161.279 104.678 1.00124.52 O
ATOM 7998 CB LYS B 395 144.670 159.113 103.582 1.00124.52 C
ATOM 7999 N ILE B 396 141.622 160.112 103.019 1.00130.70 N
ATOM 8000 CA ILE B 396 140.273 160.286 103.540 1.00130.70 C
ATOM 8001 C ILE B 396 140.128 159.633 104.911 1.00130.70 C
ATOM 8002 O ILE B 396 139.486 160.182 105.806 1.00130.70 O
ATOM 8003 CB ILE B 396 139.216 159.700 102.584 1.00130.70 C
ATOM 8004 N GLU B 397 140.727 158.458 105.069 1.00138.92 N
ATOM 8005 CA GLU B 397 140.668 157.731 106.331 1.00138.92 C
ATOM 8006 C GLU B 397 141.610 158.342 107.361 1.00138.92 C
ATOM 8007 O GLU B 397 142.470 157.656 107.912 1.00138.92 O
ATOM 8008 CB GLU B 397 141.015 156.257 106.118 1.00138.92 C
ATOM 8009 N GLU B 402 148.137 161.445 114.289 1.00127.89 N
ATOM 8010 CA GLU B 402 149.298 162.167 113.790 1.00127.89 C
ATOM 8011 C GLU B 402 149.356 162.228 112.271 1.00127.89 C
ATOM 8012 O GLU B 402 150.454 162.210 111.708 1.00127.89 O
ATOM 8013 CB GLU B 402 150.580 161.532 114.334 1.00127.89 C
ATOM 8014 N ILE B 403 148.207 162.288 111.596 1.00121.98 N
ATOM 8015 CA ILE B 403 148.215 162.333 110.137 1.00121.98 C
ATOM 8016 C ILE B 403 148.697 163.689 109.637 1.00121.98 C
ATOM 8017 O ILE B 403 149.246 163.794 108.533 1.00121.98 O
ATOM 8018 CB ILE B 403 146.823 161.985 109.580 1.00121.98 C
ATOM 8019 CG1 ILE B 403 145.758 162.926 110.148 1.00121.98 C
ATOM 8020 CG2 ILE B 403 146.489 160.534 109.864 1.00121.98 C
ATOM 8021 CD1 ILE B 403 144.420 162.807 109.469 1.00121.98 C
ATOM 8022 N VAL B 404 148.519 164.741 110.439 1.00117.38 N
ATOM 8023 CA VAL B 404 148.836 166.092 109.981 1.00117.38 C
ATOM 8024 C VAL B 404 150.342 166.289 109.909 1.00117.38 C
ATOM 8025 O VAL B 404 150.877 166.749 108.891 1.00117.38 O
ATOM 8026 CB VAL B 404 148.177 167.138 110.896 1.00117.38 C
ATOM 8027 CG1 VAL B 404 148.580 168.536 110.471 1.00117.38 C
ATOM 8028 CG2 VAL B 404 146.674 166.986 110.864 1.00117.38 C
ATOM 8029 N SER B 405 151.044 165.939 110.993 1.00114.77 N
ATOM 8030 CA SER B 405 152.499 166.042 111.013 1.00114.77 C
ATOM 8031 C SER B 405 153.127 165.106 109.998 1.00114.77 C
ATOM 8032 O SER B 405 154.118 165.460 109.348 1.00114.77 O
ATOM 8033 CB SER B 405 153.031 165.727 112.408 1.00114.77 C
ATOM 8034 OG SER B 405 152.819 164.364 112.716 1.00114.77 O
ATOM 8035 N ASN B 406 152.533 163.922 109.828 1.00113.60 N
ATOM 8036 CA ASN B 406 153.014 162.970 108.835 1.00113.60 C
ATOM 8037 C ASN B 406 152.880 163.533 107.426 1.00113.60 C
ATOM 8038 O ASN B 406 153.820 163.451 106.628 1.00113.60 O
ATOM 8039 CB ASN B 406 152.243 161.657 108.962 1.00113.60 C
ATOM 8040 CG ASN B 406 152.901 160.514 108.213 1.00113.60 C
ATOM 8041 OD1 ASN B 406 153.965 160.671 107.615 1.00113.60 O
ATOM 8042 ND2 ASN B 406 152.265 159.350 108.243 1.00113.60 N
ATOM 8043 N ALA B 407 151.738 164.157 107.127 1.00112.88 N
ATOM 8044 CA ALA B 407 151.509 164.694 105.791 1.00112.88 C
ATOM 8045 C ALA B 407 152.418 165.882 105.505 1.00112.88 C
ATOM 8046 O ALA B 407 152.998 165.975 104.415 1.00112.88 O
ATOM 8047 CB ALA B 407 150.044 165.091 105.635 1.00112.88 C
ATOM 8048 N ILE B 408 152.575 166.778 106.486 1.00109.06 N
ATOM 8049 CA ILE B 408 153.417 167.958 106.298 1.00109.06 C
ATOM 8050 C ILE B 408 154.873 167.557 106.119 1.00109.06 C
ATOM 8051 O ILE B 408 155.550 168.025 105.192 1.00109.06 O
ATOM 8052 CB ILE B 408 153.236 168.937 107.472 1.00109.06 C
ATOM 8053 CG1 ILE B 408 151.824 169.514 107.467 1.00109.06 C
ATOM 8054 CG2 ILE B 408 154.238 170.068 107.393 1.00109.06 C
ATOM 8055 CD1 ILE B 408 151.474 170.294 108.707 1.00109.06 C
ATOM 8056 N SER B 409 155.361 166.649 106.968 1.00107.06 N
ATOM 8057 CA SER B 409 156.751 166.228 106.887 1.00107.06 C
ATOM 8058 C SER B 409 157.017 165.425 105.626 1.00107.06 C
ATOM 8059 O SER B 409 158.087 165.552 105.025 1.00107.06 O
ATOM 8060 CB SER B 409 157.112 165.408 108.116 1.00107.06 C
ATOM 8061 OG SER B 409 156.351 164.220 108.152 1.00107.06 O
ATOM 8062 N PHE B 410 156.045 164.624 105.187 1.00109.65 N
ATOM 8063 CA PHE B 410 156.237 163.844 103.973 1.00109.65 C
ATOM 8064 C PHE B 410 156.255 164.734 102.740 1.00109.65 C
ATOM 8065 O PHE B 410 157.073 164.528 101.833 1.00109.65 O
ATOM 8066 CB PHE B 410 155.149 162.784 103.862 1.00109.65 C
ATOM 8067 CG PHE B 410 155.258 161.945 102.636 1.00109.65 C
ATOM 8068 CD1 PHE B 410 156.280 161.021 102.508 1.00109.65 C
ATOM 8069 CD2 PHE B 410 154.332 162.065 101.617 1.00109.65 C
ATOM 8070 CE1 PHE B 410 156.384 160.240 101.377 1.00109.65 C
ATOM 8071 CE2 PHE B 410 154.425 161.285 100.484 1.00109.65 C
ATOM 8072 CZ PHE B 410 155.455 160.372 100.363 1.00109.65 C
ATOM 8073 N ALA B 411 155.390 165.754 102.707 1.00109.54 N
ATOM 8074 CA ALA B 411 155.402 166.698 101.595 1.00109.54 C
ATOM 8075 C ALA B 411 156.688 167.510 101.577 1.00109.54 C
ATOM 8076 O ALA B 411 157.260 167.759 100.506 1.00109.54 O
ATOM 8077 CB ALA B 411 154.189 167.618 101.679 1.00109.54 C
ATOM 8078 N LEU B 412 157.177 167.900 102.755 1.00105.13 N
ATOM 8079 CA LEU B 412 158.394 168.696 102.814 1.00105.13 C
ATOM 8080 C LEU B 412 159.615 167.870 102.430 1.00105.13 C
ATOM 8081 O LEU B 412 160.529 168.370 101.761 1.00105.13 O
ATOM 8082 CB LEU B 412 158.552 169.284 104.209 1.00105.13 C
ATOM 8083 CG LEU B 412 159.680 170.294 104.345 1.00105.13 C
ATOM 8084 CD1 LEU B 412 159.368 171.476 103.464 1.00105.13 C
ATOM 8085 CD2 LEU B 412 159.820 170.710 105.788 1.00105.13 C
ATOM 8086 N TYR B 413 159.634 166.592 102.817 1.00108.06 N
ATOM 8087 CA TYR B 413 160.727 165.720 102.406 1.00108.06 C
ATOM 8088 C TYR B 413 160.679 165.446 100.914 1.00108.06 C
ATOM 8089 O TYR B 413 161.728 165.354 100.267 1.00108.06 O
ATOM 8090 CB TYR B 413 160.693 164.410 103.183 1.00108.06 C
ATOM 8091 CG TYR B 413 161.755 163.453 102.722 1.00108.06 C
ATOM 8092 CD1 TYR B 413 163.092 163.715 102.964 1.00108.06 C
ATOM 8093 CD2 TYR B 413 161.423 162.289 102.047 1.00108.06 C
ATOM 8094 CE1 TYR B 413 164.075 162.851 102.543 1.00108.06 C
ATOM 8095 CE2 TYR B 413 162.401 161.413 101.621 1.00108.06 C
ATOM 8096 CZ TYR B 413 163.728 161.701 101.873 1.00108.06 C
ATOM 8097 OH TYR B 413 164.717 160.838 101.456 1.00108.06 O
ATOM 8098 N LYS B 414 159.471 165.321 100.352 1.00110.58 N
ATOM 8099 CA LYS B 414 159.324 165.174 98.907 1.00110.58 C
ATOM 8100 C LYS B 414 159.872 166.387 98.169 1.00110.58 C
ATOM 8101 O LYS B 414 160.584 166.242 97.170 1.00110.58 O
ATOM 8102 CB LYS B 414 157.856 164.960 98.546 1.00110.58 C
ATOM 8103 CG LYS B 414 157.397 163.522 98.637 1.00110.58 C
ATOM 8104 CD LYS B 414 156.018 163.362 98.029 1.00110.58 C
ATOM 8105 N ALA B 415 159.574 167.585 98.670 1.00112.16 N
ATOM 8106 CA ALA B 415 160.071 168.820 98.075 1.00112.16 C
ATOM 8107 C ALA B 415 161.589 168.924 98.154 1.00112.16 C
ATOM 8108 O ALA B 415 162.246 169.264 97.161 1.00112.16 O
ATOM 8109 CB ALA B 415 159.432 170.028 98.752 1.00112.16 C
ATOM 8110 N PHE B 416 162.156 168.622 99.321 1.00112.60 N
ATOM 8111 CA PHE B 416 163.599 168.747 99.480 1.00112.60 C
ATOM 8112 C PHE B 416 164.352 167.656 98.730 1.00112.60 C
ATOM 8113 O PHE B 416 165.500 167.848 98.318 1.00112.60 O
ATOM 8114 CB PHE B 416 163.968 168.744 100.962 1.00112.60 C
ATOM 8115 CG PHE B 416 165.429 168.945 101.214 1.00112.60 C
ATOM 8116 CD1 PHE B 416 166.025 170.161 100.931 1.00112.60 C
ATOM 8117 CD2 PHE B 416 166.202 167.930 101.745 1.00112.60 C
ATOM 8118 CE1 PHE B 416 167.371 170.356 101.157 1.00112.60 C
ATOM 8119 CE2 PHE B 416 167.547 168.121 101.980 1.00112.60 C
ATOM 8120 CZ PHE B 416 168.131 169.337 101.685 1.00112.60 C
ATOM 8121 N SER B 417 163.714 166.504 98.526 1.00118.39 N
ATOM 8122 CA SER B 417 164.346 165.460 97.729 1.00118.39 C
ATOM 8123 C SER B 417 164.273 165.785 96.244 1.00118.39 C
ATOM 8124 O SER B 417 165.223 165.521 95.498 1.00118.39 O
ATOM 8125 CB SER B 417 163.693 164.114 98.023 1.00118.39 C
ATOM 8126 OG SER B 417 163.904 163.739 99.372 1.00118.39 O
ATOM 8127 N THR B 418 163.155 166.363 95.796 1.00128.95 N
ATOM 8128 CA THR B 418 163.023 166.727 94.389 1.00128.95 C
ATOM 8129 C THR B 418 163.870 167.945 94.045 1.00128.95 C
ATOM 8130 O THR B 418 164.134 168.205 92.866 1.00128.95 O
ATOM 8131 CB THR B 418 161.557 166.987 94.047 1.00128.95 C
ATOM 8132 N ASN B 419 164.262 168.728 95.056 1.00131.70 N
ATOM 8133 CA ASN B 419 165.239 169.792 94.838 1.00131.70 C
ATOM 8134 C ASN B 419 166.567 169.226 94.350 1.00131.70 C
ATOM 8135 O ASN B 419 167.160 169.743 93.396 1.00131.70 O
ATOM 8136 CB ASN B 419 165.439 170.598 96.121 1.00131.70 C
ATOM 8137 CG ASN B 419 164.300 171.555 96.389 1.00131.70 C
ATOM 8138 OD1 ASN B 419 163.838 172.248 95.485 1.00131.70 O
ATOM 8139 ND2 ASN B 419 163.833 171.591 97.629 1.00131.70 N
ATOM 8140 N GLU B 420 167.061 168.180 95.018 1.00135.64 N
ATOM 8141 CA GLU B 420 168.221 167.363 94.650 1.00135.64 C
ATOM 8142 C GLU B 420 169.535 168.131 94.566 1.00135.64 C
ATOM 8143 O GLU B 420 170.527 167.583 94.067 1.00135.64 O
ATOM 8144 CB GLU B 420 167.994 166.618 93.329 1.00135.64 C
ATOM 8145 N HIS B 421 169.581 169.385 95.027 1.00140.99 N
ATOM 8146 CA HIS B 421 170.859 170.078 95.138 1.00140.99 C
ATOM 8147 C HIS B 421 171.683 169.492 96.274 1.00140.99 C
ATOM 8148 O HIS B 421 172.918 169.466 96.216 1.00140.99 O
ATOM 8149 CB HIS B 421 170.628 171.575 95.347 1.00140.99 C
ATOM 8150 N ASP B 422 171.010 169.016 97.316 1.00140.01 N
ATOM 8151 CA ASP B 422 171.628 168.248 98.383 1.00140.01 C
ATOM 8152 C ASP B 422 171.358 166.755 98.255 1.00140.01 C
ATOM 8153 O ASP B 422 171.096 166.100 99.269 1.00140.01 O
ATOM 8154 CB ASP B 422 171.135 168.751 99.744 1.00140.01 C
ATOM 8155 N ARG B 423 171.379 166.214 97.034 1.00140.28 N
ATOM 8156 CA ARG B 423 171.151 164.785 96.842 1.00140.28 C
ATOM 8157 C ARG B 423 172.295 163.960 97.425 1.00140.28 C
ATOM 8158 O ARG B 423 172.067 162.934 98.078 1.00140.28 O
ATOM 8159 CB ARG B 423 170.967 164.481 95.355 1.00140.28 C
ATOM 8160 N ASP B 424 173.537 164.395 97.199 1.00130.40 N
ATOM 8161 CA ASP B 424 174.671 163.741 97.847 1.00130.40 C
ATOM 8162 C ASP B 424 174.703 164.059 99.336 1.00130.40 C
ATOM 8163 O ASP B 424 175.176 163.248 100.140 1.00130.40 O
ATOM 8164 CB ASP B 424 175.976 164.166 97.177 1.00130.40 C
ATOM 8165 N ASN B 425 174.196 165.231 99.719 1.00122.84 N
ATOM 8166 CA ASN B 425 174.132 165.639 101.121 1.00122.84 C
ATOM 8167 C ASN B 425 172.901 165.005 101.759 1.00122.84 C
ATOM 8168 O ASN B 425 171.874 165.643 102.002 1.00122.84 O
ATOM 8169 CB ASN B 425 174.111 167.156 101.242 1.00122.84 C
ATOM 8170 N TRP B 426 173.033 163.718 102.074 1.00117.08 N
ATOM 8171 CA TRP B 426 172.000 162.958 102.764 1.00117.08 C
ATOM 8172 C TRP B 426 171.897 163.375 104.223 1.00117.08 C
ATOM 8173 O TRP B 426 170.916 163.060 104.900 1.00117.08 O
ATOM 8174 CB TRP B 426 172.307 161.464 102.666 1.00117.08 C
ATOM 8175 CG TRP B 426 173.652 161.108 103.232 1.00117.08 C
ATOM 8176 CD1 TRP B 426 174.844 161.117 102.570 1.00117.08 C
ATOM 8177 CD2 TRP B 426 173.943 160.689 104.570 1.00117.08 C
ATOM 8178 NE1 TRP B 426 175.857 160.735 103.411 1.00117.08 N
ATOM 8179 CE2 TRP B 426 175.330 160.464 104.646 1.00117.08 C
ATOM 8180 CE3 TRP B 426 173.165 160.482 105.712 1.00117.08 C
ATOM 8181 CZ2 TRP B 426 175.955 160.042 105.817 1.00117.08 C
ATOM 8182 CZ3 TRP B 426 173.787 160.064 106.872 1.00117.08 C
ATOM 8183 CH2 TRP B 426 175.168 159.848 106.915 1.00117.08 C
ATOM 8184 N ASN B 427 172.914 164.088 104.700 1.00106.48 N
ATOM 8185 CA ASN B 427 173.008 164.585 106.060 1.00106.48 C
ATOM 8186 C ASN B 427 171.871 165.526 106.426 1.00106.48 C
ATOM 8187 O ASN B 427 171.416 165.517 107.573 1.00106.48 O
ATOM 8188 CB ASN B 427 174.348 165.310 106.232 1.00106.48 C
ATOM 8189 CG ASN B 427 174.737 165.500 107.676 1.00106.48 C
ATOM 8190 OD1 ASN B 427 174.052 165.047 108.589 1.00106.48 O
ATOM 8191 ND2 ASN B 427 175.849 166.185 107.893 1.00106.48 N
ATOM 8192 N GLY B 428 171.378 166.314 105.473 1.00103.21 N
ATOM 8193 CA GLY B 428 170.275 167.211 105.773 1.00103.21 C
ATOM 8194 C GLY B 428 168.948 166.488 105.886 1.00103.21 C
ATOM 8195 O GLY B 428 168.078 166.892 106.665 1.00103.21 O
ATOM 8196 N GLN B 429 168.771 165.411 105.112 1.00104.18 N
ATOM 8197 CA GLN B 429 167.521 164.660 105.156 1.00104.18 C
ATOM 8198 C GLN B 429 167.356 163.948 106.489 1.00104.18 C
ATOM 8199 O GLN B 429 166.232 163.760 106.968 1.00104.18 O
ATOM 8200 CB GLN B 429 167.466 163.649 104.013 1.00104.18 C
ATOM 8201 CG GLN B 429 167.453 164.264 102.631 1.00104.18 C
ATOM 8202 CD GLN B 429 167.332 163.221 101.535 1.00104.18 C
ATOM 8203 OE1 GLN B 429 167.258 162.027 101.807 1.00104.18 O
ATOM 8204 NE2 GLN B 429 167.318 163.671 100.288 1.00104.18 N
