PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2022-09-16
Number of transmembrane proteins: 7692 (alpha: 7123 , beta: 509 )
Content of 4tnj
HEADER    ELECTRON TRANSPORT,PHOTOSYNTHESIS       04-JUN-14   4TNJ              
TITLE RT XFEL STRUCTURE OF PHOTOSYSTEM II 500 MS AFTER THE 2ND ILLUMINATION
TITLE 2 (2F) AT 4.5 A RESOLUTION
COMPND MOL_ID: 1;
COMPND 2 MOLECULE: PHOTOSYSTEM Q(B) PROTEIN 1;
COMPND 3 CHAIN: A, a;
COMPND 4 FRAGMENT: UNP RESIDUES 1-344;
COMPND 5 SYNONYM: 32 KDA THYLAKOID MEMBRANE PROTEIN 1,PHOTOSYSTEM II PROTEIN
COMPND 6 D1 1;
COMPND 7 EC: 1.10.3.9;
COMPND 8 MOL_ID: 2;
COMPND 9 MOLECULE: PHOTOSYSTEM II CORE LIGHT HARVESTING PROTEIN;
COMPND 10 CHAIN: B, b;
COMPND 11 MOL_ID: 3;
COMPND 12 MOLECULE: PHOTOSYSTEM II CP43 PROTEIN;
COMPND 13 CHAIN: C, c;
COMPND 14 MOL_ID: 4;
COMPND 15 MOLECULE: PHOTOSYSTEM II D2 PROTEIN;
COMPND 16 CHAIN: D, d;
COMPND 17 SYNONYM: PSII D2 PROTEIN,PHOTOSYSTEM Q(A) PROTEIN;
COMPND 18 EC: 1.10.3.9;
COMPND 19 MOL_ID: 5;
COMPND 20 MOLECULE: CYTOCHROME B559 SUBUNIT ALPHA;
COMPND 21 CHAIN: E, e;
COMPND 22 SYNONYM: PSII REACTION CENTER SUBUNIT V;
COMPND 23 MOL_ID: 6;
COMPND 24 MOLECULE: CYTOCHROME B559 SUBUNIT BETA;
COMPND 25 CHAIN: F, f;
COMPND 26 SYNONYM: PSII REACTION CENTER SUBUNIT VI;
COMPND 27 MOL_ID: 7;
COMPND 28 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN H;
COMPND 29 CHAIN: H, h;
COMPND 30 SYNONYM: PSII-H;
COMPND 31 MOL_ID: 8;
COMPND 32 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN I;
COMPND 33 CHAIN: I, i;
COMPND 34 SYNONYM: PSII-I,PSII 4.4 KDA PROTEIN;
COMPND 35 MOL_ID: 9;
COMPND 36 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN J;
COMPND 37 CHAIN: J, j;
COMPND 38 SYNONYM: PSII-J;
COMPND 39 MOL_ID: 10;
COMPND 40 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN K;
COMPND 41 CHAIN: K, k;
COMPND 42 SYNONYM: PSII-K;
COMPND 43 MOL_ID: 11;
COMPND 44 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN L;
COMPND 45 CHAIN: L, l;
COMPND 46 SYNONYM: PSII-L,PSII 5 KDA PROTEIN;
COMPND 47 MOL_ID: 12;
COMPND 48 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN M;
COMPND 49 CHAIN: M, m;
COMPND 50 SYNONYM: PSII-M;
COMPND 51 MOL_ID: 13;
COMPND 52 MOLECULE: PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE;
COMPND 53 CHAIN: O, o;
COMPND 54 SYNONYM: MSP;
COMPND 55 MOL_ID: 14;
COMPND 56 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN T;
COMPND 57 CHAIN: T, t;
COMPND 58 SYNONYM: PSII-TC;
COMPND 59 MOL_ID: 15;
COMPND 60 MOLECULE: PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN;
COMPND 61 CHAIN: U, u;
COMPND 62 SYNONYM: PS II COMPLEX 12 KDA EXTRINSIC PROTEIN,PSII-U;
COMPND 63 MOL_ID: 16;
COMPND 64 MOLECULE: CYTOCHROME C-550;
COMPND 65 CHAIN: V, v;
COMPND 66 SYNONYM: CYTOCHROME C-549,CYTOCHROME C550,LOW-POTENTIAL CYTOCHROME C;
COMPND 67 MOL_ID: 17;
COMPND 68 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN YCF12;
COMPND 69 CHAIN: y, g;
COMPND 70 MOL_ID: 18;
COMPND 71 MOLECULE: PHOTOSYSTEM II REACTION CENTER X PROTEIN;
COMPND 72 CHAIN: X, x;
COMPND 73 MOL_ID: 19;
COMPND 74 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN Y;
COMPND 75 CHAIN: Y, G;
COMPND 76 FRAGMENT: SEE REMARK 999;
COMPND 77 MOL_ID: 20;