ATOM 8205 N LEU B 430 168.470 163.571 107.118 1.00 98.26 N
ATOM 8206 CA LEU B 430 168.389 162.910 108.412 1.00 98.26 C
ATOM 8207 C LEU B 430 167.974 163.890 109.496 1.00 98.26 C
ATOM 8208 O LEU B 430 167.158 163.558 110.360 1.00 98.26 O
ATOM 8209 CB LEU B 430 169.723 162.258 108.754 1.00 98.26 C
ATOM 8210 CG LEU B 430 169.669 161.322 109.951 1.00 98.26 C
ATOM 8211 CD1 LEU B 430 168.729 160.184 109.636 1.00 98.26 C
ATOM 8212 CD2 LEU B 430 171.048 160.796 110.232 1.00 98.26 C
ATOM 8213 N LYS B 431 168.492 165.119 109.445 1.00 93.07 N
ATOM 8214 CA LYS B 431 168.039 166.143 110.381 1.00 93.07 C
ATOM 8215 C LYS B 431 166.592 166.532 110.110 1.00 93.07 C
ATOM 8216 O LYS B 431 165.842 166.856 111.039 1.00 93.07 O
ATOM 8217 CB LYS B 431 168.945 167.367 110.301 1.00 93.07 C
ATOM 8218 CG LYS B 431 170.339 167.126 110.832 1.00 93.07 C
ATOM 8219 CD LYS B 431 171.159 168.394 110.792 1.00 93.07 C
ATOM 8220 CE LYS B 431 172.563 168.160 111.298 1.00 93.07 C
ATOM 8221 NZ LYS B 431 173.362 169.409 111.232 1.00 93.07 N
ATOM 8222 N LEU B 432 166.183 166.486 108.840 1.00 92.87 N
ATOM 8223 CA LEU B 432 164.802 166.789 108.489 1.00 92.87 C
ATOM 8224 C LEU B 432 163.846 165.742 109.045 1.00 92.87 C
ATOM 8225 O LEU B 432 162.791 166.082 109.589 1.00 92.87 O
ATOM 8226 CB LEU B 432 164.668 166.888 106.976 1.00 92.87 C
ATOM 8227 CG LEU B 432 163.285 167.310 106.508 1.00 92.87 C
ATOM 8228 CD1 LEU B 432 162.978 168.689 107.034 1.00 92.87 C
ATOM 8229 CD2 LEU B 432 163.233 167.289 105.000 1.00 92.87 C
ATOM 8230 N LEU B 433 164.213 164.463 108.945 1.00 91.27 N
ATOM 8231 CA LEU B 433 163.398 163.405 109.535 1.00 91.27 C
ATOM 8232 C LEU B 433 163.667 163.263 111.027 1.00 91.27 C
ATOM 8233 O LEU B 433 163.076 162.407 111.693 1.00 91.27 O
ATOM 8234 CB LEU B 433 163.657 162.087 108.816 1.00 91.27 C
ATOM 8235 CG LEU B 433 163.114 162.046 107.397 1.00 91.27 C
ATOM 8236 CD1 LEU B 433 163.634 160.839 106.656 1.00 91.27 C
ATOM 8237 CD2 LEU B 433 161.604 162.020 107.464 1.00 91.27 C
ATOM 8238 N LEU B 434 164.599 164.050 111.555 1.00 84.15 N
ATOM 8239 CA LEU B 434 164.766 164.123 112.999 1.00 84.15 C
ATOM 8240 C LEU B 434 163.859 165.183 113.610 1.00 84.15 C
ATOM 8241 O LEU B 434 163.346 164.999 114.721 1.00 84.15 O
ATOM 8242 CB LEU B 434 166.227 164.396 113.330 1.00 84.15 C
ATOM 8243 CG LEU B 434 166.584 164.633 114.794 1.00 84.15 C
ATOM 8244 CD1 LEU B 434 166.215 163.448 115.648 1.00 84.15 C
ATOM 8245 CD2 LEU B 434 168.062 164.918 114.913 1.00 84.15 C
ATOM 8246 N GLU B 435 163.644 166.296 112.902 1.00 95.18 N
ATOM 8247 CA GLU B 435 162.816 167.370 113.448 1.00 95.18 C
ATOM 8248 C GLU B 435 161.363 166.944 113.579 1.00 95.18 C
ATOM 8249 O GLU B 435 160.753 167.115 114.639 1.00 95.18 O
ATOM 8250 CB GLU B 435 162.924 168.622 112.583 1.00 95.18 C
ATOM 8251 CG GLU B 435 164.254 169.323 112.699 1.00 95.18 C
ATOM 8252 CD GLU B 435 164.449 169.940 114.063 1.00 95.18 C
ATOM 8253 OE1 GLU B 435 163.445 170.381 114.664 1.00 95.18 O
ATOM 8254 OE2 GLU B 435 165.602 169.978 114.539 1.00 95.18 O
ATOM 8255 N TRP B 436 160.798 166.378 112.526 1.00 88.30 N
ATOM 8256 CA TRP B 436 159.508 165.716 112.604 1.00 88.30 C
ATOM 8257 C TRP B 436 159.750 164.234 112.823 1.00 88.30 C
ATOM 8258 O TRP B 436 160.533 163.620 112.096 1.00 88.30 O
ATOM 8259 CB TRP B 436 158.698 165.949 111.335 1.00 88.30 C
ATOM 8260 CG TRP B 436 158.249 167.353 111.178 1.00 88.30 C
ATOM 8261 CD1 TRP B 436 157.056 167.879 111.564 1.00 88.30 C
ATOM 8262 CD2 TRP B 436 159.000 168.424 110.623 1.00 88.30 C
ATOM 8263 NE1 TRP B 436 157.011 169.216 111.268 1.00 88.30 N
ATOM 8264 CE2 TRP B 436 158.197 169.573 110.689 1.00 88.30 C
ATOM 8265 CE3 TRP B 436 160.274 168.524 110.070 1.00 88.30 C
ATOM 8266 CZ2 TRP B 436 158.626 170.803 110.224 1.00 88.30 C
ATOM 8267 CZ3 TRP B 436 160.698 169.745 109.611 1.00 88.30 C
ATOM 8268 CH2 TRP B 436 159.879 170.869 109.688 1.00 88.30 C
ATOM 8269 N ASN B 437 159.088 163.665 113.821 1.00 89.08 N
ATOM 8270 CA ASN B 437 159.353 162.288 114.229 1.00 89.08 C
ATOM 8271 C ASN B 437 158.743 161.346 113.200 1.00 89.08 C
ATOM 8272 O ASN B 437 157.530 161.138 113.172 1.00 89.08 O
ATOM 8273 CB ASN B 437 158.791 162.034 115.622 1.00 89.08 C
ATOM 8274 CG ASN B 437 159.282 160.734 116.231 1.00 89.08 C
ATOM 8275 OD1 ASN B 437 160.044 159.990 115.620 1.00 89.08 O
ATOM 8276 ND2 ASN B 437 158.842 160.460 117.451 1.00 89.08 N
ATOM 8277 N GLN B 438 159.588 160.778 112.339 1.00 99.66 N
ATOM 8278 CA GLN B 438 159.197 159.702 111.428 1.00 99.66 C
ATOM 8279 C GLN B 438 160.294 158.639 111.429 1.00 99.66 C
ATOM 8280 O GLN B 438 161.369 158.828 110.860 1.00 99.66 O
ATOM 8281 CB GLN B 438 158.932 160.211 110.022 1.00 99.66 C
ATOM 8282 CG GLN B 438 157.652 160.968 109.864 1.00 99.66 C
ATOM 8283 CD GLN B 438 157.391 161.292 108.424 1.00 99.66 C
ATOM 8284 OE1 GLN B 438 158.227 161.036 107.564 1.00 99.66 O
ATOM 8285 NE2 GLN B 438 156.217 161.835 108.143 1.00 99.66 N
ATOM 8286 N LEU B 439 160.015 157.514 112.083 1.00100.24 N
ATOM 8287 CA LEU B 439 161.005 156.448 112.148 1.00100.24 C
ATOM 8288 C LEU B 439 161.058 155.653 110.853 1.00100.24 C
ATOM 8289 O LEU B 439 162.139 155.455 110.286 1.00100.24 O
ATOM 8290 CB LEU B 439 160.706 155.518 113.318 1.00100.24 C
ATOM 8291 CG LEU B 439 161.702 154.369 113.437 1.00100.24 C
ATOM 8292 CD1 LEU B 439 163.087 154.899 113.742 1.00100.24 C
ATOM 8293 CD2 LEU B 439 161.257 153.367 114.484 1.00100.24 C
ATOM 8294 N ASP B 440 159.897 155.190 110.374 1.00101.82 N
ATOM 8295 CA ASP B 440 159.857 154.141 109.357 1.00101.82 C
ATOM 8296 C ASP B 440 160.344 154.641 108.006 1.00101.82 C
ATOM 8297 O ASP B 440 161.083 153.937 107.306 1.00101.82 O
ATOM 8298 CB ASP B 440 158.441 153.583 109.238 1.00101.82 C
ATOM 8299 N LEU B 441 159.946 155.856 107.626 1.00100.13 N
ATOM 8300 CA LEU B 441 160.420 156.433 106.375 1.00100.13 C
ATOM 8301 C LEU B 441 161.916 156.711 106.425 1.00100.13 C
ATOM 8302 O LEU B 441 162.609 156.557 105.412 1.00100.13 O
ATOM 8303 CB LEU B 441 159.635 157.705 106.066 1.00100.13 C
ATOM 8304 CG LEU B 441 159.933 158.413 104.748 1.00100.13 C
ATOM 8305 CD1 LEU B 441 159.669 157.484 103.588 1.00100.13 C
ATOM 8306 CD2 LEU B 441 159.078 159.655 104.624 1.00100.13 C
ATOM 8307 N ALA B 442 162.434 157.068 107.601 1.00 99.43 N
ATOM 8308 CA ALA B 442 163.866 157.281 107.757 1.00 99.43 C
ATOM 8309 C ALA B 442 164.650 155.983 107.673 1.00 99.43 C
ATOM 8310 O ALA B 442 165.753 155.966 107.117 1.00 99.43 O
ATOM 8311 CB ALA B 442 164.152 157.969 109.088 1.00 99.43 C
ATOM 8312 N SER B 443 164.106 154.894 108.214 1.00107.58 N
ATOM 8313 CA SER B 443 164.801 153.616 108.132 1.00107.58 C
ATOM 8314 C SER B 443 164.736 153.037 106.728 1.00107.58 C
ATOM 8315 O SER B 443 165.694 152.397 106.281 1.00107.58 O
ATOM 8316 CB SER B 443 164.211 152.625 109.131 1.00107.58 C
ATOM 8317 OG SER B 443 162.883 152.285 108.775 1.00107.58 O
ATOM 8318 N ASP B 444 163.630 153.254 106.020 1.00106.63 N
ATOM 8319 CA ASP B 444 163.493 152.710 104.676 1.00106.63 C
ATOM 8320 C ASP B 444 164.278 153.506 103.642 1.00106.63 C
ATOM 8321 O ASP B 444 164.919 152.914 102.767 1.00106.63 O
ATOM 8322 CB ASP B 444 162.016 152.652 104.281 1.00106.63 C
ATOM 8323 N GLU B 445 164.257 154.836 103.721 1.00102.00 N
ATOM 8324 CA GLU B 445 164.869 155.647 102.678 1.00102.00 C
ATOM 8325 C GLU B 445 166.386 155.721 102.799 1.00102.00 C
ATOM 8326 O GLU B 445 167.104 155.307 101.884 1.00102.00 O
ATOM 8327 CB GLU B 445 164.277 157.057 102.695 1.00102.00 C
ATOM 8328 N ILE B 446 166.886 156.240 103.921 1.00101.59 N
ATOM 8329 CA ILE B 446 168.296 156.615 103.998 1.00101.59 C
ATOM 8330 C ILE B 446 169.176 155.395 104.234 1.00101.59 C
ATOM 8331 O ILE B 446 170.219 155.230 103.590 1.00101.59 O
ATOM 8332 CB ILE B 446 168.506 157.672 105.094 1.00101.59 C
ATOM 8333 CG1 ILE B 446 167.650 158.900 104.823 1.00101.59 C
ATOM 8334 CG2 ILE B 446 169.951 158.097 105.153 1.00101.59 C
ATOM 8335 CD1 ILE B 446 167.650 159.886 105.968 1.00101.59 C
ATOM 8336 N PHE B 447 168.771 154.551 105.175 1.00103.32 N
ATOM 8337 CA PHE B 447 169.570 153.385 105.537 1.00103.32 C
ATOM 8338 C PHE B 447 169.463 152.149 104.644 1.00103.32 C
ATOM 8339 O PHE B 447 169.121 151.063 105.110 1.00103.32 O
ATOM 8340 CB PHE B 447 169.350 153.020 107.007 1.00103.32 C
ATOM 8341 CG PHE B 447 169.890 154.042 107.964 1.00103.32 C
ATOM 8342 CD1 PHE B 447 171.252 154.155 108.179 1.00103.32 C
ATOM 8343 CD2 PHE B 447 169.040 154.898 108.640 1.00103.32 C
ATOM 8344 CE1 PHE B 447 171.759 155.097 109.050 1.00103.32 C
ATOM 8345 CE2 PHE B 447 169.538 155.843 109.516 1.00103.32 C
ATOM 8346 CZ PHE B 447 170.900 155.943 109.721 1.00103.32 C
ATOM 8347 N THR B 448 169.761 152.324 103.360 1.00113.84 N
ATOM 8348 CA THR B 448 169.768 151.211 102.421 1.00113.84 C
ATOM 8349 C THR B 448 171.171 150.634 102.534 1.00113.84 C
ATOM 8350 O THR B 448 172.134 151.388 102.696 1.00113.84 O
ATOM 8351 CB THR B 448 169.521 151.676 100.979 1.00113.84 C
ATOM 8352 OG1 THR B 448 170.672 152.380 100.498 1.00113.84 O
ATOM 8353 CG2 THR B 448 168.304 152.588 100.917 1.00113.84 C
ATOM 8354 N ASN B 449 171.315 149.315 102.447 1.00113.05 N
ATOM 8355 CA ASN B 449 172.650 148.741 102.611 1.00113.05 C
ATOM 8356 C ASN B 449 173.649 149.264 101.581 1.00113.05 C
ATOM 8357 O ASN B 449 174.820 148.866 101.602 1.00113.05 O
ATOM 8358 CB ASN B 449 172.572 147.216 102.538 1.00113.05 C
ATOM 8359 N ASP B 450 173.216 150.145 100.676 1.00121.84 N
ATOM 8360 CA ASP B 450 174.122 150.675 99.665 1.00121.84 C
ATOM 8361 C ASP B 450 175.145 151.630 100.269 1.00121.84 C
ATOM 8362 O ASP B 450 176.349 151.355 100.241 1.00121.84 O
ATOM 8363 CB ASP B 450 173.320 151.372 98.566 1.00121.84 C
ATOM 8364 N ARG B 451 174.665 152.733 100.838 1.00126.81 N
ATOM 8365 CA ARG B 451 175.533 153.753 101.433 1.00126.81 C
ATOM 8366 C ARG B 451 176.405 153.270 102.597 1.00126.81 C
ATOM 8367 O ARG B 451 176.086 152.293 103.273 1.00126.81 O
ATOM 8368 CB ARG B 451 174.703 154.962 101.872 1.00126.81 C
ATOM 8369 N ASN B 452 177.507 153.984 102.821 1.00125.66 N
ATOM 8370 CA ASN B 452 178.448 153.667 103.893 1.00125.66 C
ATOM 8371 C ASN B 452 178.552 154.800 104.909 1.00125.66 C
ATOM 8372 O ASN B 452 178.691 155.966 104.539 1.00125.66 O
ATOM 8373 CB ASN B 452 179.828 153.344 103.319 1.00125.66 C
ATOM 8374 CG ASN B 452 179.838 152.061 102.514 1.00125.66 C
ATOM 8375 OD1 ASN B 452 178.914 151.253 102.601 1.00125.66 O
ATOM 8376 ND2 ASN B 452 180.888 151.866 101.726 1.00125.66 N
ATOM 8377 N TRP B 453 178.481 154.451 106.189 1.00122.59 N
ATOM 8378 CA TRP B 453 178.539 155.441 107.263 1.00122.59 C
ATOM 8379 C TRP B 453 179.494 155.064 108.397 1.00122.59 C
ATOM 8380 O TRP B 453 179.680 153.888 108.702 1.00122.59 O
ATOM 8381 CB TRP B 453 177.132 155.674 107.820 1.00122.59 C
ATOM 8382 CG TRP B 453 176.188 154.562 107.482 1.00122.59 C
ATOM 8383 CD1 TRP B 453 176.226 153.285 107.958 1.00122.59 C
ATOM 8384 CD2 TRP B 453 175.084 154.619 106.574 1.00122.59 C
ATOM 8385 NE1 TRP B 453 175.207 152.545 107.408 1.00122.59 N
ATOM 8386 CE2 TRP B 453 174.490 153.343 106.556 1.00122.59 C
ATOM 8387 CE3 TRP B 453 174.534 155.629 105.777 1.00122.59 C
ATOM 8388 CZ2 TRP B 453 173.377 153.047 105.772 1.00122.59 C
ATOM 8389 CZ3 TRP B 453 173.428 155.334 105.001 1.00122.59 C
ATOM 8390 CH2 TRP B 453 172.861 154.055 105.005 1.00122.59 C
ATOM 8391 N GLU B 454 180.093 156.079 109.015 1.00113.33 N
ATOM 8392 CA GLU B 454 181.015 155.880 110.130 1.00113.33 C
ATOM 8393 C GLU B 454 180.393 156.455 111.399 1.00113.33 C
ATOM 8394 O GLU B 454 179.240 156.882 111.381 1.00113.33 O
ATOM 8395 CB GLU B 454 182.358 156.552 109.846 1.00113.33 C
ATOM 8396 N SER B 455 181.143 156.473 112.497 1.00107.50 N
ATOM 8397 CA SER B 455 180.598 157.007 113.742 1.00107.50 C
ATOM 8398 C SER B 455 180.654 158.530 113.762 1.00107.50 C
ATOM 8399 O SER B 455 179.698 159.187 114.200 1.00107.50 O
ATOM 8400 CB SER B 455 181.360 156.432 114.934 1.00107.50 C
ATOM 8401 N ALA B 456 181.756 159.103 113.263 1.00104.56 N
ATOM 8402 CA ALA B 456 181.938 160.553 113.259 1.00104.56 C
ATOM 8403 C ALA B 456 180.946 161.240 112.332 1.00104.56 C
ATOM 8404 O ALA B 456 180.664 162.434 112.485 1.00104.56 O
ATOM 8405 CB ALA B 456 183.370 160.897 112.854 1.00104.56 C
ATOM 8406 N ASP B 457 180.425 160.508 111.349 1.00104.56 N
ATOM 8407 CA ASP B 457 179.293 161.005 110.585 1.00104.56 C
ATOM 8408 C ASP B 457 178.054 161.133 111.462 1.00104.56 C
ATOM 8409 O ASP B 457 177.268 162.072 111.304 1.00104.56 O
ATOM 8410 CB ASP B 457 179.020 160.080 109.401 1.00104.56 C
ATOM 8411 N LEU B 458 177.797 160.165 112.334 1.00 95.90 N
ATOM 8412 CA LEU B 458 176.551 160.194 113.116 1.00 95.90 C
ATOM 8413 C LEU B 458 176.550 160.911 114.461 1.00 95.90 C
ATOM 8414 O LEU B 458 175.495 161.146 115.042 1.00 95.90 O
ATOM 8415 CB LEU B 458 176.030 158.768 113.315 1.00 95.90 C
ATOM 8416 CG LEU B 458 175.559 158.057 112.049 1.00 95.90 C
ATOM 8417 CD1 LEU B 458 175.062 156.659 112.377 1.00 95.90 C
ATOM 8418 CD2 LEU B 458 174.469 158.867 111.368 1.00 95.90 C
ATOM 8419 N GLN B 459 177.725 161.275 114.940 1.00 90.48 N
ATOM 8420 CA GLN B 459 177.873 161.920 116.253 1.00 90.48 C
ATOM 8421 C GLN B 459 176.996 163.145 116.517 1.00 90.48 C
ATOM 8422 O GLN B 459 176.274 163.202 117.525 1.00 90.48 O
ATOM 8423 CB GLN B 459 179.338 162.314 116.452 1.00 30.00 C
ATOM 8424 CG GLN B 459 180.295 161.137 116.521 1.00 30.00 C
ATOM 8425 CD GLN B 459 181.742 161.566 116.645 1.00 30.00 C
ATOM 8426 OE1 GLN B 459 182.106 162.670 116.237 1.00 30.00 O
ATOM 8427 NE2 GLN B 459 182.573 160.696 117.211 1.00 30.00 N
ATOM 8428 N ASP B 460 177.057 164.124 115.616 1.00 81.09 N
ATOM 8429 CA ASP B 460 176.345 165.379 115.826 1.00 81.09 C
ATOM 8430 C ASP B 460 174.840 165.193 115.714 1.00 81.09 C
ATOM 8431 O ASP B 460 174.076 165.863 116.414 1.00 81.09 O
ATOM 8432 CB ASP B 460 176.832 166.430 114.831 1.00 81.09 C
ATOM 8433 N VAL B 461 174.402 164.281 114.847 1.00 78.89 N
ATOM 8434 CA VAL B 461 172.984 163.962 114.761 1.00 78.89 C
ATOM 8435 C VAL B 461 172.542 163.191 115.997 1.00 78.89 C
ATOM 8436 O VAL B 461 171.418 163.352 116.485 1.00 78.89 O
ATOM 8437 CB VAL B 461 172.719 163.173 113.470 1.00 78.89 C
ATOM 8438 CG1 VAL B 461 171.251 162.878 113.309 1.00 78.89 C
ATOM 8439 CG2 VAL B 461 173.249 163.940 112.283 1.00 78.89 C
ATOM 8440 N MET B 462 173.434 162.357 116.532 1.00 79.10 N
ATOM 8441 CA MET B 462 173.125 161.555 117.709 1.00 79.10 C
ATOM 8442 C MET B 462 172.913 162.430 118.931 1.00 79.10 C
ATOM 8443 O MET B 462 172.039 162.150 119.763 1.00 79.10 O
ATOM 8444 CB MET B 462 174.262 160.575 117.959 1.00 79.10 C
ATOM 8445 CG MET B 462 174.011 159.554 119.030 1.00 79.10 C
ATOM 8446 SD MET B 462 172.767 158.370 118.523 1.00 79.10 S
ATOM 8447 CE MET B 462 172.359 157.658 120.103 1.00 79.10 C
ATOM 8448 N PHE B 463 173.708 163.495 119.049 1.00 68.01 N
ATOM 8449 CA PHE B 463 173.609 164.372 120.214 1.00 68.01 C
ATOM 8450 C PHE B 463 172.261 165.079 120.280 1.00 68.01 C
ATOM 8451 O PHE B 463 171.630 165.132 121.343 1.00 68.01 O
ATOM 8452 CB PHE B 463 174.736 165.398 120.202 1.00 68.01 C
ATOM 8453 CG PHE B 463 174.678 166.347 121.350 1.00 68.01 C
ATOM 8454 CD1 PHE B 463 175.026 165.932 122.616 1.00 68.01 C
ATOM 8455 CD2 PHE B 463 174.273 167.654 121.164 1.00 68.01 C
ATOM 8456 CE1 PHE B 463 174.970 166.804 123.680 1.00 68.01 C
ATOM 8457 CE2 PHE B 463 174.213 168.529 122.223 1.00 68.01 C
ATOM 8458 CZ PHE B 463 174.563 168.105 123.481 1.00 68.01 C
ATOM 8459 N THR B 464 171.793 165.608 119.151 1.00 68.50 N
ATOM 8460 CA THR B 464 170.521 166.320 119.151 1.00 68.50 C
ATOM 8461 C THR B 464 169.354 165.364 119.345 1.00 68.50 C
ATOM 8462 O THR B 464 168.309 165.753 119.874 1.00 68.50 O
ATOM 8463 CB THR B 464 170.360 167.107 117.858 1.00 68.50 C
ATOM 8464 OG1 THR B 464 170.428 166.209 116.749 1.00 68.50 O
ATOM 8465 CG2 THR B 464 171.461 168.139 117.728 1.00 68.50 C
ATOM 8466 N ALA B 465 169.515 164.106 118.937 1.00 64.74 N
ATOM 8467 CA ALA B 465 168.475 163.120 119.204 1.00 64.74 C
ATOM 8468 C ALA B 465 168.470 162.724 120.671 1.00 64.74 C
ATOM 8469 O ALA B 465 167.444 162.299 121.209 1.00 64.74 O
ATOM 8470 CB ALA B 465 168.667 161.896 118.316 1.00 64.74 C
ATOM 8471 N LEU B 466 169.626 162.830 121.327 1.00 61.78 N
ATOM 8472 CA LEU B 466 169.651 162.701 122.780 1.00 61.78 C
ATOM 8473 C LEU B 466 169.020 163.904 123.462 1.00 61.78 C
ATOM 8474 O LEU B 466 168.553 163.796 124.601 1.00 61.78 O
ATOM 8475 CB LEU B 466 171.078 162.513 123.287 1.00 61.78 C
ATOM 8476 CG LEU B 466 171.519 161.112 123.676 1.00 61.78 C
ATOM 8477 CD1 LEU B 466 170.776 160.730 124.925 1.00 61.78 C
ATOM 8478 CD2 LEU B 466 171.213 160.139 122.584 1.00 61.78 C
ATOM 8479 N VAL B 467 169.035 165.068 122.804 1.00 66.75 N
ATOM 8480 CA VAL B 467 168.543 166.285 123.450 1.00 66.75 C
ATOM 8481 C VAL B 467 167.038 166.229 123.667 1.00 66.75 C
ATOM 8482 O VAL B 467 166.560 166.377 124.797 1.00 66.75 O
ATOM 8483 CB VAL B 467 168.946 167.533 122.647 1.00 66.75 C
ATOM 8484 CG1 VAL B 467 168.194 168.743 123.148 1.00 66.75 C
ATOM 8485 CG2 VAL B 467 170.424 167.788 122.801 1.00 66.75 C
ATOM 8486 N LYS B 468 166.265 165.993 122.614 1.00 68.74 N
ATOM 8487 CA LYS B 468 164.817 166.128 122.707 1.00 68.74 C
ATOM 8488 C LYS B 468 164.099 164.821 122.326 1.00 68.74 C
ATOM 8489 O LYS B 468 163.496 164.718 121.258 1.00 68.74 O
ATOM 8490 CB LYS B 468 164.373 167.318 121.850 1.00 68.74 C
ATOM 8491 CG LYS B 468 165.012 167.355 120.460 1.00 68.74 C
ATOM 8492 CD LYS B 468 164.517 168.518 119.644 1.00 68.74 C
ATOM 8493 CE LYS B 468 165.146 168.515 118.264 1.00 68.74 C
ATOM 8494 NZ LYS B 468 164.659 169.652 117.434 1.00 68.74 N
ATOM 8495 N ASP B 469 164.123 163.871 123.277 1.00 66.85 N
ATOM 8496 CA ASP B 469 163.193 162.734 123.441 1.00 66.85 C
ATOM 8497 C ASP B 469 162.805 162.015 122.146 1.00 66.85 C
ATOM 8498 O ASP B 469 161.636 161.968 121.769 1.00 66.85 O
ATOM 8499 CB ASP B 469 161.941 163.189 124.189 1.00 66.85 C
ATOM 8500 N ARG B 470 163.784 161.450 121.452 1.00 66.29 N
ATOM 8501 CA ARG B 470 163.524 160.696 120.225 1.00 66.29 C
ATOM 8502 C ARG B 470 164.025 159.267 120.386 1.00 66.29 C
ATOM 8503 O ARG B 470 165.038 158.883 119.793 1.00 66.29 O
ATOM 8504 CB ARG B 470 164.170 161.379 119.021 1.00 66.29 C
ATOM 8505 CG ARG B 470 163.549 162.713 118.690 1.00 66.29 C
ATOM 8506 CD ARG B 470 162.146 162.539 118.147 1.00 66.29 C
ATOM 8507 NE ARG B 470 161.562 163.808 117.729 1.00 66.29 N
ATOM 8508 CZ ARG B 470 160.817 164.576 118.513 1.00 66.29 C
ATOM 8509 NH1 ARG B 470 160.560 164.203 119.757 1.00 66.29 N
ATOM 8510 NH2 ARG B 470 160.324 165.714 118.054 1.00 66.29 N
ATOM 8511 N PRO B 471 163.308 158.440 121.152 1.00 59.39 N
ATOM 8512 CA PRO B 471 163.886 157.155 121.580 1.00 59.39 C
ATOM 8513 C PRO B 471 163.983 156.107 120.482 1.00 59.39 C
ATOM 8514 O PRO B 471 164.988 155.384 120.412 1.00 59.39 O
ATOM 8515 CB PRO B 471 162.937 156.721 122.701 1.00 59.39 C
ATOM 8516 CG PRO B 471 161.643 157.348 122.345 1.00 59.39 C
ATOM 8517 CD PRO B 471 161.956 158.649 121.696 1.00 59.39 C
ATOM 8518 N LYS B 472 162.960 155.998 119.628 1.00 64.17 N
ATOM 8519 CA LYS B 472 163.043 155.128 118.461 1.00 64.17 C
ATOM 8520 C LYS B 472 164.164 155.574 117.545 1.00 64.17 C
ATOM 8521 O LYS B 472 164.886 154.755 116.955 1.00 64.17 O
ATOM 8522 CB LYS B 472 161.720 155.154 117.708 1.00 64.17 C
ATOM 8523 CG LYS B 472 160.566 154.568 118.467 1.00 64.17 C
ATOM 8524 CD LYS B 472 159.305 154.654 117.642 1.00 64.17 C
ATOM 8525 CE LYS B 472 158.112 154.145 118.419 1.00 64.17 C
ATOM 8526 NZ LYS B 472 156.850 154.260 117.647 1.00 64.17 N
ATOM 8527 N PHE B 473 164.370 156.878 117.479 1.00 70.36 N
ATOM 8528 CA PHE B 473 165.429 157.419 116.666 1.00 70.36 C
ATOM 8529 C PHE B 473 166.771 157.338 117.379 1.00 70.36 C
ATOM 8530 O PHE B 473 167.771 157.780 116.826 1.00 70.36 O
ATOM 8531 CB PHE B 473 165.082 158.856 116.303 1.00 70.36 C
ATOM 8532 CG PHE B 473 165.601 159.284 114.974 1.00 70.36 C
ATOM 8533 CD1 PHE B 473 164.917 158.935 113.823 1.00 70.36 C
ATOM 8534 CD2 PHE B 473 166.759 160.028 114.864 1.00 70.36 C
ATOM 8535 CE1 PHE B 473 165.376 159.322 112.595 1.00 70.36 C
ATOM 8536 CE2 PHE B 473 167.222 160.423 113.629 1.00 70.36 C
ATOM 8537 CZ PHE B 473 166.532 160.066 112.496 1.00 70.36 C
ATOM 8538 N VAL B 474 166.808 156.803 118.602 1.00 62.84 N
ATOM 8539 CA VAL B 474 168.064 156.360 119.192 1.00 62.84 C
ATOM 8540 C VAL B 474 168.301 154.881 118.912 1.00 62.84 C
ATOM 8541 O VAL B 474 169.444 154.489 118.639 1.00 62.84 O
ATOM 8542 CB VAL B 474 168.072 156.669 120.699 1.00 62.84 C
ATOM 8543 CG1 VAL B 474 169.273 156.079 121.398 1.00 62.84 C
ATOM 8544 CG2 VAL B 474 168.077 158.151 120.912 1.00 62.84 C
ATOM 8545 N ARG B 475 167.236 154.058 118.942 1.00 66.40 N
ATOM 8546 CA ARG B 475 167.338 152.642 118.564 1.00 66.40 C
ATOM 8547 C ARG B 475 167.862 152.468 117.148 1.00 66.40 C
ATOM 8548 O ARG B 475 168.601 151.513 116.870 1.00 66.40 O
ATOM 8549 CB ARG B 475 165.978 151.956 118.669 1.00 66.40 C
ATOM 8550 CG ARG B 475 165.484 151.775 120.064 1.00 66.40 C
ATOM 8551 CD ARG B 475 166.189 150.638 120.763 1.00 66.40 C
ATOM 8552 NE ARG B 475 165.738 149.349 120.264 1.00 66.40 N
ATOM 8553 CZ ARG B 475 164.713 148.683 120.780 1.00 66.40 C
ATOM 8554 NH1 ARG B 475 164.054 149.188 121.812 1.00 66.40 N1+
ATOM 8555 NH2 ARG B 475 164.352 147.512 120.277 1.00 66.40 N
ATOM 8556 N LEU B 476 167.482 153.384 116.250 1.00 79.48 N
ATOM 8557 CA LEU B 476 167.917 153.293 114.859 1.00 79.48 C
ATOM 8558 C LEU B 476 169.433 153.395 114.723 1.00 79.48 C
ATOM 8559 O LEU B 476 170.045 152.619 113.981 1.00 79.48 O
ATOM 8560 CB LEU B 476 167.249 154.374 114.021 1.00 79.48 C
ATOM 8561 CG LEU B 476 167.579 154.259 112.540 1.00 79.48 C
ATOM 8562 CD1 LEU B 476 167.036 152.949 112.022 1.00 79.48 C
ATOM 8563 CD2 LEU B 476 167.020 155.419 111.758 1.00 79.48 C
ATOM 8564 N PHE B 477 170.067 154.308 115.461 1.00 82.08 N
ATOM 8565 CA PHE B 477 171.511 154.447 115.305 1.00 82.08 C
ATOM 8566 C PHE B 477 172.277 153.317 115.974 1.00 82.08 C
ATOM 8567 O PHE B 477 173.356 152.945 115.499 1.00 82.08 O
ATOM 8568 CB PHE B 477 171.998 155.780 115.846 1.00 82.08 C
ATOM 8569 CG PHE B 477 171.518 156.952 115.069 1.00 82.08 C
ATOM 8570 CD1 PHE B 477 172.038 157.232 113.819 1.00 82.08 C
ATOM 8571 CD2 PHE B 477 170.583 157.800 115.601 1.00 82.08 C
ATOM 8572 CE1 PHE B 477 171.595 158.326 113.102 1.00 82.08 C
ATOM 8573 CE2 PHE B 477 170.134 158.891 114.895 1.00 82.08 C
ATOM 8574 CZ PHE B 477 170.639 159.158 113.648 1.00 82.08 C
ATOM 8575 N LEU B 478 171.753 152.758 117.064 1.00 77.73 N
ATOM 8576 CA LEU B 478 172.425 151.613 117.670 1.00 77.73 C
ATOM 8577 C LEU B 478 172.311 150.377 116.792 1.00 77.73 C
ATOM 8578 O LEU B 478 173.243 149.569 116.733 1.00 77.73 O
ATOM 8579 CB LEU B 478 171.873 151.336 119.060 1.00 77.73 C
ATOM 8580 CG LEU B 478 172.269 152.388 120.087 1.00 77.73 C
ATOM 8581 CD1 LEU B 478 171.650 152.074 121.430 1.00 77.73 C
ATOM 8582 CD2 LEU B 478 173.776 152.461 120.194 1.00 77.73 C
ATOM 8583 N GLU B 479 171.189 150.215 116.085 1.00 88.95 N
ATOM 8584 CA GLU B 479 171.101 149.098 115.152 1.00 88.95 C
ATOM 8585 C GLU B 479 171.914 149.355 113.889 1.00 88.95 C
ATOM 8586 O GLU B 479 172.348 148.410 113.224 1.00 88.95 O
ATOM 8587 CB GLU B 479 169.646 148.797 114.809 1.00 88.95 C
ATOM 8588 CG GLU B 479 168.891 148.193 115.968 1.00 88.95 C
ATOM 8589 CD GLU B 479 167.483 147.810 115.606 1.00 88.95 C
ATOM 8590 OE1 GLU B 479 167.060 148.125 114.478 1.00 88.95 O
ATOM 8591 OE2 GLU B 479 166.801 147.184 116.445 1.00 88.95 O
ATOM 8592 N ASN B 480 172.144 150.624 113.576 1.00 91.42 N
ATOM 8593 CA ASN B 480 172.927 150.973 112.400 1.00 91.42 C
ATOM 8594 C ASN B 480 174.413 151.032 112.715 1.00 91.42 C
ATOM 8595 O ASN B 480 175.236 151.291 111.840 1.00 91.42 O
ATOM 8596 CB ASN B 480 172.436 152.280 111.787 1.00 91.42 C
ATOM 8597 CG ASN B 480 171.154 152.101 111.003 1.00 91.42 C
ATOM 8598 OD1 ASN B 480 170.973 151.093 110.320 1.00 91.42 O
ATOM 8599 ND2 ASN B 480 170.256 153.072 111.100 1.00 91.42 N
ATOM 8600 N GLY B 481 174.749 150.795 113.978 1.00 86.81 N
ATOM 8601 CA GLY B 481 176.133 150.777 114.407 1.00 86.81 C
ATOM 8602 C GLY B 481 176.734 152.064 114.934 1.00 86.81 C
ATOM 8603 O GLY B 481 176.922 153.027 114.195 1.00 86.81 O
ATOM 8604 N LEU B 482 177.043 152.066 116.227 1.00 83.42 N
ATOM 8605 CA LEU B 482 177.668 153.198 116.885 1.00 83.42 C
ATOM 8606 C LEU B 482 178.281 152.726 118.191 1.00 83.42 C
ATOM 8607 O LEU B 482 177.650 151.984 118.948 1.00 83.42 O
ATOM 8608 CB LEU B 482 176.654 154.316 117.133 1.00 83.42 C
ATOM 8609 CG LEU B 482 177.133 155.562 117.862 1.00 83.42 C
ATOM 8610 CD1 LEU B 482 178.291 156.192 117.132 1.00 83.42 C
ATOM 8611 CD2 LEU B 482 175.982 156.531 117.952 1.00 83.42 C
ATOM 8612 N ASN B 483 179.509 153.155 118.450 1.00 78.64 N
ATOM 8613 CA ASN B 483 180.242 152.748 119.639 1.00 78.64 C
ATOM 8614 C ASN B 483 179.902 153.709 120.767 1.00 78.64 C
ATOM 8615 O ASN B 483 180.474 154.799 120.851 1.00 78.64 O
ATOM 8616 CB ASN B 483 181.742 152.732 119.366 1.00 78.64 C
ATOM 8617 CG ASN B 483 182.141 151.653 118.386 1.00 78.64 C