COMPND 78 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN Z;
COMPND 79 CHAIN: Z, z;
COMPND 80 SYNONYM: PSII-Z
SOURCE MOL_ID: 1;
SOURCE 2 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 3 ORGANISM_TAXID: 197221;
SOURCE 4 STRAIN: BP-1;
SOURCE 5 MOL_ID: 2;
SOURCE 6 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 7 ORGANISM_TAXID: 197221;
SOURCE 8 STRAIN: BP-1;
SOURCE 9 MOL_ID: 3;
SOURCE 10 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 11 ORGANISM_TAXID: 197221;
SOURCE 12 STRAIN: BP-1;
SOURCE 13 MOL_ID: 4;
SOURCE 14 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 15 ORGANISM_TAXID: 197221;
SOURCE 16 STRAIN: BP-1;
SOURCE 17 MOL_ID: 5;
SOURCE 18 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 19 ORGANISM_TAXID: 197221;
SOURCE 20 STRAIN: BP-1;
SOURCE 21 MOL_ID: 6;
SOURCE 22 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 23 ORGANISM_TAXID: 197221;
SOURCE 24 STRAIN: BP-1;
SOURCE 25 MOL_ID: 7;
SOURCE 26 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 27 ORGANISM_TAXID: 197221;
SOURCE 28 STRAIN: BP-1;
SOURCE 29 MOL_ID: 8;
SOURCE 30 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 31 ORGANISM_TAXID: 197221;
SOURCE 32 STRAIN: BP-1;
SOURCE 33 MOL_ID: 9;
SOURCE 34 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 35 ORGANISM_TAXID: 197221;
SOURCE 36 STRAIN: BP-1;
SOURCE 37 MOL_ID: 10;
SOURCE 38 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 39 ORGANISM_TAXID: 197221;
SOURCE 40 STRAIN: BP-1;
SOURCE 41 MOL_ID: 11;
SOURCE 42 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 43 ORGANISM_TAXID: 197221;
SOURCE 44 STRAIN: BP-1;
SOURCE 45 MOL_ID: 12;
SOURCE 46 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 47 ORGANISM_TAXID: 197221;
SOURCE 48 STRAIN: BP-1;
SOURCE 49 MOL_ID: 13;
SOURCE 50 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 51 ORGANISM_TAXID: 197221;
SOURCE 52 STRAIN: BP-1;
SOURCE 53 MOL_ID: 14;
SOURCE 54 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 55 ORGANISM_TAXID: 197221;
SOURCE 56 STRAIN: BP-1;
SOURCE 57 MOL_ID: 15;
SOURCE 58 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 59 ORGANISM_TAXID: 197221;
SOURCE 60 STRAIN: BP-1;
SOURCE 61 MOL_ID: 16;
SOURCE 62 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 63 ORGANISM_TAXID: 197221;
SOURCE 64 STRAIN: BP-1;
SOURCE 65 MOL_ID: 17;
SOURCE 66 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 67 ORGANISM_TAXID: 197221;
SOURCE 68 STRAIN: BP-1;
SOURCE 69 MOL_ID: 18;
SOURCE 70 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 71 ORGANISM_TAXID: 197221;
SOURCE 72 STRAIN: BP-1;
SOURCE 73 MOL_ID: 19;
SOURCE 74 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 75 ORGANISM_TAXID: 197221;
SOURCE 76 STRAIN: BP-1;
SOURCE 77 MOL_ID: 20;
SOURCE 78 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 79 ORGANISM_TAXID: 197221;
SOURCE 80 STRAIN: BP-1
REMARK 1
REMARK 1 REFERENCE 1
REMARK 1 AUTH P.V.AFONINE,R.W.GROSSE-KUNSTLEVE,N.ECHOLS,J.J.HEADD,
REMARK 1 AUTH 2 N.W.MORIARTY,M.MUSTYAKIMOV,T.C.TERWILLIGER,A.URZHUMTSEV,
REMARK 1 AUTH 3 P.H.ZWART,P.D.ADAMS
REMARK 1 TITL TOWARDS AUTOMATED CRYSTALLOGRAPHIC STRUCTURE REFINEMENT WITH
REMARK 1 TITL 2 PHENIX.REFINE.