ATOM 8618 OD1 ASN B 483 181.649 150.527 118.452 1.00 78.64 O
ATOM 8619 ND2 ASN B 483 183.034 151.992 117.464 1.00 78.64 N
ATOM 8620 N LEU B 484 178.977 153.294 121.633 1.00 68.25 N
ATOM 8621 CA LEU B 484 178.357 154.231 122.561 1.00 68.25 C
ATOM 8622 C LEU B 484 179.308 154.616 123.684 1.00 68.25 C
ATOM 8623 O LEU B 484 179.262 155.745 124.183 1.00 68.25 O
ATOM 8624 CB LEU B 484 177.067 153.631 123.112 1.00 68.25 C
ATOM 8625 CG LEU B 484 176.195 154.558 123.952 1.00 68.25 C
ATOM 8626 CD1 LEU B 484 175.806 155.752 123.129 1.00 68.25 C
ATOM 8627 CD2 LEU B 484 174.960 153.834 124.394 1.00 68.25 C
ATOM 8628 N ARG B 485 180.191 153.703 124.083 1.00 72.37 N
ATOM 8629 CA ARG B 485 181.196 154.049 125.081 1.00 72.37 C
ATOM 8630 C ARG B 485 182.258 154.962 124.479 1.00 72.37 C
ATOM 8631 O ARG B 485 182.844 155.798 125.175 1.00 72.37 O
ATOM 8632 CB ARG B 485 181.820 152.778 125.653 1.00 72.37 C
ATOM 8633 CG ARG B 485 182.732 153.005 126.836 1.00 72.37 C
ATOM 8634 CD ARG B 485 183.263 151.696 127.374 1.00 72.37 C
ATOM 8635 NE ARG B 485 184.221 151.914 128.451 1.00 72.37 N
ATOM 8636 CZ ARG B 485 183.887 152.033 129.730 1.00 72.37 C
ATOM 8637 NH1 ARG B 485 182.617 151.945 130.092 1.00 72.37 N
ATOM 8638 NH2 ARG B 485 184.822 152.232 130.649 1.00 72.37 N
ATOM 8639 N LYS B 486 182.503 154.828 123.175 1.00 73.93 N
ATOM 8640 CA LYS B 486 183.455 155.707 122.505 1.00 73.93 C
ATOM 8641 C LYS B 486 182.855 157.091 122.287 1.00 73.93 C
ATOM 8642 O LYS B 486 183.579 158.083 122.151 1.00 73.93 O
ATOM 8643 CB LYS B 486 183.880 155.071 121.181 1.00 73.93 C
ATOM 8644 CG LYS B 486 185.022 155.746 120.447 1.00 73.93 C
ATOM 8645 CD LYS B 486 185.391 154.964 119.200 1.00 73.93 C
ATOM 8646 CE LYS B 486 186.518 155.634 118.442 1.00 73.93 C
ATOM 8647 NZ LYS B 486 186.870 154.873 117.214 1.00 73.93 N
ATOM 8648 N PHE B 487 181.526 157.177 122.278 1.00 71.78 N
ATOM 8649 CA PHE B 487 180.857 158.450 122.038 1.00 71.78 C
ATOM 8650 C PHE B 487 180.952 159.373 123.245 1.00 71.78 C
ATOM 8651 O PHE B 487 181.347 160.536 123.113 1.00 71.78 O
ATOM 8652 CB PHE B 487 179.399 158.189 121.678 1.00 71.78 C
ATOM 8653 CG PHE B 487 178.598 159.427 121.449 1.00 71.78 C
ATOM 8654 CD1 PHE B 487 178.749 160.152 120.285 1.00 71.78 C
ATOM 8655 CD2 PHE B 487 177.674 159.848 122.387 1.00 71.78 C
ATOM 8656 CE1 PHE B 487 178.004 161.284 120.070 1.00 71.78 C
ATOM 8657 CE2 PHE B 487 176.929 160.976 122.179 1.00 71.78 C
ATOM 8658 CZ PHE B 487 177.092 161.696 121.020 1.00 71.78 C
ATOM 8659 N LEU B 488 180.588 158.876 124.423 1.00 62.95 N
ATOM 8660 CA LEU B 488 180.434 159.730 125.594 1.00 62.95 C
ATOM 8661 C LEU B 488 181.784 160.189 126.130 1.00 62.95 C
ATOM 8662 O LEU B 488 182.567 159.390 126.647 1.00 62.95 O
ATOM 8663 CB LEU B 488 179.676 158.984 126.684 1.00 62.95 C
ATOM 8664 CG LEU B 488 178.258 158.568 126.320 1.00 62.95 C
ATOM 8665 CD1 LEU B 488 177.656 157.768 127.445 1.00 62.95 C
ATOM 8666 CD2 LEU B 488 177.419 159.775 126.015 1.00 62.95 C
ATOM 8667 N THR B 489 182.047 161.484 126.017 1.00 66.09 N
ATOM 8668 CA THR B 489 183.234 162.101 126.588 1.00 66.09 C
ATOM 8669 C THR B 489 182.776 163.100 127.633 1.00 66.09 C
ATOM 8670 O THR B 489 181.621 163.535 127.606 1.00 66.09 O
ATOM 8671 CB THR B 489 184.062 162.812 125.527 1.00 66.09 C
ATOM 8672 OG1 THR B 489 183.307 163.910 125.004 1.00 66.09 O
ATOM 8673 CG2 THR B 489 184.388 161.863 124.397 1.00 66.09 C
ATOM 8674 N THR B 490 183.681 163.475 128.539 1.00 66.36 N
ATOM 8675 CA THR B 490 183.355 164.372 129.644 1.00 66.36 C
ATOM 8676 C THR B 490 182.956 165.772 129.191 1.00 66.36 C
ATOM 8677 O THR B 490 182.297 166.501 129.937 1.00 66.36 O
ATOM 8678 CB THR B 490 184.530 164.465 130.608 1.00 66.36 C
ATOM 8679 OG1 THR B 490 185.671 164.970 129.911 1.00 66.36 O
ATOM 8680 CG2 THR B 490 184.844 163.101 131.166 1.00 66.36 C
ATOM 8681 N GLU B 491 183.363 166.165 127.982 1.00 67.43 N
ATOM 8682 CA GLU B 491 182.846 167.395 127.393 1.00 67.43 C
ATOM 8683 C GLU B 491 181.357 167.273 127.096 1.00 67.43 C
ATOM 8684 O GLU B 491 180.580 168.193 127.381 1.00 67.43 O
ATOM 8685 CB GLU B 491 183.618 167.732 126.118 1.00 67.43 C
ATOM 8686 N VAL B 492 180.945 166.129 126.546 1.00 61.52 N
ATOM 8687 CA VAL B 492 179.552 165.924 126.163 1.00 61.52 C
ATOM 8688 C VAL B 492 178.663 165.843 127.394 1.00 61.52 C
ATOM 8689 O VAL B 492 177.548 166.376 127.406 1.00 61.52 O
ATOM 8690 CB VAL B 492 179.435 164.667 125.287 1.00 61.52 C
ATOM 8691 CG1 VAL B 492 177.996 164.373 124.921 1.00 61.52 C
ATOM 8692 CG2 VAL B 492 180.259 164.849 124.043 1.00 61.52 C
ATOM 8693 N LEU B 493 179.156 165.233 128.470 1.00 61.18 N
ATOM 8694 CA LEU B 493 178.331 165.118 129.666 1.00 61.18 C
ATOM 8695 C LEU B 493 178.218 166.446 130.401 1.00 61.18 C
ATOM 8696 O LEU B 493 177.189 166.726 131.026 1.00 61.18 O
ATOM 8697 CB LEU B 493 178.883 164.041 130.584 1.00 61.18 C
ATOM 8698 CG LEU B 493 178.759 162.645 130.003 1.00 61.18 C
ATOM 8699 CD1 LEU B 493 179.396 161.667 130.946 1.00 61.18 C
ATOM 8700 CD2 LEU B 493 177.308 162.309 129.770 1.00 61.18 C
ATOM 8701 N ARG B 494 179.252 167.286 130.331 1.00 67.49 N
ATOM 8702 CA ARG B 494 179.108 168.641 130.849 1.00 67.49 C
ATOM 8703 C ARG B 494 178.119 169.445 130.016 1.00 67.49 C
ATOM 8704 O ARG B 494 177.265 170.151 130.569 1.00 67.49 O
ATOM 8705 CB ARG B 494 180.465 169.337 130.905 1.00 67.49 C
ATOM 8706 CG ARG B 494 181.334 168.859 132.044 1.00 67.49 C
ATOM 8707 CD ARG B 494 182.677 169.550 132.042 1.00 67.49 C
ATOM 8708 NE ARG B 494 183.489 169.115 133.172 1.00 67.49 N
ATOM 8709 CZ ARG B 494 184.752 169.470 133.367 1.00 67.49 C
ATOM 8710 NH1 ARG B 494 185.361 170.261 132.497 1.00 67.49 N
ATOM 8711 NH2 ARG B 494 185.410 169.023 134.426 1.00 67.49 N
ATOM 8712 N GLU B 495 178.180 169.301 128.688 1.00 58.70 N
ATOM 8713 CA GLU B 495 177.232 169.992 127.823 1.00 58.70 C
ATOM 8714 C GLU B 495 175.818 169.458 128.003 1.00 58.70 C
ATOM 8715 O GLU B 495 174.842 170.140 127.675 1.00 58.70 O
ATOM 8716 CB GLU B 495 177.665 169.865 126.364 1.00 58.70 C
ATOM 8717 N LEU B 496 175.687 168.237 128.515 1.00 55.20 N
ATOM 8718 CA LEU B 496 174.365 167.665 128.717 1.00 55.20 C
ATOM 8719 C LEU B 496 173.787 168.059 130.071 1.00 55.20 C
ATOM 8720 O LEU B 496 172.616 168.444 130.162 1.00 55.20 O
ATOM 8721 CB LEU B 496 174.430 166.149 128.587 1.00 55.20 C
ATOM 8722 CG LEU B 496 173.062 165.482 128.592 1.00 55.20 C
ATOM 8723 CD1 LEU B 496 172.296 165.922 127.378 1.00 55.20 C
ATOM 8724 CD2 LEU B 496 173.208 163.997 128.599 1.00 55.20 C
ATOM 8725 N TYR B 497 174.589 167.975 131.134 1.00 59.15 N
ATOM 8726 CA TYR B 497 174.080 168.281 132.470 1.00 59.15 C
ATOM 8727 C TYR B 497 173.912 169.778 132.702 1.00 59.15 C
ATOM 8728 O TYR B 497 172.991 170.190 133.414 1.00 59.15 O
ATOM 8729 CB TYR B 497 174.994 167.692 133.541 1.00 59.15 C
ATOM 8730 CG TYR B 497 174.686 166.270 133.923 1.00 59.15 C
ATOM 8731 CD1 TYR B 497 173.725 165.998 134.878 1.00 59.15 C
ATOM 8732 CD2 TYR B 497 175.350 165.207 133.345 1.00 59.15 C
ATOM 8733 CE1 TYR B 497 173.435 164.710 135.248 1.00 59.15 C
ATOM 8734 CE2 TYR B 497 175.061 163.909 133.713 1.00 59.15 C
ATOM 8735 CZ TYR B 497 174.099 163.674 134.662 1.00 59.15 C
ATOM 8736 OH TYR B 497 173.799 162.391 135.036 1.00 59.15 O
ATOM 8737 N THR B 498 174.795 170.613 132.151 1.00 60.49 N
ATOM 8738 CA THR B 498 174.680 172.037 132.453 1.00 60.49 C
ATOM 8739 C THR B 498 173.567 172.696 131.651 1.00 60.49 C
ATOM 8740 O THR B 498 172.905 173.615 132.141 1.00 60.49 O
ATOM 8741 CB THR B 498 176.001 172.747 132.198 1.00 60.49 C
ATOM 8742 OG1 THR B 498 176.392 172.544 130.835 1.00 60.49 O
ATOM 8743 CG2 THR B 498 177.069 172.218 133.128 1.00 60.49 C
ATOM 8744 N ASN B 499 173.339 172.241 130.424 1.00 60.84 N
ATOM 8745 CA ASN B 499 172.338 172.852 129.565 1.00 60.84 C
ATOM 8746 C ASN B 499 170.984 172.167 129.626 1.00 60.84 C
ATOM 8747 O ASN B 499 169.986 172.808 129.961 1.00 60.84 O
ATOM 8748 CB ASN B 499 172.834 172.873 128.119 1.00 60.84 C
ATOM 8749 CG ASN B 499 173.959 173.849 127.916 1.00 60.84 C
ATOM 8750 OD1 ASN B 499 173.951 174.939 128.481 1.00 60.84 O
ATOM 8751 ND2 ASN B 499 174.932 173.472 127.102 1.00 60.84 N
ATOM 8752 N ASN B 500 170.919 170.873 129.317 1.00 57.11 N
ATOM 8753 CA ASN B 500 169.655 170.207 129.039 1.00 57.11 C
ATOM 8754 C ASN B 500 169.042 169.541 130.259 1.00 57.11 C
ATOM 8755 O ASN B 500 168.282 168.579 130.116 1.00 57.11 O
ATOM 8756 CB ASN B 500 169.846 169.188 127.922 1.00 57.11 C
ATOM 8757 CG ASN B 500 170.176 169.836 126.614 1.00 57.11 C
ATOM 8758 OD1 ASN B 500 169.612 170.867 126.269 1.00 57.11 O
ATOM 8759 ND2 ASN B 500 171.097 169.245 125.874 1.00 57.11 N
ATOM 8760 N PHE B 501 169.339 170.023 131.454 1.00 49.60 N
ATOM 8761 CA PHE B 501 168.783 169.466 132.676 1.00 49.60 C
ATOM 8762 C PHE B 501 167.903 170.538 133.300 1.00 49.60 C
ATOM 8763 O PHE B 501 168.401 171.596 133.695 1.00 49.60 O
ATOM 8764 CB PHE B 501 169.910 169.035 133.609 1.00 49.60 C
ATOM 8765 CG PHE B 501 169.468 168.237 134.790 1.00 49.60 C
ATOM 8766 CD1 PHE B 501 169.073 166.927 134.638 1.00 49.60 C
ATOM 8767 CD2 PHE B 501 169.503 168.775 136.059 1.00 49.60 C
ATOM 8768 CE1 PHE B 501 168.683 166.182 135.725 1.00 49.60 C
ATOM 8769 CE2 PHE B 501 169.118 168.032 137.150 1.00 49.60 C
ATOM 8770 CZ PHE B 501 168.708 166.734 136.980 1.00 49.60 C
ATOM 8771 N SER B 502 166.598 170.272 133.364 1.00 54.36 N
ATOM 8772 CA SER B 502 165.628 171.293 133.745 1.00 54.36 C
ATOM 8773 C SER B 502 165.739 171.632 135.223 1.00 54.36 C
ATOM 8774 O SER B 502 165.800 170.746 136.076 1.00 54.36 O
ATOM 8775 CB SER B 502 164.217 170.815 133.437 1.00 54.36 C
ATOM 8776 OG SER B 502 163.882 169.730 134.273 1.00 54.36 O
ATOM 8777 N SER B 503 165.721 172.934 135.519 1.00 55.77 N
ATOM 8778 CA SER B 503 166.088 173.410 136.850 1.00 55.77 C
ATOM 8779 C SER B 503 165.024 173.084 137.887 1.00 55.77 C
ATOM 8780 O SER B 503 165.296 173.120 139.093 1.00 55.77 O
ATOM 8781 CB SER B 503 166.347 174.911 136.815 1.00 55.77 C
ATOM 8782 OG SER B 503 167.462 175.200 135.998 1.00 55.77 O
ATOM 8783 N LEU B 504 163.805 172.777 137.439 1.00 54.28 N
ATOM 8784 CA LEU B 504 162.772 172.312 138.358 1.00 54.28 C
ATOM 8785 C LEU B 504 163.148 170.974 138.983 1.00 54.28 C
ATOM 8786 O LEU B 504 163.017 170.788 140.200 1.00 54.28 O
ATOM 8787 CB LEU B 504 161.442 172.203 137.624 1.00 54.28 C
ATOM 8788 CG LEU B 504 160.291 171.717 138.489 1.00 54.28 C
ATOM 8789 CD1 LEU B 504 160.057 172.688 139.626 1.00 54.28 C
ATOM 8790 CD2 LEU B 504 159.051 171.567 137.642 1.00 54.28 C
ATOM 8791 N VAL B 505 163.644 170.043 138.164 1.00 52.09 N
ATOM 8792 CA VAL B 505 164.067 168.741 138.663 1.00 52.09 C
ATOM 8793 C VAL B 505 165.284 168.892 139.565 1.00 52.09 C
ATOM 8794 O VAL B 505 165.422 168.190 140.572 1.00 52.09 O
ATOM 8795 CB VAL B 505 164.328 167.792 137.478 1.00 52.09 C
ATOM 8796 CG1 VAL B 505 164.809 166.444 137.945 1.00 52.09 C
ATOM 8797 CG2 VAL B 505 163.070 167.624 136.667 1.00 52.09 C
ATOM 8798 N PHE B 506 166.149 169.862 139.256 1.00 54.21 N
ATOM 8799 CA PHE B 506 167.313 170.108 140.099 1.00 54.21 C
ATOM 8800 C PHE B 506 166.917 170.674 141.453 1.00 54.21 C
ATOM 8801 O PHE B 506 167.482 170.280 142.477 1.00 54.21 O
ATOM 8802 CB PHE B 506 168.287 171.051 139.403 1.00 54.21 C
ATOM 8803 CG PHE B 506 169.462 171.416 140.249 1.00 54.21 C
ATOM 8804 CD1 PHE B 506 170.439 170.483 140.527 1.00 54.21 C
ATOM 8805 CD2 PHE B 506 169.591 172.691 140.764 1.00 54.21 C
ATOM 8806 CE1 PHE B 506 171.523 170.809 141.311 1.00 54.21 C
ATOM 8807 CE2 PHE B 506 170.674 173.025 141.545 1.00 54.21 C
ATOM 8808 CZ PHE B 506 171.643 172.082 141.817 1.00 54.21 C
ATOM 8809 N LYS B 507 165.947 171.589 141.482 1.00 57.06 N
ATOM 8810 CA LYS B 507 165.464 172.103 142.760 1.00 57.06 C
ATOM 8811 C LYS B 507 164.762 171.012 143.556 1.00 57.06 C
ATOM 8812 O LYS B 507 164.877 170.950 144.788 1.00 57.06 O
ATOM 8813 CB LYS B 507 164.528 173.288 142.534 1.00 57.06 C
ATOM 8814 N ASN B 508 164.074 170.111 142.857 1.00 52.59 N
ATOM 8815 CA ASN B 508 163.378 169.029 143.538 1.00 52.59 C
ATOM 8816 C ASN B 508 164.368 168.035 144.136 1.00 52.59 C
ATOM 8817 O ASN B 508 164.185 167.565 145.266 1.00 52.59 O
ATOM 8818 CB ASN B 508 162.435 168.347 142.554 1.00 52.59 C
ATOM 8819 CG ASN B 508 161.379 167.548 143.240 1.00 52.59 C
ATOM 8820 OD1 ASN B 508 161.348 167.481 144.459 1.00 52.59 O
ATOM 8821 ND2 ASN B 508 160.486 166.955 142.464 1.00 52.59 N
ATOM 8822 N LEU B 509 165.438 167.732 143.402 1.00 53.44 N
ATOM 8823 CA LEU B 509 166.494 166.875 143.926 1.00 53.44 C
ATOM 8824 C LEU B 509 167.222 167.549 145.080 1.00 53.44 C