REMARK 1 REF ACTA CRYSTALLOGR. D BIOL. V. 68 352 2012
REMARK 1 REF 2 CRYSTALLOGR.
REMARK 1 REFN ESSN 1399-0047
REMARK 1 PMID 22505256
REMARK 1 DOI 10.1107/S0907444912001308
REMARK 1 REFERENCE 2
REMARK 1 AUTH P.D.ADAMS,P.V.AFONINE,G.BUNKOCZI,V.B.CHEN,I.W.DAVIS,
REMARK 1 AUTH 2 N.ECHOLS,J.J.HEADD,L.W.HUNG,G.J.KAPRAL,R.W.GROSSE-KUNSTLEVE,
REMARK 1 AUTH 3 A.J.MCCOY,N.W.MORIARTY,R.OEFFNER,R.J.READ,D.C.RICHARDSON,
REMARK 1 AUTH 4 J.S.RICHARDSON,T.C.TERWILLIGER,P.H.ZWART
REMARK 1 TITL PHENIX: A COMPREHENSIVE PYTHON-BASED SYSTEM FOR
REMARK 1 TITL 2 MACROMOLECULAR STRUCTURE SOLUTION.
REMARK 1 REF ACTA CRYSTALLOGR. D BIOL. V. 66 213 2010
REMARK 1 REF 2 CRYSTALLOGR.
REMARK 1 REFN ESSN 1399-0047
REMARK 1 PMID 20124702
REMARK 1 DOI 10.1107/S0907444909052925
REMARK 2
REMARK 2 RESOLUTION. 4.50 ANGSTROMS.
REMARK 3
REMARK 3 REFINEMENT.
REMARK 3 PROGRAM : PHENIX (PHENIX.REFINE: DEV_1635+SVN)
REMARK 3 AUTHORS : PAUL ADAMS,PAVEL AFONINE,VINCENT CHEN,IAN
REMARK 3 : DAVIS,KRESHNA GOPAL,RALF GROSSE-KUNSTLEVE,
REMARK 3 : LI-WEI HUNG,ROBERT IMMORMINO,TOM IOERGER,
REMARK 3 : AIRLIE MCCOY,ERIK MCKEE,NIGEL MORIARTY,
REMARK 3 : REETAL PAI,RANDY READ,JANE RICHARDSON,
REMARK 3 : DAVID RICHARDSON,TOD ROMO,JIM SACCHETTINI,
REMARK 3 : NICHOLAS SAUTER,JACOB SMITH,LAURENT
REMARK 3 : STORONI,TOM TERWILLIGER,PETER ZWART
REMARK 3
REMARK 3 REFINEMENT TARGET : NULL
REMARK 3
REMARK 3 DATA USED IN REFINEMENT.
REMARK 3 RESOLUTION RANGE HIGH (ANGSTROMS) : 4.50
REMARK 3 RESOLUTION RANGE LOW (ANGSTROMS) : 72.97
REMARK 3 MIN(FOBS/SIGMA_FOBS) : 1.364
REMARK 3 COMPLETENESS FOR RANGE (%) : 96.8
REMARK 3 NUMBER OF REFLECTIONS : 103594
REMARK 3
REMARK 3 FIT TO DATA USED IN REFINEMENT.
REMARK 3 R VALUE (WORKING + TEST SET) : 0.276
REMARK 3 R VALUE (WORKING SET) : 0.276
REMARK 3 FREE R VALUE : 0.284
REMARK 3 FREE R VALUE TEST SET SIZE (%) : 4.896
REMARK 3 FREE R VALUE TEST SET COUNT : 5072
REMARK 3
REMARK 3 FIT TO DATA USED IN REFINEMENT (IN BINS).
REMARK 3 BIN RESOLUTION RANGE COMPL. NWORK NFREE RWORK RFREE
REMARK 3 1 72.9798 - 13.9511 1.00 3411 149 0.3138 0.3032
REMARK 3 2 13.9511 - 11.0859 1.00 3387 176 0.2272 0.2217
REMARK 3 3 11.0859 - 9.6882 1.00 3394 169 0.2200 0.2138
REMARK 3 4 9.6882 - 8.8040 1.00 3379 168 0.2079 0.2239
REMARK 3 5 8.8040 - 8.1739 1.00 3403 192 0.2234 0.2128
REMARK 3 6 8.1739 - 7.6925 1.00 3409 185 0.2346 0.2807
REMARK 3 7 7.6925 - 7.3077 1.00 3393 170 0.2384 0.2545
REMARK 3 8 7.3077 - 6.9898 1.00 3347 175 0.2458 0.2869
REMARK 3 9 6.9898 - 6.7209 1.00 3424 177 0.2569 0.2718
REMARK 3 10 6.7209 - 6.4892 1.00 3417 173 0.2707 0.3124
REMARK 3 11 6.4892 - 6.2864 1.00 3351 172 0.2636 0.2590
REMARK 3 12 6.2864 - 6.1068 1.00 3428 174 0.2777 0.2912
REMARK 3 13 6.1068 - 5.9461 1.00 3392 188 0.2801 0.3347
REMARK 3 14 5.9461 - 5.8011 1.00 3404 162 0.2907 0.2844
REMARK 3 15 5.8011 - 5.6692 1.00 3386 199 0.2995 0.3075
REMARK 3 16 5.6692 - 5.5486 1.00 3382 157 0.2873 0.3259
REMARK 3 17 5.5486 - 5.4377 1.00 3429 182 0.3082 0.3028
REMARK 3 18 5.4377 - 5.3351 1.00 3335 181 0.3038 0.3356
REMARK 3 19 5.3351 - 5.2398 1.00 3425 164 0.3126 0.3522
REMARK 3 20 5.2398 - 5.1510 1.00 3374 177 0.3080 0.3008
REMARK 3 21 5.1510 - 5.0680 0.99 3307 167 0.3202 0.2995
REMARK 3 22 5.0680 - 4.9900 0.99 3393 198 0.3254 0.3408
REMARK 3 23 4.9900 - 4.9167 0.98 3334 175 0.3196 0.3218
REMARK 3 24 4.9167 - 4.8474 0.96 3276 163 0.3395 0.2994
REMARK 3 25 4.8474 - 4.7819 0.95 3242 161 0.3352 0.3406
REMARK 3 26 4.7819 - 4.7198 0.92 3052 155 0.3489 0.3529
REMARK 3 27 4.7198 - 4.6608 0.86 2971 143 0.3623 0.3655
REMARK 3 28 4.6608 - 4.6047 0.86 2948 161 0.3564 0.3870
REMARK 3 29 4.6047 - 4.5512 0.81 2736 148 0.3683 0.3759
REMARK 3 30 4.5512 - 4.5000 0.70 2393 111 0.3779 0.4248
REMARK 3
REMARK 3 BULK SOLVENT MODELLING.
REMARK 3 METHOD USED : FLAT BULK SOLVENT MODEL
REMARK 3 SOLVENT RADIUS : 1.11
REMARK 3 SHRINKAGE RADIUS : 0.90
REMARK 3 K_SOL : NULL
REMARK 3 B_SOL : NULL
REMARK 3
REMARK 3 ERROR ESTIMATES.
REMARK 3 COORDINATE ERROR (MAXIMUM-LIKELIHOOD BASED) : 0.648
REMARK 3 PHASE ERROR (DEGREES, MAXIMUM-LIKELIHOOD BASED) : 28.666
REMARK 3
REMARK 3 B VALUES.
REMARK 3 FROM WILSON PLOT (A**2) : 152.7
REMARK 3 MEAN B VALUE (OVERALL, A**2) : 174.0
REMARK 3 OVERALL ANISOTROPIC B VALUE.
REMARK 3 B11 (A**2) : NULL
REMARK 3 B22 (A**2) : NULL
REMARK 3 B33 (A**2) : NULL
REMARK 3 B12 (A**2) : NULL
REMARK 3 B13 (A**2) : NULL
REMARK 3 B23 (A**2) : NULL
REMARK 3
REMARK 3 TWINNING INFORMATION.
REMARK 3 FRACTION: NULL
REMARK 3 OPERATOR: NULL
REMARK 3
REMARK 3 DEVIATIONS FROM IDEAL VALUES.