ATOM 8825 O LEU B 509 167.623 166.884 146.044 1.00 53.44 O
ATOM 8826 CB LEU B 509 167.469 166.520 142.809 1.00 53.44 C
ATOM 8827 CG LEU B 509 168.630 165.622 143.206 1.00 53.44 C
ATOM 8828 CD1 LEU B 509 168.106 164.296 143.671 1.00 53.44 C
ATOM 8829 CD2 LEU B 509 169.583 165.445 142.057 1.00 53.44 C
ATOM 8830 N GLN B 510 167.390 168.871 144.998 1.00 57.21 N
ATOM 8831 CA GLN B 510 167.981 169.643 146.085 1.00 57.21 C
ATOM 8832 C GLN B 510 167.163 169.528 147.360 1.00 57.21 C
ATOM 8833 O GLN B 510 167.722 169.422 148.458 1.00 57.21 O
ATOM 8834 CB GLN B 510 168.102 171.104 145.658 1.00 57.21 C
ATOM 8835 CG GLN B 510 168.644 172.028 146.716 1.00 57.21 C
ATOM 8836 CD GLN B 510 170.031 171.648 147.143 1.00 57.21 C
ATOM 8837 OE1 GLN B 510 170.230 171.088 148.220 1.00 57.21 O
ATOM 8838 NE2 GLN B 510 171.008 171.945 146.301 1.00 57.21 N
ATOM 8839 N ILE B 511 165.838 169.531 147.232 1.00 55.78 N
ATOM 8840 CA ILE B 511 164.986 169.311 148.399 1.00 55.78 C
ATOM 8841 C ILE B 511 165.117 167.877 148.905 1.00 55.78 C
ATOM 8842 O ILE B 511 165.250 167.640 150.115 1.00 55.78 O
ATOM 8843 CB ILE B 511 163.527 169.661 148.061 1.00 55.78 C
ATOM 8844 CG1 ILE B 511 163.402 171.146 147.740 1.00 55.78 C
ATOM 8845 CG2 ILE B 511 162.609 169.325 149.209 1.00 55.78 C
ATOM 8846 CD1 ILE B 511 162.067 171.528 147.154 1.00 55.78 C
ATOM 8847 N ALA B 512 165.117 166.910 147.982 1.00 55.29 N
ATOM 8848 CA ALA B 512 165.073 165.501 148.367 1.00 55.29 C
ATOM 8849 C ALA B 512 166.379 165.044 148.996 1.00 55.29 C
ATOM 8850 O ALA B 512 166.406 164.051 149.729 1.00 55.29 O
ATOM 8851 CB ALA B 512 164.748 164.636 147.155 1.00 55.29 C
ATOM 8852 N LYS B 513 167.476 165.739 148.703 1.00 59.27 N
ATOM 8853 CA LYS B 513 168.745 165.390 149.323 1.00 59.27 C
ATOM 8854 C LYS B 513 168.757 165.785 150.792 1.00 59.27 C
ATOM 8855 O LYS B 513 169.172 165.001 151.652 1.00 59.27 O
ATOM 8856 CB LYS B 513 169.888 166.069 148.572 1.00 59.27 C
ATOM 8857 CG LYS B 513 171.311 165.650 148.953 1.00 59.27 C
ATOM 8858 CD LYS B 513 171.943 166.583 149.976 1.00 59.27 C
ATOM 8859 CE LYS B 513 171.936 167.994 149.462 1.00 59.27 C
ATOM 8860 NZ LYS B 513 172.599 168.952 150.392 1.00 59.27 N1+
ATOM 8861 N ASN B 514 168.335 167.013 151.093 1.00 60.39 N
ATOM 8862 CA ASN B 514 168.408 167.509 152.462 1.00 60.39 C
ATOM 8863 C ASN B 514 167.339 166.878 153.337 1.00 60.39 C
ATOM 8864 O ASN B 514 167.588 166.566 154.505 1.00 60.39 O
ATOM 8865 CB ASN B 514 168.277 169.028 152.476 1.00 60.39 C
ATOM 8866 CG ASN B 514 169.500 169.717 151.935 1.00 60.39 C
ATOM 8867 OD1 ASN B 514 170.624 169.331 152.238 1.00 60.39 O
ATOM 8868 ND2 ASN B 514 169.291 170.738 151.118 1.00 60.39 N
ATOM 8869 N SER B 515 166.143 166.680 152.794 1.00 64.03 N
ATOM 8870 CA SER B 515 165.060 166.208 153.646 1.00 64.03 C
ATOM 8871 C SER B 515 165.128 164.704 153.892 1.00 64.03 C
ATOM 8872 O SER B 515 165.012 164.261 155.037 1.00 64.03 O
ATOM 8873 CB SER B 515 163.721 166.586 153.029 1.00 64.03 C
ATOM 8874 OG SER B 515 163.566 165.932 151.786 1.00 64.03 O
ATOM 8875 N TYR B 516 165.321 163.903 152.845 1.00 61.76 N
ATOM 8876 CA TYR B 516 165.295 162.444 152.955 1.00 61.76 C
ATOM 8877 C TYR B 516 166.638 161.894 152.471 1.00 61.76 C
ATOM 8878 O TYR B 516 166.819 161.600 151.290 1.00 61.76 O
ATOM 8879 CB TYR B 516 164.143 161.853 152.156 1.00 61.76 C
ATOM 8880 CG TYR B 516 162.789 162.343 152.583 1.00 61.76 C
ATOM 8881 CD1 TYR B 516 162.239 161.945 153.790 1.00 61.76 C
ATOM 8882 CD2 TYR B 516 162.037 163.163 151.758 1.00 61.76 C
ATOM 8883 CE1 TYR B 516 160.994 162.382 154.182 1.00 61.76 C
ATOM 8884 CE2 TYR B 516 160.791 163.604 152.137 1.00 61.76 C
ATOM 8885 CZ TYR B 516 160.275 163.208 153.350 1.00 61.76 C
ATOM 8886 OH TYR B 516 159.030 163.639 153.741 1.00 61.76 O
ATOM 8887 N ASN B 517 167.575 161.729 153.394 1.00 61.48 N
ATOM 8888 CA ASN B 517 168.946 161.446 153.001 1.00 61.48 C
ATOM 8889 C ASN B 517 169.253 159.958 153.112 1.00 61.48 C
ATOM 8890 O ASN B 517 168.740 159.263 153.990 1.00 61.48 O
ATOM 8891 CB ASN B 517 169.903 162.260 153.863 1.00 61.48 C
ATOM 8892 CG ASN B 517 171.289 162.354 153.273 1.00 61.48 C
ATOM 8893 OD1 ASN B 517 171.576 161.776 152.229 1.00 61.48 O
ATOM 8894 ND2 ASN B 517 172.156 163.109 153.931 1.00 61.48 N
ATOM 8895 N ASP B 518 170.096 159.472 152.201 1.00 56.04 N
ATOM 8896 CA ASP B 518 170.544 158.086 152.173 1.00 56.04 C
ATOM 8897 C ASP B 518 171.918 158.031 151.521 1.00 56.04 C
ATOM 8898 O ASP B 518 172.515 159.061 151.208 1.00 56.04 O
ATOM 8899 CB ASP B 518 169.562 157.183 151.420 1.00 56.04 C
ATOM 8900 N ALA B 519 172.424 156.814 151.320 1.00 54.90 N
ATOM 8901 CA ALA B 519 173.772 156.659 150.783 1.00 54.90 C
ATOM 8902 C ALA B 519 173.807 156.928 149.285 1.00 54.90 C
ATOM 8903 O ALA B 519 174.612 157.740 148.798 1.00 54.90 O
ATOM 8904 CB ALA B 519 174.296 155.258 151.089 1.00 54.90 C
ATOM 8905 N LEU B 520 172.939 156.233 148.541 1.00 46.52 N
ATOM 8906 CA LEU B 520 172.914 156.338 147.083 1.00 46.52 C
ATOM 8907 C LEU B 520 172.587 157.746 146.631 1.00 46.52 C
ATOM 8908 O LEU B 520 173.213 158.264 145.701 1.00 46.52 O
ATOM 8909 CB LEU B 520 171.894 155.363 146.507 1.00 46.52 C
ATOM 8910 CG LEU B 520 171.750 155.458 144.994 1.00 46.52 C
ATOM 8911 CD1 LEU B 520 173.053 155.107 144.337 1.00 46.52 C
ATOM 8912 CD2 LEU B 520 170.671 154.547 144.509 1.00 46.52 C
ATOM 8913 N LEU B 521 171.633 158.390 147.300 1.00 49.90 N
ATOM 8914 CA LEU B 521 171.223 159.725 146.893 1.00 49.90 C
ATOM 8915 C LEU B 521 172.331 160.737 147.150 1.00 49.90 C
ATOM 8916 O LEU B 521 172.534 161.662 146.353 1.00 49.90 O
ATOM 8917 CB LEU B 521 169.950 160.118 147.629 1.00 49.90 C
ATOM 8918 CG LEU B 521 169.318 161.358 147.028 1.00 49.90 C
ATOM 8919 CD1 LEU B 521 168.839 161.028 145.638 1.00 49.90 C
ATOM 8920 CD2 LEU B 521 168.184 161.842 147.887 1.00 49.90 C
ATOM 8921 N THR B 522 173.093 160.535 148.227 1.00 52.24 N
ATOM 8922 CA THR B 522 174.251 161.378 148.500 1.00 52.24 C
ATOM 8923 C THR B 522 175.309 161.218 147.425 1.00 52.24 C
ATOM 8924 O THR B 522 175.861 162.214 146.935 1.00 52.24 O
ATOM 8925 CB THR B 522 174.834 161.036 149.867 1.00 52.24 C
ATOM 8926 OG1 THR B 522 173.836 161.236 150.872 1.00 52.24 O
ATOM 8927 CG2 THR B 522 176.021 161.919 150.177 1.00 52.24 C
ATOM 8928 N PHE B 523 175.578 159.975 147.015 1.00 51.62 N
ATOM 8929 CA PHE B 523 176.578 159.754 145.975 1.00 51.62 C
ATOM 8930 C PHE B 523 176.133 160.325 144.634 1.00 51.62 C
ATOM 8931 O PHE B 523 176.951 160.863 143.876 1.00 51.62 O
ATOM 8932 CB PHE B 523 176.875 158.269 145.843 1.00 51.62 C
ATOM 8933 CG PHE B 523 177.913 157.965 144.826 1.00 51.62 C
ATOM 8934 CD1 PHE B 523 179.244 158.199 145.101 1.00 51.62 C
ATOM 8935 CD2 PHE B 523 177.561 157.463 143.589 1.00 51.62 C
ATOM 8936 CE1 PHE B 523 180.211 157.927 144.165 1.00 51.62 C
ATOM 8937 CE2 PHE B 523 178.519 157.192 142.648 1.00 51.62 C
ATOM 8938 CZ PHE B 523 179.849 157.424 142.935 1.00 51.62 C
ATOM 8939 N VAL B 524 174.836 160.245 144.336 1.00 51.15 N
ATOM 8940 CA VAL B 524 174.334 160.793 143.080 1.00 51.15 C
ATOM 8941 C VAL B 524 174.413 162.313 143.092 1.00 51.15 C
ATOM 8942 O VAL B 524 174.794 162.931 142.090 1.00 51.15 O
ATOM 8943 CB VAL B 524 172.911 160.280 142.803 1.00 51.15 C
ATOM 8944 CG1 VAL B 524 172.293 160.992 141.632 1.00 51.15 C
ATOM 8945 CG2 VAL B 524 172.971 158.814 142.489 1.00 51.15 C
ATOM 8946 N TRP B 525 174.123 162.936 144.238 1.00 58.40 N
ATOM 8947 CA TRP B 525 174.226 164.389 144.316 1.00 58.40 C
ATOM 8948 C TRP B 525 175.670 164.855 144.205 1.00 58.40 C
ATOM 8949 O TRP B 525 175.941 165.891 143.582 1.00 58.40 O
ATOM 8950 CB TRP B 525 173.596 164.892 145.612 1.00 58.40 C
ATOM 8951 CG TRP B 525 173.585 166.373 145.744 1.00 58.40 C
ATOM 8952 CD1 TRP B 525 172.957 167.263 144.934 1.00 58.40 C
ATOM 8953 CD2 TRP B 525 174.197 167.133 146.777 1.00 58.40 C
ATOM 8954 NE1 TRP B 525 173.162 168.540 145.383 1.00 58.40 N
ATOM 8955 CE2 TRP B 525 173.924 168.484 146.519 1.00 58.40 C
ATOM 8956 CE3 TRP B 525 174.971 166.803 147.890 1.00 58.40 C
ATOM 8957 CZ2 TRP B 525 174.392 169.505 147.336 1.00 58.40 C
ATOM 8958 CZ3 TRP B 525 175.433 167.811 148.700 1.00 58.40 C
ATOM 8959 CH2 TRP B 525 175.142 169.151 148.420 1.00 58.40 C
ATOM 8960 N LYS B 526 176.612 164.079 144.747 1.00 59.36 N
ATOM 8961 CA LYS B 526 178.016 164.443 144.589 1.00 59.36 C
ATOM 8962 C LYS B 526 178.470 164.288 143.145 1.00 59.36 C
ATOM 8963 O LYS B 526 179.243 165.113 142.648 1.00 59.36 O
ATOM 8964 CB LYS B 526 178.897 163.624 145.527 1.00 59.36 C
ATOM 8965 CG LYS B 526 178.658 163.928 146.991 1.00 59.36 C
ATOM 8966 CD LYS B 526 178.934 165.385 147.294 1.00 59.36 C
ATOM 8967 CE LYS B 526 180.418 165.687 147.229 1.00 59.36 C
ATOM 8968 NZ LYS B 526 180.712 167.105 147.581 1.00 59.36 N
ATOM 8969 N MET B 527 177.968 163.267 142.443 1.00 61.83 N
ATOM 8970 CA MET B 527 178.283 163.129 141.020 1.00 61.83 C
ATOM 8971 C MET B 527 177.705 164.277 140.200 1.00 61.83 C
ATOM 8972 O MET B 527 178.350 164.779 139.268 1.00 61.83 O
ATOM 8973 CB MET B 527 177.756 161.802 140.485 1.00 61.83 C
ATOM 8974 CG MET B 527 178.127 161.551 139.032 1.00 61.83 C
ATOM 8975 SD MET B 527 177.342 160.100 138.314 1.00 61.83 S
ATOM 8976 CE MET B 527 178.215 158.766 139.135 1.00 61.83 C
ATOM 8977 N VAL B 528 176.491 164.711 140.533 1.00 62.61 N
ATOM 8978 CA VAL B 528 175.857 165.777 139.762 1.00 62.61 C
ATOM 8979 C VAL B 528 176.562 167.103 140.000 1.00 62.61 C
ATOM 8980 O VAL B 528 176.802 167.866 139.058 1.00 62.61 O
ATOM 8981 CB VAL B 528 174.354 165.847 140.086 1.00 62.61 C
ATOM 8982 CG1 VAL B 528 173.727 167.077 139.483 1.00 62.61 C
ATOM 8983 CG2 VAL B 528 173.666 164.642 139.518 1.00 62.61 C
ATOM 8984 N GLU B 529 176.964 167.380 141.240 1.00 69.39 N
ATOM 8985 CA GLU B 529 177.693 168.624 141.466 1.00 69.39 C
ATOM 8986 C GLU B 529 179.136 168.529 140.994 1.00 69.39 C
ATOM 8987 O GLU B 529 179.793 169.557 140.804 1.00 69.39 O
ATOM 8988 CB GLU B 529 177.625 169.053 142.924 1.00 69.39 C
ATOM 8989 CG GLU B 529 176.303 169.690 143.244 1.00 69.39 C
ATOM 8990 CD GLU B 529 176.302 170.398 144.566 1.00 69.39 C
ATOM 8991 OE1 GLU B 529 177.275 170.237 145.331 1.00 69.39 O
ATOM 8992 OE2 GLU B 529 175.344 171.156 144.815 1.00 69.39 O
ATOM 8993 N ASP B 530 179.652 167.319 140.793 1.00 69.08 N
ATOM 8994 CA ASP B 530 180.948 167.210 140.136 1.00 69.08 C
ATOM 8995 C ASP B 530 180.830 167.528 138.653 1.00 69.08 C
ATOM 8996 O ASP B 530 181.678 168.227 138.090 1.00 69.08 O
ATOM 8997 CB ASP B 530 181.531 165.815 140.343 1.00 69.08 C
ATOM 8998 N PHE B 531 179.775 167.036 138.004 1.00 68.61 N
ATOM 8999 CA PHE B 531 179.590 167.336 136.587 1.00 68.61 C
ATOM 9000 C PHE B 531 179.111 168.758 136.343 1.00 68.61 C
ATOM 9001 O PHE B 531 179.271 169.275 135.233 1.00 68.61 O
ATOM 9002 CB PHE B 531 178.599 166.377 135.948 1.00 68.61 C
ATOM 9003 CG PHE B 531 179.202 165.103 135.469 1.00 68.61 C
ATOM 9004 CD1 PHE B 531 179.850 165.068 134.249 1.00 68.61 C
ATOM 9005 CD2 PHE B 531 179.090 163.937 136.199 1.00 68.61 C
ATOM 9006 CE1 PHE B 531 180.400 163.902 133.776 1.00 68.61 C
ATOM 9007 CE2 PHE B 531 179.637 162.761 135.718 1.00 68.61 C
ATOM 9008 CZ PHE B 531 180.279 162.743 134.511 1.00 68.61 C
ATOM 9009 N ARG B 532 178.508 169.395 137.347 1.00 66.79 N
ATOM 9010 CA ARG B 532 177.775 170.634 137.105 1.00 66.79 C
ATOM 9011 C ARG B 532 178.717 171.812 136.868 1.00 66.79 C
ATOM 9012 O ARG B 532 178.390 172.731 136.110 1.00 66.79 O
ATOM 9013 CB ARG B 532 176.820 170.893 138.274 1.00 66.79 C
ATOM 9014 CG ARG B 532 175.992 172.151 138.144 1.00 66.79 C
ATOM 9015 CD ARG B 532 175.119 172.131 136.902 1.00 66.79 C
ATOM 9016 NE ARG B 532 174.013 171.189 136.984 1.00 66.79 N
ATOM 9017 CZ ARG B 532 172.840 171.486 137.529 1.00 66.79 C
ATOM 9018 NH1 ARG B 532 172.631 172.686 138.044 1.00 66.79 N1+
ATOM 9019 NH2 ARG B 532 171.875 170.584 137.564 1.00 66.79 N
ATOM 9020 N ARG B 533 179.903 171.783 137.464 1.00 81.11 N
ATOM 9021 CA ARG B 533 180.872 172.858 137.280 1.00 81.11 C
ATOM 9022 C ARG B 533 181.459 172.851 135.874 1.00 81.11 C
ATOM 9023 O ARG B 533 182.658 173.045 135.690 1.00 81.11 O
ATOM 9024 CB ARG B 533 181.990 172.736 138.305 1.00 81.11 C
ATOM 9025 CG ARG B 533 181.518 172.909 139.720 1.00 81.11 C
ATOM 9026 CD ARG B 533 182.647 172.639 140.678 1.00 81.11 C
ATOM 9027 NE ARG B 533 182.206 172.706 142.064 1.00 81.11 N
ATOM 9028 CZ ARG B 533 182.974 172.400 143.105 1.00 81.11 C
ATOM 9029 NH1 ARG B 533 184.222 171.999 142.914 1.00 81.11 N
ATOM 9030 NH2 ARG B 533 182.492 172.490 144.335 1.00 81.11 N