REMARK 3 RMSD COUNT
REMARK 3 BOND : 0.005 52088
REMARK 3 ANGLE : 0.757 71528
REMARK 3 CHIRALITY : 0.029 7238
REMARK 3 PLANARITY : 0.004 8510
REMARK 3 DIHEDRAL : 18.658 18206
REMARK 3
REMARK 3 TLS DETAILS
REMARK 3 NUMBER OF TLS GROUPS : NULL
REMARK 3
REMARK 3 NCS DETAILS
REMARK 3 NUMBER OF NCS GROUPS : 19
REMARK 3 NCS GROUP : 1
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'A'
REMARK 3 SELECTION : CHAIN 'G'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 2
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'B'
REMARK 3 SELECTION : CHAIN 'N'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 3
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'C'
REMARK 3 SELECTION : CHAIN 'P'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 4
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'D'
REMARK 3 SELECTION : CHAIN 'Q'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 5
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'E'
REMARK 3 SELECTION : CHAIN 'R'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 6
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'F'
REMARK 3 SELECTION : CHAIN 'S'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 7
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'H'
REMARK 3 SELECTION : CHAIN 'W'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 8
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'I'
REMARK 3 SELECTION : CHAIN 'A'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 9
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'J'
REMARK 3 SELECTION : CHAIN 'B'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 10
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'K'
REMARK 3 SELECTION : CHAIN 'C'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 11
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'L'
REMARK 3 SELECTION : CHAIN 'D'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 12
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'M'
REMARK 3 SELECTION : CHAIN 'E'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 13
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'O'
REMARK 3 SELECTION : CHAIN 'F'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 14
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'T'
REMARK 3 SELECTION : CHAIN 'G'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 15
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'U'
REMARK 3 SELECTION : CHAIN 'H'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 16
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'V'
REMARK 3 SELECTION : CHAIN 'I'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 17
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'X'
REMARK 3 SELECTION : CHAIN 'J'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 18
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'Z'
REMARK 3 SELECTION : CHAIN 'L'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 19
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'M'
REMARK 3 SELECTION : CHAIN 'Y'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3
REMARK 3 OTHER REFINEMENT REMARKS: NULL
REMARK 4
REMARK 4 4TNJ COMPLIES WITH FORMAT V. 3.30, 13-JUL-11
REMARK 100
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 17-JUN-14.
REMARK 100 THE DEPOSITION ID IS D_1000201918.
REMARK 200
REMARK 200 EXPERIMENTAL DETAILS
REMARK 200 EXPERIMENT TYPE : X-RAY DIFFRACTION
REMARK 200 DATE OF DATA COLLECTION : 03-MAR-13
REMARK 200 TEMPERATURE (KELVIN) : 298
REMARK 200 PH : 7.0
REMARK 200 NUMBER OF CRYSTALS USED : 16973
REMARK 200
REMARK 200 SYNCHROTRON (Y/N) : N
REMARK 200 RADIATION SOURCE : FREE ELECTRON LASER
REMARK 200 BEAMLINE : CXI
REMARK 200 X-RAY GENERATOR MODEL : SLAC LCLS BEAMLINE CXI
REMARK 200 MONOCHROMATIC OR LAUE (M/L) : M
REMARK 200 WAVELENGTH OR RANGE (A) : 1.77
REMARK 200 MONOCHROMATOR : NO MONOCHROMATOR, FEL BEAM WITH
REMARK 200 20-30 EV BANDWIDTH
REMARK 200 OPTICS : KB MIRRORS
REMARK 200
REMARK 200 DETECTOR TYPE : PIXEL
REMARK 200 DETECTOR MANUFACTURER : CS-PAD DETECTOR
REMARK 200 INTENSITY-INTEGRATION SOFTWARE : NULL
REMARK 200 DATA SCALING SOFTWARE : NULL
REMARK 200
REMARK 200 NUMBER OF UNIQUE REFLECTIONS : 52965
REMARK 200 RESOLUTION RANGE HIGH (A) : 4.500
REMARK 200 RESOLUTION RANGE LOW (A) : 72.970
REMARK 200 REJECTION CRITERIA (SIGMA(I)) : NULL
REMARK 200
REMARK 200 OVERALL.
REMARK 200 COMPLETENESS FOR RANGE (%) : 99.5
REMARK 200 DATA REDUNDANCY : 131.4
REMARK 200 R MERGE (I) : NULL
REMARK 200 R SYM (I) : NULL
REMARK 200 <I/SIGMA(I)> FOR THE DATA SET : 52.1000
REMARK 200
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 4.50
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE LOW (A) : 4.66
REMARK 200 COMPLETENESS FOR SHELL (%) : 95.8
REMARK 200 DATA REDUNDANCY IN SHELL : 7.80
REMARK 200 R MERGE FOR SHELL (I) : NULL
REMARK 200 R SYM FOR SHELL (I) : NULL
REMARK 200 <I/SIGMA(I)> FOR SHELL : 3.700
REMARK 200
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT
REMARK 200 SOFTWARE USED: NULL
REMARK 200 STARTING MODEL: 3BZ1
REMARK 200
REMARK 200 REMARK: NULL
REMARK 280
REMARK 280 CRYSTAL
REMARK 280 SOLVENT CONTENT, VS (%): 66.36
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 3.66
REMARK 280
REMARK 280 CRYSTALLIZATION CONDITIONS: 4% PEG2000, 5 MM CALCIUM CHLORIDE, 100
REMARK 280 MM PIPES, PH 7.0, BATCH, TEMPERATURE 298K
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21
REMARK 290
REMARK 290 SYMOP SYMMETRY
REMARK 290 NNNMMM OPERATOR
REMARK 290 1555 X,Y,Z
REMARK 290 2555 -X+1/2,-Y,Z+1/2
REMARK 290 3555 -X,Y+1/2,-Z+1/2
REMARK 290 4555 X+1/2,-Y+1/2,-Z
REMARK 290
REMARK 290 WHERE NNN -> OPERATOR NUMBER
REMARK 290 MMM -> TRANSLATION VECTOR
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY
REMARK 290 RELATED MOLECULES.
REMARK 290 SMTRY1 1 1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 1 0.000000 1.000000 0.000000 0.00000
REMARK 290 SMTRY3 1 0.000000 0.000000 1.000000 0.00000
REMARK 290 SMTRY1 2 -1.000000 0.000000 0.000000 66.14900
REMARK 290 SMTRY2 2 0.000000 -1.000000 0.000000 0.00000
REMARK 290 SMTRY3 2 0.000000 0.000000 1.000000 153.98800
REMARK 290 SMTRY1 3 -1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 3 0.000000 1.000000 0.000000 114.35650
REMARK 290 SMTRY3 3 0.000000 0.000000 -1.000000 153.98800
REMARK 290 SMTRY1 4 1.000000 0.000000 0.000000 66.14900
REMARK 290 SMTRY2 4 0.000000 -1.000000 0.000000 114.35650
REMARK 290 SMTRY3 4 0.000000 0.000000 -1.000000 0.00000
REMARK 290
REMARK 290 REMARK: NULL
REMARK 300
REMARK 300 BIOMOLECULE: 1
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON
REMARK 300 BURIED SURFACE AREA.
REMARK 350
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS
REMARK 350 GIVEN BELOW. BOTH NON-CRYSTALLOGRAPHIC AND
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.
REMARK 350
REMARK 350 BIOMOLECULE: 1
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: 40-MERIC
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E, F, H, I, J, K,
REMARK 350 AND CHAINS: L, M, O, T, U, V, y, X, Y,
REMARK 350 AND CHAINS: Z, a, b, c, d, e, f, h, i, j,
REMARK 350 AND CHAINS: k, l, m, o, t, u, v, g, x,
REMARK 350 AND CHAINS: G, z
REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000
REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000
REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000