ATOM 9031 N PRO B 555 188.354 160.090 134.024 1.00 96.04 N
ATOM 9032 CA PRO B 555 189.079 161.163 134.711 1.00 96.04 C
ATOM 9033 C PRO B 555 188.394 161.624 135.997 1.00 96.04 C
ATOM 9034 O PRO B 555 188.984 161.480 137.067 1.00 96.04 O
ATOM 9035 CB PRO B 555 189.128 162.281 133.665 1.00 96.04 C
ATOM 9036 CG PRO B 555 188.029 161.980 132.714 1.00 96.04 C
ATOM 9037 CD PRO B 555 187.908 160.493 132.680 1.00 96.04 C
ATOM 9038 N ILE B 556 187.180 162.170 135.905 1.00 86.43 N
ATOM 9039 CA ILE B 556 186.441 162.499 137.118 1.00 86.43 C
ATOM 9040 C ILE B 556 185.516 161.351 137.500 1.00 86.43 C
ATOM 9041 O ILE B 556 185.168 161.182 138.673 1.00 86.43 O
ATOM 9042 CB ILE B 556 185.698 163.842 136.954 1.00 86.43 C
ATOM 9043 CG1 ILE B 556 184.742 163.842 135.760 1.00 86.43 C
ATOM 9044 CG2 ILE B 556 186.691 164.981 136.795 1.00 86.43 C
ATOM 9045 CD1 ILE B 556 183.318 163.578 136.114 1.00 86.43 C
ATOM 9046 N THR B 557 185.098 160.554 136.517 1.00 77.11 N
ATOM 9047 CA THR B 557 184.435 159.286 136.788 1.00 77.11 C
ATOM 9048 C THR B 557 184.708 158.322 135.645 1.00 77.11 C
ATOM 9049 O THR B 557 184.969 158.722 134.507 1.00 77.11 O
ATOM 9050 CB THR B 557 182.922 159.443 136.996 1.00 77.11 C
ATOM 9051 OG1 THR B 557 182.359 158.175 137.351 1.00 77.11 O
ATOM 9052 CG2 THR B 557 182.240 159.947 135.744 1.00 77.11 C
ATOM 9053 N ARG B 558 184.698 157.045 135.986 1.00 69.36 N
ATOM 9054 CA ARG B 558 184.545 155.975 135.024 1.00 69.36 C
ATOM 9055 C ARG B 558 183.074 155.569 135.046 1.00 69.36 C
ATOM 9056 O ARG B 558 182.260 156.220 135.712 1.00 69.36 O
ATOM 9057 CB ARG B 558 185.537 154.854 135.346 1.00 69.36 C
ATOM 9058 CG ARG B 558 185.427 154.294 136.751 1.00 69.36 C
ATOM 9059 CD ARG B 558 186.590 153.359 137.078 1.00 69.36 C
ATOM 9060 NE ARG B 558 186.574 152.144 136.275 1.00 69.36 N
ATOM 9061 CZ ARG B 558 187.594 151.300 136.185 1.00 69.36 C
ATOM 9062 NH1 ARG B 558 188.708 151.540 136.854 1.00 69.36 N
ATOM 9063 NH2 ARG B 558 187.497 150.213 135.432 1.00 69.36 N
ATOM 9064 N HIS B 559 182.738 154.500 134.326 1.00 60.32 N
ATOM 9065 CA HIS B 559 181.360 154.111 134.032 1.00 60.32 C
ATOM 9066 C HIS B 559 180.529 155.248 133.441 1.00 60.32 C
ATOM 9067 O HIS B 559 179.690 155.842 134.150 1.00 60.32 O
ATOM 9068 CB HIS B 559 180.674 153.535 135.264 1.00 60.32 C
ATOM 9069 CG HIS B 559 181.305 152.293 135.801 1.00 60.32 C
ATOM 9070 ND1 HIS B 559 181.196 151.073 135.173 1.00 60.32 N
ATOM 9071 CD2 HIS B 559 182.002 152.069 136.940 1.00 60.32 C
ATOM 9072 CE1 HIS B 559 181.819 150.154 135.887 1.00 60.32 C
ATOM 9073 NE2 HIS B 559 182.317 150.734 136.964 1.00 60.32 N
ATOM 9074 N PRO B 560 180.733 155.616 132.176 1.00 53.22 N
ATOM 9075 CA PRO B 560 179.905 156.686 131.600 1.00 53.22 C
ATOM 9076 C PRO B 560 178.471 156.273 131.336 1.00 53.22 C
ATOM 9077 O PRO B 560 177.567 157.125 131.342 1.00 53.22 O
ATOM 9078 CB PRO B 560 180.628 157.017 130.292 1.00 53.22 C
ATOM 9079 CG PRO B 560 181.993 156.506 130.470 1.00 53.22 C
ATOM 9080 CD PRO B 560 181.838 155.268 131.275 1.00 53.22 C
ATOM 9081 N LEU B 561 178.245 154.987 131.075 1.00 44.27 N
ATOM 9082 CA LEU B 561 176.914 154.528 130.697 1.00 44.27 C
ATOM 9083 C LEU B 561 175.932 154.657 131.849 1.00 44.27 C
ATOM 9084 O LEU B 561 174.771 155.023 131.641 1.00 44.27 O
ATOM 9085 CB LEU B 561 176.970 153.091 130.198 1.00 44.27 C
ATOM 9086 CG LEU B 561 177.136 152.896 128.694 1.00 44.27 C
ATOM 9087 CD1 LEU B 561 175.958 153.519 128.000 1.00 44.27 C
ATOM 9088 CD2 LEU B 561 178.425 153.461 128.150 1.00 44.27 C
ATOM 9089 N GLN B 562 176.393 154.419 133.078 1.00 43.36 N
ATOM 9090 CA GLN B 562 175.543 154.672 134.235 1.00 43.36 C
ATOM 9091 C GLN B 562 175.280 156.158 134.431 1.00 43.36 C
ATOM 9092 O GLN B 562 174.227 156.538 134.951 1.00 43.36 O
ATOM 9093 CB GLN B 562 176.152 154.066 135.494 1.00 43.36 C
ATOM 9094 CG GLN B 562 175.870 152.589 135.671 1.00 43.36 C
ATOM 9095 CD GLN B 562 176.720 151.722 134.795 1.00 43.36 C
ATOM 9096 OE1 GLN B 562 177.723 152.168 134.249 1.00 43.36 O
ATOM 9097 NE2 GLN B 562 176.321 150.470 134.649 1.00 43.36 N
ATOM 9098 N ALA B 563 176.202 157.016 133.997 1.00 40.51 N
ATOM 9099 CA ALA B 563 175.959 158.448 134.116 1.00 40.51 C
ATOM 9100 C ALA B 563 174.860 158.896 133.167 1.00 40.51 C
ATOM 9101 O ALA B 563 173.945 159.629 133.569 1.00 40.51 O
ATOM 9102 CB ALA B 563 177.241 159.229 133.861 1.00 40.51 C
ATOM 9103 N LEU B 564 174.901 158.425 131.919 1.00 37.66 N
ATOM 9104 CA LEU B 564 173.824 158.751 130.988 1.00 37.66 C
ATOM 9105 C LEU B 564 172.510 158.113 131.416 1.00 37.66 C
ATOM 9106 O LEU B 564 171.438 158.715 131.266 1.00 37.66 O
ATOM 9107 CB LEU B 564 174.200 158.317 129.580 1.00 37.66 C
ATOM 9108 CG LEU B 564 173.177 158.596 128.492 1.00 37.66 C
ATOM 9109 CD1 LEU B 564 172.896 160.053 128.442 1.00 37.66 C
ATOM 9110 CD2 LEU B 564 173.725 158.141 127.173 1.00 37.66 C
ATOM 9111 N PHE B 565 172.578 156.923 132.013 1.00 32.66 N
ATOM 9112 CA PHE B 565 171.370 156.256 132.478 1.00 32.66 C
ATOM 9113 C PHE B 565 170.713 157.000 133.634 1.00 32.66 C
ATOM 9114 O PHE B 565 169.487 157.156 133.658 1.00 32.66 O
ATOM 9115 CB PHE B 565 171.705 154.829 132.878 1.00 32.66 C
ATOM 9116 CG PHE B 565 170.557 154.082 133.435 1.00 32.66 C
ATOM 9117 CD1 PHE B 565 169.526 153.684 132.626 1.00 32.66 C
ATOM 9118 CD2 PHE B 565 170.527 153.741 134.764 1.00 32.66 C
ATOM 9119 CE1 PHE B 565 168.470 152.987 133.135 1.00 32.66 C
ATOM 9120 CE2 PHE B 565 169.476 153.044 135.276 1.00 32.66 C
ATOM 9121 CZ PHE B 565 168.447 152.664 134.462 1.00 32.66 C
ATOM 9122 N ILE B 566 171.504 157.493 134.586 1.00 35.82 N
ATOM 9123 CA ILE B 566 170.924 158.218 135.713 1.00 35.82 C
ATOM 9124 C ILE B 566 170.410 159.577 135.262 1.00 35.82 C
ATOM 9125 O ILE B 566 169.371 160.057 135.746 1.00 35.82 O
ATOM 9126 CB ILE B 566 171.953 158.304 136.852 1.00 35.82 C
ATOM 9127 CG1 ILE B 566 172.128 156.922 137.459 1.00 35.82 C
ATOM 9128 CG2 ILE B 566 171.555 159.270 137.930 1.00 35.82 C
ATOM 9129 CD1 ILE B 566 173.262 156.834 138.412 1.00 35.82 C
ATOM 9130 N TRP B 567 171.076 160.178 134.269 1.00 40.01 N
ATOM 9131 CA TRP B 567 170.544 161.383 133.640 1.00 40.01 C
ATOM 9132 C TRP B 567 169.189 161.135 132.998 1.00 40.01 C
ATOM 9133 O TRP B 567 168.311 162.002 133.036 1.00 40.01 O
ATOM 9134 CB TRP B 567 171.503 161.894 132.578 1.00 40.01 C
ATOM 9135 CG TRP B 567 170.957 163.060 131.874 1.00 40.01 C
ATOM 9136 CD1 TRP B 567 170.855 164.312 132.354 1.00 40.01 C
ATOM 9137 CD2 TRP B 567 170.358 163.073 130.582 1.00 40.01 C
ATOM 9138 NE1 TRP B 567 170.268 165.126 131.428 1.00 40.01 N
ATOM 9139 CE2 TRP B 567 169.945 164.381 130.330 1.00 40.01 C
ATOM 9140 CE3 TRP B 567 170.136 162.104 129.613 1.00 40.01 C
ATOM 9141 CZ2 TRP B 567 169.335 164.751 129.151 1.00 40.01 C
ATOM 9142 CZ3 TRP B 567 169.531 162.474 128.441 1.00 40.01 C
ATOM 9143 CH2 TRP B 567 169.137 163.785 128.218 1.00 40.01 C
ATOM 9144 N SER B 568 168.997 159.964 132.403 1.00 37.40 N
ATOM 9145 CA SER B 568 167.704 159.693 131.787 1.00 37.40 C
ATOM 9146 C SER B 568 166.641 159.387 132.830 1.00 37.40 C
ATOM 9147 O SER B 568 165.470 159.723 132.639 1.00 37.40 O
ATOM 9148 CB SER B 568 167.816 158.545 130.796 1.00 37.40 C
ATOM 9149 OG SER B 568 166.548 158.233 130.255 1.00 37.40 O
ATOM 9150 N VAL B 569 167.020 158.747 133.935 1.00 32.54 N
ATOM 9151 CA VAL B 569 166.003 158.316 134.891 1.00 32.54 C
ATOM 9152 C VAL B 569 165.531 159.475 135.760 1.00 32.54 C
ATOM 9153 O VAL B 569 164.351 159.535 136.128 1.00 32.54 O
ATOM 9154 CB VAL B 569 166.534 157.130 135.714 1.00 32.54 C
ATOM 9155 CG1 VAL B 569 165.613 156.742 136.836 1.00 32.54 C
ATOM 9156 CG2 VAL B 569 166.666 155.947 134.816 1.00 32.54 C
ATOM 9157 N LEU B 570 166.406 160.445 136.049 1.00 34.35 N
ATOM 9158 CA LEU B 570 165.998 161.568 136.896 1.00 34.35 C
ATOM 9159 C LEU B 570 164.930 162.445 136.254 1.00 34.35 C
ATOM 9160 O LEU B 570 164.125 163.047 136.966 1.00 34.35 O
ATOM 9161 CB LEU B 570 167.195 162.432 137.266 1.00 34.35 C
ATOM 9162 CG LEU B 570 168.107 161.900 138.352 1.00 34.35 C
ATOM 9163 CD1 LEU B 570 169.291 162.812 138.505 1.00 34.35 C
ATOM 9164 CD2 LEU B 570 167.313 161.861 139.616 1.00 34.35 C
ATOM 9165 N GLN B 571 164.879 162.523 134.933 1.00 37.97 N
ATOM 9166 CA GLN B 571 163.909 163.403 134.301 1.00 37.97 C
ATOM 9167 C GLN B 571 162.588 162.723 133.973 1.00 37.97 C
ATOM 9168 O GLN B 571 161.756 163.341 133.302 1.00 37.97 O
ATOM 9169 CB GLN B 571 164.485 164.008 133.029 1.00 37.97 C
ATOM 9170 CG GLN B 571 165.615 164.958 133.267 1.00 37.97 C
ATOM 9171 CD GLN B 571 166.078 165.594 131.987 1.00 37.97 C
ATOM 9172 OE1 GLN B 571 165.555 165.296 130.919 1.00 37.97 O
ATOM 9173 NE2 GLN B 571 167.058 166.479 132.081 1.00 37.97 N
ATOM 9174 N ASN B 572 162.383 161.484 134.434 1.00 42.92 N
ATOM 9175 CA ASN B 572 161.186 160.673 134.154 1.00 42.92 C
ATOM 9176 C ASN B 572 160.925 160.524 132.660 1.00 42.92 C
ATOM 9177 O ASN B 572 159.837 160.815 132.168 1.00 42.92 O
ATOM 9178 CB ASN B 572 159.949 161.224 134.856 1.00 42.92 C
ATOM 9179 CG ASN B 572 160.023 161.082 136.345 1.00 42.92 C
ATOM 9180 OD1 ASN B 572 160.123 162.068 137.070 1.00 42.92 O
ATOM 9181 ND2 ASN B 572 159.955 159.853 136.820 1.00 42.92 N
ATOM 9182 N LYS B 573 161.936 160.073 131.926 1.00 43.16 N
ATOM 9183 CA LYS B 573 161.772 159.729 130.518 1.00 43.16 C
ATOM 9184 C LYS B 573 161.686 158.214 130.426 1.00 43.16 C
ATOM 9185 O LYS B 573 162.650 157.511 130.720 1.00 43.16 O
ATOM 9186 CB LYS B 573 162.922 160.274 129.688 1.00 43.16 C
ATOM 9187 CG LYS B 573 162.932 161.771 129.560 1.00 43.16 C
ATOM 9188 CD LYS B 573 164.072 162.214 128.673 1.00 43.16 C
ATOM 9189 CE LYS B 573 164.080 163.715 128.503 1.00 43.16 C
ATOM 9190 NZ LYS B 573 165.225 164.162 127.666 1.00 43.16 N
ATOM 9191 N LYS B 574 160.526 157.702 130.021 1.00 47.03 N
ATOM 9192 CA LYS B 574 160.331 156.257 130.007 1.00 47.03 C
ATOM 9193 C LYS B 574 161.043 155.617 128.827 1.00 47.03 C
ATOM 9194 O LYS B 574 161.953 154.791 128.997 1.00 47.03 O
ATOM 9195 CB LYS B 574 158.841 155.933 129.959 1.00 47.03 C
ATOM 9196 CG LYS B 574 158.099 156.311 131.211 1.00 47.03 C
ATOM 9197 CD LYS B 574 156.630 155.960 131.110 1.00 47.03 C
ATOM 9198 CE LYS B 574 155.892 156.370 132.370 1.00 47.03 C
ATOM 9199 NZ LYS B 574 154.445 156.041 132.308 1.00 47.03 N
ATOM 9200 N GLU B 575 160.647 156.006 127.617 1.00 43.71 N
ATOM 9201 CA GLU B 575 161.043 155.258 126.433 1.00 43.71 C
ATOM 9202 C GLU B 575 162.502 155.487 126.091 1.00 43.71 C
ATOM 9203 O GLU B 575 163.107 154.686 125.380 1.00 43.71 O
ATOM 9204 CB GLU B 575 160.148 155.625 125.256 1.00 43.71 C
ATOM 9205 N LEU B 576 163.091 156.570 126.584 1.00 40.71 N
ATOM 9206 CA LEU B 576 164.520 156.747 126.379 1.00 40.71 C
ATOM 9207 C LEU B 576 165.313 155.900 127.362 1.00 40.71 C
ATOM 9208 O LEU B 576 166.378 155.371 127.019 1.00 40.71 O
ATOM 9209 CB LEU B 576 164.880 158.227 126.496 1.00 40.71 C
ATOM 9210 CG LEU B 576 166.232 158.769 126.025 1.00 40.71 C
ATOM 9211 CD1 LEU B 576 167.347 158.652 127.046 1.00 40.71 C
ATOM 9212 CD2 LEU B 576 166.621 158.058 124.748 1.00 40.71 C
ATOM 9213 N SER B 577 164.810 155.750 128.584 1.00 40.93 N
ATOM 9214 CA SER B 577 165.558 154.997 129.578 1.00 40.93 C
ATOM 9215 C SER B 577 165.489 153.509 129.300 1.00 40.93 C
ATOM 9216 O SER B 577 166.452 152.785 129.567 1.00 40.93 O
ATOM 9217 CB SER B 577 165.031 155.278 130.970 1.00 40.93 C
ATOM 9218 OG SER B 577 163.753 154.697 131.097 1.00 40.93 O
ATOM 9219 N LYS B 578 164.375 153.035 128.737 1.00 43.86 N
ATOM 9220 CA LYS B 578 164.307 151.624 128.368 1.00 43.86 C
ATOM 9221 C LYS B 578 165.259 151.306 127.227 1.00 43.86 C
ATOM 9222 O LYS B 578 165.761 150.183 127.126 1.00 43.86 O
ATOM 9223 CB LYS B 578 162.884 151.235 127.996 1.00 43.86 C
ATOM 9224 CG LYS B 578 161.950 151.250 129.169 1.00 43.86 C
ATOM 9225 CD LYS B 578 160.552 150.864 128.766 1.00 43.86 C
ATOM 9226 CE LYS B 578 159.631 150.980 129.953 1.00 43.86 C
ATOM 9227 NZ LYS B 578 158.226 150.656 129.602 1.00 43.86 N
ATOM 9228 N VAL B 579 165.526 152.285 126.364 1.00 41.77 N
ATOM 9229 CA VAL B 579 166.500 152.088 125.298 1.00 41.77 C
ATOM 9230 C VAL B 579 167.908 152.096 125.855 1.00 41.77 C
ATOM 9231 O VAL B 579 168.711 151.205 125.556 1.00 41.77 O
ATOM 9232 CB VAL B 579 166.318 153.153 124.209 1.00 41.77 C
ATOM 9233 CG1 VAL B 579 167.466 153.113 123.238 1.00 41.77 C
ATOM 9234 CG2 VAL B 579 165.037 152.886 123.491 1.00 41.77 C
ATOM 9235 N ILE B 580 168.227 153.072 126.699 1.00 37.87 N
ATOM 9236 CA ILE B 580 169.601 153.164 127.172 1.00 37.87 C
ATOM 9237 C ILE B 580 169.908 152.116 128.240 1.00 37.87 C