REMARK 465
REMARK 465 MISSING RESIDUES
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)
REMARK 465
REMARK 465 M RES C SSSEQI
REMARK 465 MET A 1
REMARK 465 THR A 2
REMARK 465 THR A 3
REMARK 465 THR A 4
REMARK 465 LEU A 5
REMARK 465 GLN A 6
REMARK 465 ARG A 7
REMARK 465 ARG A 8
REMARK 465 GLU A 9
REMARK 465 MET B 1
REMARK 465 GLU B 492
REMARK 465 TRP B 493
REMARK 465 GLY B 494
REMARK 465 PHE B 495
REMARK 465 TYR B 496
REMARK 465 GLN B 497
REMARK 465 LYS B 498
REMARK 465 VAL B 499
REMARK 465 GLY B 500
REMARK 465 ASP B 501
REMARK 465 VAL B 502
REMARK 465 THR B 503
REMARK 465 THR B 504
REMARK 465 ARG B 505
REMARK 465 ARG B 506
REMARK 465 LYS B 507
REMARK 465 GLU B 508
REMARK 465 ALA B 509
REMARK 465 VAL B 510
REMARK 465 MET C 13
REMARK 465 VAL C 14
REMARK 465 THR C 15
REMARK 465 LEU C 16
REMARK 465 SER C 17
REMARK 465 SER C 18
REMARK 465 ASN C 19
REMARK 465 SER C 20
REMARK 465 ILE C 21
REMARK 465 PHE C 22
REMARK 465 ALA C 23
REMARK 465 THR C 24
REMARK 465 ASN C 25
REMARK 465 ARG C 26
REMARK 465 MET D 1
REMARK 465 THR D 2
REMARK 465 ILE D 3
REMARK 465 ALA D 4
REMARK 465 ILE D 5
REMARK 465 GLY D 6
REMARK 465 ARG D 7
REMARK 465 ALA D 8
REMARK 465 PRO D 9
REMARK 465 ALA D 10
REMARK 465 GLU D 11
REMARK 465 ARG D 12
REMARK 465 MET E 1
REMARK 465 ALA E 2
REMARK 465 MET F 1
REMARK 465 THR F 2
REMARK 465 SER F 3
REMARK 465 ASN F 4
REMARK 465 THR F 5
REMARK 465 PRO F 6
REMARK 465 ASN F 7
REMARK 465 GLN F 8
REMARK 465 GLU F 9
REMARK 465 PRO F 10
REMARK 465 MET H 1
REMARK 465 ASP I 36
REMARK 465 LEU I 37
REMARK 465 GLU I 38
REMARK 465 MET J 1
REMARK 465 MET J 2
REMARK 465 SER J 3
REMARK 465 GLU J 4
REMARK 465 GLY J 5
REMARK 465 GLY J 6
REMARK 465 MET K 1
REMARK 465 ILE K 2
REMARK 465 ASP K 3
REMARK 465 ALA K 4
REMARK 465 LEU K 5
REMARK 465 VAL K 6
REMARK 465 LEU K 7
REMARK 465 VAL K 8
REMARK 465 ALA K 9
REMARK 465 SER M 35
REMARK 465 SER M 36
REMARK 465 MET O 1
REMARK 465 LYS O 2
REMARK 465 TYR O 3
REMARK 465 ARG O 4
REMARK 465 ILE O 5
REMARK 465 LEU O 6
REMARK 465 MET O 7
REMARK 465 ALA O 8
REMARK 465 THR O 9
REMARK 465 LEU O 10
REMARK 465 LEU O 11
REMARK 465 ALA O 12
REMARK 465 VAL O 13
REMARK 465 CYS O 14
REMARK 465 LEU O 15
REMARK 465 GLY O 16
REMARK 465 ILE O 17
REMARK 465 PHE O 18
REMARK 465 SER O 19
REMARK 465 LEU O 20
REMARK 465 SER O 21
REMARK 465 ALA O 22
REMARK 465 PRO O 23
REMARK 465 ALA O 24
REMARK 465 PHE O 25
REMARK 465 ALA O 26
REMARK 465 ALA O 27
REMARK 465 LYS O 28
REMARK 465 GLN O 29
REMARK 465 MET U 1
REMARK 465 GLN U 2
REMARK 465 ARG U 3
REMARK 465 LEU U 4
REMARK 465 GLY U 5
REMARK 465 ARG U 6
REMARK 465 TRP U 7
REMARK 465 LEU U 8
REMARK 465 ALA U 9
REMARK 465 LEU U 10
REMARK 465 ALA U 11
REMARK 465 TYR U 12
REMARK 465 PHE U 13
REMARK 465 VAL U 14
REMARK 465 GLY U 15
REMARK 465 VAL U 16
REMARK 465 SER U 17
REMARK 465 LEU U 18
REMARK 465 LEU U 19
REMARK 465 GLY U 20
REMARK 465 TRP U 21
REMARK 465 ILE U 22
REMARK 465 ASN U 23
REMARK 465 TRP U 24