ATOM 9238 O ILE B 580 171.079 151.897 128.562 1.00 37.87 O
ATOM 9239 CB ILE B 580 169.883 154.588 127.671 1.00 37.87 C
ATOM 9240 CG1 ILE B 580 171.356 154.916 127.516 1.00 37.87 C
ATOM 9241 CG2 ILE B 580 169.500 154.742 129.119 1.00 37.87 C
ATOM 9242 CD1 ILE B 580 171.775 154.969 126.085 1.00 37.87 C
ATOM 9243 N TRP B 581 168.894 151.426 128.767 1.00 38.04 N
ATOM 9244 CA TRP B 581 169.146 150.370 129.742 1.00 38.04 C
ATOM 9245 C TRP B 581 169.738 149.134 129.088 1.00 38.04 C
ATOM 9246 O TRP B 581 170.433 148.351 129.737 1.00 38.04 O
ATOM 9247 CB TRP B 581 167.853 150.008 130.458 1.00 38.04 C
ATOM 9248 CG TRP B 581 168.000 148.938 131.465 1.00 38.04 C
ATOM 9249 CD1 TRP B 581 168.655 149.015 132.640 1.00 38.04 C
ATOM 9250 CD2 TRP B 581 167.494 147.613 131.371 1.00 38.04 C
ATOM 9251 NE1 TRP B 581 168.580 147.821 133.303 1.00 38.04 N
ATOM 9252 CE2 TRP B 581 167.869 146.941 132.537 1.00 38.04 C
ATOM 9253 CE3 TRP B 581 166.752 146.930 130.411 1.00 38.04 C
ATOM 9254 CZ2 TRP B 581 167.530 145.625 132.773 1.00 38.04 C
ATOM 9255 CZ3 TRP B 581 166.418 145.627 130.645 1.00 38.04 C
ATOM 9256 CH2 TRP B 581 166.802 144.986 131.815 1.00 38.04 C
ATOM 9257 N GLU B 582 169.493 148.948 127.796 1.00 46.01 N
ATOM 9258 CA GLU B 582 169.934 147.718 127.155 1.00 46.01 C
ATOM 9259 C GLU B 582 171.401 147.783 126.758 1.00 46.01 C
ATOM 9260 O GLU B 582 171.939 146.822 126.203 1.00 46.01 O
ATOM 9261 CB GLU B 582 169.064 147.423 125.942 1.00 46.01 C
ATOM 9262 CG GLU B 582 167.632 147.112 126.303 1.00 46.01 C
ATOM 9263 CD GLU B 582 166.768 146.881 125.086 1.00 46.01 C
ATOM 9264 OE1 GLU B 582 167.281 147.024 123.958 1.00 46.01 O
ATOM 9265 OE2 GLU B 582 165.571 146.576 125.258 1.00 46.01 O
ATOM 9266 N GLN B 583 172.065 148.908 127.007 1.00 46.25 N
ATOM 9267 CA GLN B 583 173.464 149.004 126.617 1.00 46.25 C
ATOM 9268 C GLN B 583 174.387 148.966 127.825 1.00 46.25 C
ATOM 9269 O GLN B 583 175.608 148.865 127.672 1.00 46.25 O
ATOM 9270 CB GLN B 583 173.691 150.276 125.813 1.00 46.25 C
ATOM 9271 CG GLN B 583 172.823 150.355 124.593 1.00 46.25 C
ATOM 9272 CD GLN B 583 173.117 149.261 123.619 1.00 46.25 C
ATOM 9273 OE1 GLN B 583 174.271 148.896 123.410 1.00 46.25 O
ATOM 9274 NE2 GLN B 583 172.074 148.724 123.007 1.00 46.25 N
ATOM 9275 N THR B 584 173.835 149.060 129.031 1.00 45.48 N
ATOM 9276 CA THR B 584 174.690 149.142 130.207 1.00 45.48 C
ATOM 9277 C THR B 584 175.215 147.762 130.577 1.00 45.48 C
ATOM 9278 O THR B 584 174.694 146.740 130.131 1.00 45.48 O
ATOM 9279 CB THR B 584 173.938 149.765 131.379 1.00 45.48 C
ATOM 9280 OG1 THR B 584 174.852 150.005 132.451 1.00 45.48 O
ATOM 9281 CG2 THR B 584 172.862 148.849 131.867 1.00 45.48 C
ATOM 9282 N ARG B 585 176.281 147.737 131.373 1.00 48.64 N
ATOM 9283 CA ARG B 585 176.981 146.479 131.598 1.00 48.64 C
ATOM 9284 C ARG B 585 176.314 145.658 132.690 1.00 48.64 C
ATOM 9285 O ARG B 585 175.841 144.548 132.434 1.00 48.64 O
ATOM 9286 CB ARG B 585 178.441 146.748 131.939 1.00 48.64 C
ATOM 9287 CG ARG B 585 179.153 147.573 130.887 1.00 48.64 C
ATOM 9288 CD ARG B 585 179.253 146.853 129.553 1.00 48.64 C
ATOM 9289 NE ARG B 585 180.185 145.732 129.567 1.00 48.64 N
ATOM 9290 CZ ARG B 585 180.213 144.783 128.639 1.00 48.64 C
ATOM 9291 NH1 ARG B 585 179.356 144.817 127.631 1.00 48.64 N
ATOM 9292 NH2 ARG B 585 181.096 143.801 128.717 1.00 48.64 N
ATOM 9293 N GLY B 586 176.253 146.183 133.909 1.00 47.83 N
ATOM 9294 CA GLY B 586 175.661 145.436 135.001 1.00 47.83 C
ATOM 9295 C GLY B 586 174.166 145.646 135.037 1.00 47.83 C
ATOM 9296 O GLY B 586 173.687 146.643 135.577 1.00 47.83 O
ATOM 9297 N CYS B 587 173.416 144.689 134.491 1.00 47.07 N
ATOM 9298 CA CYS B 587 172.045 144.971 134.082 1.00 47.07 C
ATOM 9299 C CYS B 587 171.099 145.004 135.273 1.00 47.07 C
ATOM 9300 O CYS B 587 170.398 146.003 135.491 1.00 47.07 O
ATOM 9301 CB CYS B 587 171.606 143.933 133.061 1.00 47.07 C
ATOM 9302 SG CYS B 587 172.728 143.888 131.669 1.00 47.07 S
ATOM 9303 N THR B 588 171.078 143.929 136.066 1.00 43.32 N
ATOM 9304 CA THR B 588 170.175 143.871 137.210 1.00 43.32 C
ATOM 9305 C THR B 588 170.570 144.876 138.281 1.00 43.32 C
ATOM 9306 O THR B 588 169.706 145.430 138.975 1.00 43.32 O
ATOM 9307 CB THR B 588 170.121 142.460 137.782 1.00 43.32 C
ATOM 9308 OG1 THR B 588 169.299 142.459 138.948 1.00 43.32 O
ATOM 9309 CG2 THR B 588 171.484 141.948 138.131 1.00 43.32 C
ATOM 9310 N LEU B 589 171.865 145.181 138.381 1.00 43.21 N
ATOM 9311 CA LEU B 589 172.319 146.168 139.346 1.00 43.21 C
ATOM 9312 C LEU B 589 171.853 147.557 138.953 1.00 43.21 C
ATOM 9313 O LEU B 589 171.392 148.325 139.803 1.00 43.21 O
ATOM 9314 CB LEU B 589 173.834 146.125 139.455 1.00 43.21 C
ATOM 9315 CG LEU B 589 174.392 147.079 140.491 1.00 43.21 C
ATOM 9316 CD1 LEU B 589 173.883 146.690 141.850 1.00 43.21 C
ATOM 9317 CD2 LEU B 589 175.892 147.034 140.450 1.00 43.21 C
ATOM 9318 N ALA B 590 171.921 147.875 137.660 1.00 42.37 N
ATOM 9319 CA ALA B 590 171.472 149.179 137.195 1.00 42.37 C
ATOM 9320 C ALA B 590 169.967 149.322 137.324 1.00 42.37 C
ATOM 9321 O ALA B 590 169.470 150.398 137.687 1.00 42.37 O
ATOM 9322 CB ALA B 590 171.903 149.404 135.752 1.00 42.37 C
ATOM 9323 N ALA B 591 169.228 148.242 137.052 1.00 39.14 N
ATOM 9324 CA ALA B 591 167.780 148.285 137.211 1.00 39.14 C
ATOM 9325 C ALA B 591 167.395 148.516 138.662 1.00 39.14 C
ATOM 9326 O ALA B 591 166.529 149.353 138.965 1.00 39.14 O
ATOM 9327 CB ALA B 591 167.164 146.992 136.695 1.00 39.14 C
ATOM 9328 N LEU B 592 168.089 147.854 139.581 1.00 36.57 N
ATOM 9329 CA LEU B 592 167.703 147.983 140.973 1.00 36.57 C
ATOM 9330 C LEU B 592 168.151 149.327 141.539 1.00 36.57 C
ATOM 9331 O LEU B 592 167.483 149.900 142.413 1.00 36.57 O
ATOM 9332 CB LEU B 592 168.286 146.829 141.764 1.00 36.57 C
ATOM 9333 CG LEU B 592 167.466 146.610 143.014 1.00 36.57 C
ATOM 9334 CD1 LEU B 592 166.141 146.053 142.587 1.00 36.57 C
ATOM 9335 CD2 LEU B 592 168.153 145.672 143.935 1.00 36.57 C
ATOM 9336 N GLY B 593 169.254 149.868 141.019 1.00 38.94 N
ATOM 9337 CA GLY B 593 169.660 151.208 141.407 1.00 38.94 C
ATOM 9338 C GLY B 593 168.688 152.270 140.942 1.00 38.94 C
ATOM 9339 O GLY B 593 168.418 153.233 141.666 1.00 38.94 O
ATOM 9340 N ALA B 594 168.138 152.103 139.739 1.00 37.30 N
ATOM 9341 CA ALA B 594 167.109 153.026 139.274 1.00 37.30 C
ATOM 9342 C ALA B 594 165.863 152.940 140.140 1.00 37.30 C
ATOM 9343 O ALA B 594 165.211 153.960 140.399 1.00 37.30 O
ATOM 9344 CB ALA B 594 166.764 152.746 137.817 1.00 37.30 C
ATOM 9345 N SER B 595 165.535 151.737 140.625 1.00 37.82 N
ATOM 9346 CA SER B 595 164.390 151.610 141.526 1.00 37.82 C
ATOM 9347 C SER B 595 164.623 152.348 142.838 1.00 37.82 C
ATOM 9348 O SER B 595 163.746 153.094 143.304 1.00 37.82 O
ATOM 9349 CB SER B 595 164.099 150.151 141.829 1.00 37.82 C
ATOM 9350 OG SER B 595 165.078 149.647 142.709 1.00 37.82 O
ATOM 9351 N LYS B 596 165.803 152.174 143.442 1.00 36.83 N
ATOM 9352 CA LYS B 596 166.046 152.804 144.740 1.00 36.83 C
ATOM 9353 C LYS B 596 166.234 154.309 144.596 1.00 36.83 C
ATOM 9354 O LYS B 596 166.027 155.065 145.549 1.00 36.83 O
ATOM 9355 CB LYS B 596 167.246 152.164 145.430 1.00 36.83 C
ATOM 9356 CG LYS B 596 167.373 152.492 146.911 1.00 36.83 C
ATOM 9357 CD LYS B 596 168.389 153.567 147.194 1.00 36.83 C
ATOM 9358 CE LYS B 596 168.491 153.836 148.668 1.00 36.83 C
ATOM 9359 NZ LYS B 596 167.230 154.449 149.153 1.00 36.83 N1+
ATOM 9360 N LEU B 597 166.593 154.768 143.402 1.00 35.14 N
ATOM 9361 CA LEU B 597 166.654 156.205 143.176 1.00 35.14 C
ATOM 9362 C LEU B 597 165.261 156.798 143.022 1.00 35.14 C
ATOM 9363 O LEU B 597 164.963 157.864 143.581 1.00 35.14 O
ATOM 9364 CB LEU B 597 167.499 156.492 141.945 1.00 35.14 C
ATOM 9365 CG LEU B 597 167.732 157.953 141.636 1.00 35.14 C
ATOM 9366 CD1 LEU B 597 168.454 158.586 142.777 1.00 35.14 C
ATOM 9367 CD2 LEU B 597 168.562 158.044 140.397 1.00 35.14 C
ATOM 9368 N LEU B 598 164.386 156.122 142.280 1.00 34.60 N
ATOM 9369 CA LEU B 598 163.079 156.705 142.019 1.00 34.60 C
ATOM 9370 C LEU B 598 162.168 156.646 143.233 1.00 34.60 C
ATOM 9371 O LEU B 598 161.261 157.472 143.353 1.00 34.60 O
ATOM 9372 CB LEU B 598 162.414 156.035 140.834 1.00 34.60 C
ATOM 9373 CG LEU B 598 163.054 156.416 139.520 1.00 34.60 C
ATOM 9374 CD1 LEU B 598 162.350 155.682 138.415 1.00 34.60 C
ATOM 9375 CD2 LEU B 598 162.960 157.896 139.325 1.00 34.60 C
ATOM 9376 N LYS B 599 162.383 155.692 144.146 1.00 39.19 N
ATOM 9377 CA LYS B 599 161.621 155.733 145.397 1.00 39.19 C
ATOM 9378 C LYS B 599 161.931 156.994 146.196 1.00 39.19 C
ATOM 9379 O LYS B 599 161.018 157.677 146.685 1.00 39.19 O
ATOM 9380 CB LYS B 599 161.904 154.506 146.252 1.00 39.19 C
ATOM 9381 CG LYS B 599 161.467 153.201 145.664 1.00 39.19 C
ATOM 9382 CD LYS B 599 159.981 153.023 145.652 1.00 39.19 C
ATOM 9383 CE LYS B 599 159.678 151.631 145.139 1.00 39.19 C
ATOM 9384 NZ LYS B 599 158.231 151.328 145.072 1.00 39.19 N1+
ATOM 9385 N SER B 600 163.213 157.340 146.306 1.00 38.87 N
ATOM 9386 CA SER B 600 163.594 158.516 147.078 1.00 38.87 C
ATOM 9387 C SER B 600 163.200 159.797 146.364 1.00 38.87 C
ATOM 9388 O SER B 600 162.953 160.820 147.008 1.00 38.87 O
ATOM 9389 CB SER B 600 165.090 158.499 147.354 1.00 38.87 C
ATOM 9390 OG SER B 600 165.469 159.651 148.075 1.00 38.87 O
ATOM 9391 N MET B 601 163.142 159.770 145.035 1.00 41.08 N
ATOM 9392 CA MET B 601 162.547 160.901 144.328 1.00 41.08 C
ATOM 9393 C MET B 601 161.040 160.955 144.530 1.00 41.08 C
ATOM 9394 O MET B 601 160.434 162.023 144.422 1.00 41.08 O
ATOM 9395 CB MET B 601 162.875 160.830 142.845 1.00 41.08 C
ATOM 9396 CG MET B 601 164.246 161.317 142.498 1.00 41.08 C
ATOM 9397 SD MET B 601 164.298 163.091 142.684 1.00 41.08 S
ATOM 9398 CE MET B 601 163.206 163.540 141.343 1.00 41.08 C
ATOM 9399 N ALA B 602 160.412 159.812 144.795 1.00 42.10 N
ATOM 9400 CA ALA B 602 158.962 159.795 144.935 1.00 42.10 C
ATOM 9401 C ALA B 602 158.525 160.226 146.325 1.00 42.10 C
ATOM 9402 O ALA B 602 157.368 160.607 146.522 1.00 42.10 O
ATOM 9403 CB ALA B 602 158.420 158.406 144.617 1.00 42.10 C
ATOM 9404 N LYS B 603 159.424 160.161 147.310 1.00 50.03 N
ATOM 9405 CA LYS B 603 159.037 160.573 148.660 1.00 50.03 C
ATOM 9406 C LYS B 603 158.877 162.083 148.798 1.00 50.03 C
ATOM 9407 O LYS B 603 158.392 162.560 149.828 1.00 50.03 O
ATOM 9408 CB LYS B 603 160.045 160.095 149.697 1.00 50.03 C
ATOM 9409 CG LYS B 603 159.943 158.657 150.086 1.00 50.03 C
ATOM 9410 CD LYS B 603 160.922 158.405 151.202 1.00 50.03 C
ATOM 9411 CE LYS B 603 160.892 156.975 151.660 1.00 50.03 C
ATOM 9412 NZ LYS B 603 161.883 156.768 152.745 1.00 50.03 N
ATOM 9413 N VAL B 604 159.314 162.861 147.807 1.00 54.31 N
ATOM 9414 CA VAL B 604 159.161 164.305 147.910 1.00 54.31 C
ATOM 9415 C VAL B 604 157.705 164.658 147.641 1.00 54.31 C
ATOM 9416 O VAL B 604 156.956 163.873 147.047 1.00 54.31 O
ATOM 9417 CB VAL B 604 160.116 165.022 146.942 1.00 54.31 C
ATOM 9418 CG1 VAL B 604 159.575 165.005 145.536 1.00 54.31 C
ATOM 9419 CG2 VAL B 604 160.442 166.423 147.421 1.00 54.31 C
ATOM 9420 N LYS B 605 157.272 165.818 148.134 1.00 61.19 N
ATOM 9421 CA LYS B 605 155.878 166.229 148.038 1.00 61.19 C
ATOM 9422 C LYS B 605 155.724 167.666 147.567 1.00 61.19 C
ATOM 9423 O LYS B 605 154.766 168.336 147.959 1.00 61.19 O
ATOM 9424 CB LYS B 605 155.182 166.050 149.385 1.00 61.19 C
ATOM 9425 CG LYS B 605 155.056 164.607 149.842 1.00 61.19 C
ATOM 9426 CD LYS B 605 154.462 164.517 151.226 1.00 61.19 C
ATOM 9427 CE LYS B 605 154.455 163.088 151.727 1.00 61.19 C
ATOM 9428 NZ LYS B 605 153.901 163.000 153.102 1.00 61.19 N
ATOM 9429 N ASN B 606 156.652 168.166 146.757 1.00 57.88 N
ATOM 9430 CA ASN B 606 156.516 169.521 146.238 1.00 57.88 C
ATOM 9431 C ASN B 606 155.601 169.545 145.021 1.00 57.88 C
ATOM 9432 O ASN B 606 154.801 170.471 144.848 1.00 57.88 O
ATOM 9433 CB ASN B 606 157.891 170.081 145.893 1.00 57.88 C
ATOM 9434 CG ASN B 606 157.881 171.574 145.705 1.00 57.88 C
ATOM 9435 OD1 ASN B 606 156.860 172.230 145.877 1.00 57.88 O
ATOM 9436 ND2 ASN B 606 159.029 172.123 145.345 1.00 57.88 N
ATOM 9437 N ASP B 607 155.708 168.537 144.163 1.00 64.60 N
ATOM 9438 CA ASP B 607 154.936 168.449 142.927 1.00 64.60 C
ATOM 9439 C ASP B 607 154.491 167.004 142.774 1.00 64.60 C
ATOM 9440 O ASP B 607 155.325 166.096 142.733 1.00 64.60 O
ATOM 9441 CB ASP B 607 155.776 168.899 141.735 1.00 64.60 C
ATOM 9442 CG ASP B 607 154.958 169.102 140.479 1.00 64.60 C
ATOM 9443 OD1 ASP B 607 153.725 168.909 140.516 1.00 64.60 O
ATOM 9444 OD2 ASP B 607 155.558 169.460 139.445 1.00 64.60 O
ATOM 9445 N ILE B 608 153.182 166.787 142.673 1.00 58.76 N
ATOM 9446 CA ILE B 608 152.667 165.424 142.738 1.00 58.76 C
ATOM 9447 C ILE B 608 152.625 164.797 141.345 1.00 58.76 C
ATOM 9448 O ILE B 608 152.659 163.563 141.199 1.00 58.76 O
ATOM 9449 CB ILE B 608 151.295 165.426 143.440 1.00 58.76 C
ATOM 9450 CG1 ILE B 608 150.878 164.020 143.847 1.00 58.76 C
ATOM 9451 CG2 ILE B 608 150.239 166.070 142.579 1.00 58.76 C
ATOM 9452 CD1 ILE B 608 149.748 164.008 144.821 1.00 58.76 C
ATOM 9453 N ASN B 609 152.623 165.634 140.303 1.00 62.64 N
ATOM 9454 CA ASN B 609 152.487 165.144 138.934 1.00 62.64 C
ATOM 9455 C ASN B 609 153.717 164.366 138.491 1.00 62.64 C
ATOM 9456 O ASN B 609 153.601 163.354 137.794 1.00 62.64 O
ATOM 9457 CB ASN B 609 152.239 166.309 137.985 1.00 62.64 C
ATOM 9458 CG ASN B 609 150.883 166.915 138.171 1.00 62.64 C
ATOM 9459 OD1 ASN B 609 149.896 166.205 138.344 1.00 62.64 O
ATOM 9460 ND2 ASN B 609 150.818 168.239 138.141 1.00 62.64 N
ATOM 9461 N ALA B 610 154.904 164.827 138.875 1.00 62.38 N
ATOM 9462 CA ALA B 610 156.099 164.042 138.603 1.00 62.38 C
ATOM 9463 C ALA B 610 156.175 162.836 139.526 1.00 62.38 C
ATOM 9464 O ALA B 610 156.703 161.785 139.141 1.00 62.38 O
ATOM 9465 CB ALA B 610 157.347 164.911 138.745 1.00 62.38 C
ATOM 9466 N ALA B 611 155.625 162.960 140.737 1.00 60.04 N
ATOM 9467 CA ALA B 611 155.806 161.928 141.752 1.00 60.04 C
ATOM 9468 C ALA B 611 155.038 160.659 141.413 1.00 60.04 C
ATOM 9469 O ALA B 611 155.543 159.545 141.626 1.00 60.04 O
ATOM 9470 CB ALA B 611 155.382 162.455 143.116 1.00 60.04 C
ATOM 9471 N GLY B 612 153.824 160.803 140.876 1.00 64.17 N
ATOM 9472 CA GLY B 612 153.067 159.626 140.473 1.00 64.17 C
ATOM 9473 C GLY B 612 153.740 158.844 139.359 1.00 64.17 C
ATOM 9474 O GLY B 612 153.860 157.610 139.430 1.00 64.17 O
ATOM 9475 N GLU B 613 154.239 159.557 138.344 1.00 66.09 N
ATOM 9476 CA GLU B 613 154.938 158.908 137.243 1.00 66.09 C
ATOM 9477 C GLU B 613 156.240 158.289 137.714 1.00 66.09 C
ATOM 9478 O GLU B 613 156.659 157.241 137.208 1.00 66.09 O
ATOM 9479 CB GLU B 613 155.213 159.915 136.139 1.00 66.09 C
ATOM 9480 CG GLU B 613 153.964 160.518 135.563 1.00 66.09 C
ATOM 9481 CD GLU B 613 154.262 161.528 134.482 1.00 66.09 C
ATOM 9482 OE1 GLU B 613 155.456 161.782 134.224 1.00 66.09 O
ATOM 9483 OE2 GLU B 613 153.304 162.082 133.904 1.00 66.09 O
ATOM 9484 N SER B 614 156.870 158.905 138.713 1.00 52.74 N
ATOM 9485 CA SER B 614 158.118 158.372 139.234 1.00 52.74 C
ATOM 9486 C SER B 614 157.892 157.057 139.960 1.00 52.74 C
ATOM 9487 O SER B 614 158.663 156.106 139.787 1.00 52.74 O
ATOM 9488 CB SER B 614 158.776 159.388 140.158 1.00 52.74 C
ATOM 9489 OG SER B 614 159.999 158.876 140.647 1.00 52.74 O
ATOM 9490 N GLU B 615 156.820 156.965 140.748 1.00 57.37 N
ATOM 9491 CA GLU B 615 156.590 155.710 141.456 1.00 57.37 C
ATOM 9492 C GLU B 615 156.148 154.609 140.496 1.00 57.37 C
ATOM 9493 O GLU B 615 156.511 153.433 140.677 1.00 57.37 O
ATOM 9494 CB GLU B 615 155.578 155.906 142.578 1.00 57.37 C
ATOM 9495 CG GLU B 615 155.498 154.724 143.517 1.00 57.37 C
ATOM 9496 CD GLU B 615 154.642 155.004 144.724 1.00 57.37 C
ATOM 9497 OE1 GLU B 615 154.089 156.116 144.806 1.00 57.37 O
ATOM 9498 OE2 GLU B 615 154.529 154.118 145.596 1.00 57.37 O1-
ATOM 9499 N GLU B 616 155.427 154.977 139.427 1.00 61.87 N
ATOM 9500 CA GLU B 616 155.081 153.976 138.415 1.00 61.87 C
ATOM 9501 C GLU B 616 156.312 153.471 137.673 1.00 61.87 C
ATOM 9502 O GLU B 616 156.434 152.266 137.411 1.00 61.87 O
ATOM 9503 CB GLU B 616 154.071 154.525 137.417 1.00 61.87 C
ATOM 9504 CG GLU B 616 152.677 154.668 137.973 1.00 61.87 C
ATOM 9505 CD GLU B 616 151.687 155.166 136.939 1.00 61.87 C
ATOM 9506 OE1 GLU B 616 152.115 155.501 135.814 1.00 61.87 O
ATOM 9507 OE2 GLU B 616 150.477 155.226 137.248 1.00 61.87 O
ATOM 9508 N LEU B 617 157.239 154.371 137.333 1.00 45.35 N
ATOM 9509 CA LEU B 617 158.457 153.941 136.657 1.00 45.35 C
ATOM 9510 C LEU B 617 159.324 153.089 137.575 1.00 45.35 C
ATOM 9511 O LEU B 617 159.981 152.142 137.119 1.00 45.35 O
ATOM 9512 CB LEU B 617 159.232 155.152 136.154 1.00 45.35 C
ATOM 9513 CG LEU B 617 160.441 154.818 135.294 1.00 45.35 C
ATOM 9514 CD1 LEU B 617 159.976 154.114 134.060 1.00 45.35 C
ATOM 9515 CD2 LEU B 617 161.140 156.081 134.904 1.00 45.35 C
ATOM 9516 N ALA B 618 159.287 153.369 138.879 1.00 46.11 N
ATOM 9517 CA ALA B 618 160.049 152.560 139.824 1.00 46.11 C
ATOM 9518 C ALA B 618 159.522 151.138 139.899 1.00 46.11 C
ATOM 9519 O ALA B 618 160.307 150.178 139.876 1.00 46.11 O
ATOM 9520 CB ALA B 618 160.017 153.194 141.207 1.00 46.11 C
ATOM 9521 N ASN B 619 158.198 150.978 139.983 1.00 50.92 N
ATOM 9522 CA ASN B 619 157.642 149.625 140.009 1.00 50.92 C
ATOM 9523 C ASN B 619 157.875 148.900 138.688 1.00 50.92 C
ATOM 9524 O ASN B 619 158.139 147.683 138.672 1.00 50.92 O
ATOM 9525 CB ASN B 619 156.158 149.667 140.345 1.00 50.92 C
ATOM 9526 CG ASN B 619 155.914 149.981 141.791 1.00 50.92 C
ATOM 9527 OD1 ASN B 619 156.610 149.473 142.666 1.00 50.92 O
ATOM 9528 ND2 ASN B 619 154.931 150.828 142.060 1.00 50.92 N
ATOM 9529 N GLU B 620 157.840 149.639 137.576 1.00 50.67 N
ATOM 9530 CA GLU B 620 158.091 149.024 136.282 1.00 50.67 C
ATOM 9531 C GLU B 620 159.536 148.573 136.128 1.00 50.67 C
ATOM 9532 O GLU B 620 159.789 147.577 135.449 1.00 50.67 O
ATOM 9533 CB GLU B 620 157.707 149.992 135.171 1.00 50.67 C
ATOM 9534 CG GLU B 620 157.696 149.380 133.800 1.00 50.67 C
ATOM 9535 CD GLU B 620 157.176 150.330 132.760 1.00 50.67 C
ATOM 9536 OE1 GLU B 620 156.894 151.492 133.109 1.00 50.67 O
ATOM 9537 OE2 GLU B 620 157.022 149.910 131.598 1.00 50.67 O
ATOM 9538 N TYR B 621 160.487 149.241 136.770 1.00 39.98 N
ATOM 9539 CA TYR B 621 161.849 148.715 136.762 1.00 39.98 C
ATOM 9540 C TYR B 621 162.071 147.577 137.742 1.00 39.98 C
ATOM 9541 O TYR B 621 162.898 146.695 137.471 1.00 39.98 O
ATOM 9542 CB TYR B 621 162.871 149.815 137.023 1.00 39.98 C
ATOM 9543 CG TYR B 621 163.368 150.439 135.758 1.00 39.98 C
ATOM 9544 CD1 TYR B 621 164.364 149.832 135.034 1.00 39.98 C
ATOM 9545 CD2 TYR B 621 162.845 151.617 135.280 1.00 39.98 C
ATOM 9546 CE1 TYR B 621 164.832 150.376 133.879 1.00 39.98 C
ATOM 9547 CE2 TYR B 621 163.308 152.177 134.119 1.00 39.98 C
ATOM 9548 CZ TYR B 621 164.302 151.548 133.422 1.00 39.98 C
ATOM 9549 OH TYR B 621 164.776 152.106 132.263 1.00 39.98 O
ATOM 9550 N GLU B 622 161.346 147.559 138.862 1.00 48.50 N
ATOM 9551 CA GLU B 622 161.486 146.443 139.794 1.00 48.50 C
ATOM 9552 C GLU B 622 161.029 145.129 139.171 1.00 48.50 C
ATOM 9553 O GLU B 622 161.711 144.099 139.309 1.00 48.50 O
ATOM 9554 CB GLU B 622 160.702 146.711 141.067 1.00 48.50 C
ATOM 9555 CG GLU B 622 160.889 145.630 142.088 1.00 48.50 C
ATOM 9556 CD GLU B 622 159.985 145.784 143.288 1.00 48.50 C
ATOM 9557 OE1 GLU B 622 159.208 146.761 143.339 1.00 48.50 O
ATOM 9558 OE2 GLU B 622 160.033 144.904 144.173 1.00 48.50 O
ATOM 9559 N THR B 623 159.903 145.150 138.446 1.00 46.60 N
ATOM 9560 CA THR B 623 159.425 143.907 137.834 1.00 46.60 C
ATOM 9561 C THR B 623 160.355 143.436 136.723 1.00 46.60 C
ATOM 9562 O THR B 623 160.530 142.226 136.522 1.00 46.60 O
ATOM 9563 CB THR B 623 158.018 144.071 137.277 1.00 46.60 C
ATOM 9564 OG1 THR B 623 158.040 145.025 136.213 1.00 46.60 O
ATOM 9565 CG2 THR B 623 157.069 144.538 138.354 1.00 46.60 C
ATOM 9566 N ARG B 624 160.993 144.369 136.021 1.00 41.66 N
ATOM 9567 CA ARG B 624 161.923 143.975 134.974 1.00 41.66 C
ATOM 9568 C ARG B 624 163.182 143.366 135.565 1.00 41.66 C
ATOM 9569 O ARG B 624 163.719 142.386 135.029 1.00 41.66 O
ATOM 9570 CB ARG B 624 162.252 145.173 134.102 1.00 41.66 C
ATOM 9571 CG ARG B 624 163.117 144.845 132.930 1.00 41.66 C
ATOM 9572 CD ARG B 624 163.174 146.028 132.025 1.00 41.66 C
ATOM 9573 NE ARG B 624 161.860 146.301 131.466 1.00 41.66 N
ATOM 9574 CZ ARG B 624 161.565 147.386 130.770 1.00 41.66 C
ATOM 9575 NH1 ARG B 624 162.492 148.304 130.548 1.00 41.66 N1+
ATOM 9576 NH2 ARG B 624 160.344 147.559 130.295 1.00 41.66 N
ATOM 9577 N ALA B 625 163.629 143.891 136.705 1.00 38.37 N
ATOM 9578 CA ALA B 625 164.784 143.308 137.374 1.00 38.37 C
ATOM 9579 C ALA B 625 164.490 141.898 137.865 1.00 38.37 C
ATOM 9580 O ALA B 625 165.329 140.998 137.730 1.00 38.37 O
ATOM 9581 CB ALA B 625 165.220 144.188 138.534 1.00 38.37 C
ATOM 9582 N VAL B 626 163.286 141.668 138.395 1.00 40.27 N
ATOM 9583 CA VAL B 626 163.023 140.339 138.941 1.00 40.27 C
ATOM 9584 C VAL B 626 162.809 139.324 137.818 1.00 40.27 C
ATOM 9585 O VAL B 626 163.220 138.161 137.938 1.00 40.27 O
ATOM 9586 CB VAL B 626 161.863 140.360 139.958 1.00 40.27 C
ATOM 9587 CG1 VAL B 626 160.527 140.625 139.331 1.00 40.27 C
ATOM 9588 CG2 VAL B 626 161.809 139.066 140.700 1.00 40.27 C
ATOM 9589 N GLU B 627 162.252 139.755 136.678 1.00 41.06 N
ATOM 9590 CA GLU B 627 162.105 138.829 135.559 1.00 41.06 C
ATOM 9591 C GLU B 627 163.462 138.455 134.969 1.00 41.06 C
ATOM 9592 O GLU B 627 163.713 137.274 134.677 1.00 41.06 O
ATOM 9593 CB GLU B 627 161.197 139.427 134.488 1.00 41.06 C
ATOM 9594 N LEU B 628 164.362 139.442 134.837 1.00 40.62 N
ATOM 9595 CA LEU B 628 165.712 139.162 134.347 1.00 40.62 C
ATOM 9596 C LEU B 628 166.468 138.228 135.276 1.00 40.62 C
ATOM 9597 O LEU B 628 167.152 137.309 134.813 1.00 40.62 O
ATOM 9598 CB LEU B 628 166.501 140.454 134.170 1.00 40.62 C
ATOM 9599 CG LEU B 628 167.974 140.275 133.807 1.00 40.62 C
ATOM 9600 CD1 LEU B 628 168.122 139.603 132.467 1.00 40.62 C
ATOM 9601 CD2 LEU B 628 168.684 141.593 133.821 1.00 40.62 C
ATOM 9602 N PHE B 629 166.342 138.417 136.587 1.00 40.82 N
ATOM 9603 CA PHE B 629 167.130 137.563 137.465 1.00 40.82 C
ATOM 9604 C PHE B 629 166.542 136.166 137.579 1.00 40.82 C
ATOM 9605 O PHE B 629 167.293 135.213 137.788 1.00 40.82 O
ATOM 9606 CB PHE B 629 167.281 138.172 138.844 1.00 40.82 C
ATOM 9607 CG PHE B 629 168.193 137.399 139.720 1.00 40.82 C
ATOM 9608 CD1 PHE B 629 169.549 137.452 139.528 1.00 40.82 C
ATOM 9609 CD2 PHE B 629 167.693 136.595 140.712 1.00 40.82 C
ATOM 9610 CE1 PHE B 629 170.388 136.737 140.331 1.00 40.82 C
ATOM 9611 CE2 PHE B 629 168.523 135.879 141.513 1.00 40.82 C
ATOM 9612 CZ PHE B 629 169.868 135.943 141.318 1.00 40.82 C
ATOM 9613 N THR B 630 165.224 136.010 137.423 1.00 43.93 N
ATOM 9614 CA THR B 630 164.669 134.660 137.352 1.00 43.93 C
ATOM 9615 C THR B 630 165.166 133.928 136.115 1.00 43.93 C
ATOM 9616 O THR B 630 165.590 132.761 136.198 1.00 43.93 O
ATOM 9617 CB THR B 630 163.146 134.713 137.367 1.00 43.93 C
ATOM 9618 OG1 THR B 630 162.710 135.218 138.632 1.00 43.93 O
ATOM 9619 CG2 THR B 630 162.550 133.344 137.159 1.00 43.93 C
ATOM 9620 N GLU B 631 165.183 134.624 134.976 1.00 48.54 N
ATOM 9621 CA GLU B 631 165.693 134.014 133.755 1.00 48.54 C
ATOM 9622 C GLU B 631 167.172 133.664 133.872 1.00 48.54 C
ATOM 9623 O GLU B 631 167.588 132.579 133.459 1.00 48.54 O
ATOM 9624 CB GLU B 631 165.454 134.944 132.575 1.00 48.54 C
ATOM 9625 CG GLU B 631 165.920 134.375 131.262 1.00 48.54 C
ATOM 9626 CD GLU B 631 165.121 133.168 130.827 1.00 48.54 C
ATOM 9627 OE1 GLU B 631 163.926 133.066 131.189 1.00 48.54 O
ATOM 9628 OE2 GLU B 631 165.690 132.315 130.114 1.00 48.54 O
ATOM 9629 N CYS B 632 167.964 134.528 134.507 1.00 48.09 N
ATOM 9630 CA CYS B 632 169.391 134.253 134.647 1.00 48.09 C
ATOM 9631 C CYS B 632 169.654 133.189 135.704 1.00 48.09 C
ATOM 9632 O CYS B 632 170.691 132.521 135.680 1.00 48.09 O
ATOM 9633 CB CYS B 632 170.129 135.542 134.983 1.00 48.09 C
ATOM 9634 SG CYS B 632 171.912 135.403 135.053 1.00 48.09 S
ATOM 9635 N TYR B 633 168.729 133.011 136.640 1.00 48.82 N
ATOM 9636 CA TYR B 633 168.922 131.990 137.658 1.00 48.82 C
ATOM 9637 C TYR B 633 168.505 130.633 137.135 1.00 48.82 C
ATOM 9638 O TYR B 633 168.816 129.602 137.741 1.00 48.82 O
ATOM 9639 CB TYR B 633 168.127 132.358 138.901 1.00 48.82 C
ATOM 9640 CG TYR B 633 168.375 131.488 140.095 1.00 48.82 C
ATOM 9641 CD1 TYR B 633 169.552 131.592 140.805 1.00 48.82 C
ATOM 9642 CD2 TYR B 633 167.426 130.583 140.525 1.00 48.82 C
ATOM 9643 CE1 TYR B 633 169.785 130.816 141.902 1.00 48.82 C
ATOM 9644 CE2 TYR B 633 167.654 129.798 141.626 1.00 48.82 C
ATOM 9645 CZ TYR B 633 168.841 129.923 142.308 1.00 48.82 C
ATOM 9646 OH TYR B 633 169.106 129.153 143.413 1.00 48.82 O
ATOM 9647 N SER B 634 167.758 130.616 136.031 1.00 49.58 N
ATOM 9648 CA SER B 634 167.373 129.338 135.441 1.00 49.58 C
ATOM 9649 C SER B 634 168.570 128.560 134.897 1.00 49.58 C
ATOM 9650 O SER B 634 168.570 127.327 134.939 1.00 49.58