REMARK 465 SER U 25
REMARK 465 ALA U 26
REMARK 465 PRO U 27
REMARK 465 THR U 28
REMARK 465 LEU U 29
REMARK 465 ALA U 30
REMARK 465 ALA U 31
REMARK 465 THR U 32
REMARK 465 ALA U 33
REMARK 465 SER U 34
REMARK 465 THR U 35
REMARK 465 GLU U 36
REMARK 465 GLU U 37
REMARK 465 MET V 1
REMARK 465 LEU V 2
REMARK 465 LYS V 3
REMARK 465 LYS V 4
REMARK 465 CYS V 5
REMARK 465 VAL V 6
REMARK 465 TRP V 7
REMARK 465 LEU V 8
REMARK 465 ALA V 9
REMARK 465 VAL V 10
REMARK 465 ALA V 11
REMARK 465 LEU V 12
REMARK 465 CYS V 13
REMARK 465 LEU V 14
REMARK 465 CYS V 15
REMARK 465 LEU V 16
REMARK 465 TRP V 17
REMARK 465 GLN V 18
REMARK 465 PHE V 19
REMARK 465 THR V 20
REMARK 465 MET V 21
REMARK 465 GLY V 22
REMARK 465 THR V 23
REMARK 465 ALA V 24
REMARK 465 LEU V 25
REMARK 465 ALA V 26
REMARK 465 MET y 1
REMARK 465 GLY y 2
REMARK 465 ILE y 3
REMARK 465 PHE y 4
REMARK 465 ASN y 5
REMARK 465 GLY y 6
REMARK 465 ILE y 7
REMARK 465 ILE y 8
REMARK 465 GLU y 9
REMARK 465 PHE y 10
REMARK 465 LEU y 11
REMARK 465 SER y 12
REMARK 465 ASN y 13
REMARK 465 ILE y 14
REMARK 465 ASN y 15
REMARK 465 PHE y 16
REMARK 465 GLU y 17
REMARK 465 VAL y 18
REMARK 465 MET X 10
REMARK 465 ARG X 48
REMARK 465 SER X 49
REMARK 465 LEU X 50
REMARK 465 MET a 1
REMARK 465 THR a 2
REMARK 465 THR a 3
REMARK 465 THR a 4
REMARK 465 LEU a 5
REMARK 465 GLN a 6
REMARK 465 ARG a 7
REMARK 465 ARG a 8
REMARK 465 GLU a 9
REMARK 465 MET b 1
REMARK 465 GLU b 492
REMARK 465 TRP b 493
REMARK 465 GLY b 494
REMARK 465 PHE b 495
REMARK 465 TYR b 496
REMARK 465 GLN b 497
REMARK 465 LYS b 498
REMARK 465 VAL b 499
REMARK 465 GLY b 500
REMARK 465 ASP b 501
REMARK 465 VAL b 502
REMARK 465 THR b 503
REMARK 465 THR b 504
REMARK 465 ARG b 505
REMARK 465 ARG b 506
REMARK 465 LYS b 507
REMARK 465 GLU b 508
REMARK 465 ALA b 509
REMARK 465 VAL b 510
REMARK 465 MET c 13
REMARK 465 VAL c 14
REMARK 465 THR c 15
REMARK 465 LEU c 16
REMARK 465 SER c 17
REMARK 465 SER c 18
REMARK 465 ASN c 19
REMARK 465 SER c 20
REMARK 465 ILE c 21
REMARK 465 PHE c 22
REMARK 465 ALA c 23
REMARK 465 THR c 24
REMARK 465 ASN c 25
REMARK 465 ARG c 26
REMARK 465 MET d 1
REMARK 465 THR d 2
REMARK 465 ILE d 3
REMARK 465 ALA d 4
REMARK 465 ILE d 5
REMARK 465 GLY d 6
REMARK 465 ARG d 7
REMARK 465 ALA d 8
REMARK 465 PRO d 9
REMARK 465 ALA d 10
REMARK 465 GLU d 11
REMARK 465 ARG d 12
REMARK 465 MET e 1
REMARK 465 ALA e 2
REMARK 465 MET f 1
REMARK 465 THR f 2
REMARK 465 SER f 3
REMARK 465 ASN f 4
REMARK 465 THR f 5
REMARK 465 PRO f 6
REMARK 465 ASN f 7
REMARK 465 GLN f 8
REMARK 465 GLU f 9
REMARK 465 PRO f 10
REMARK 465 MET h 1
REMARK 465 ASP i 36
REMARK 465 LEU i 37
REMARK 465 GLU i 38
REMARK 465 MET j 1
REMARK 465 MET j 2
REMARK 465 SER j 3
REMARK 465 GLU j 4
REMARK 465 GLY j 5
REMARK 465 GLY j 6
REMARK 465 MET k 1
REMARK 465 ILE k 2
REMARK 465 ASP k 3
REMARK 465 ALA k 4
REMARK 465 LEU k 5
REMARK 465 VAL k 6
REMARK 465 LEU k 7
REMARK 465 VAL k 8
REMARK 465 ALA k 9
REMARK 465 SER m 35
REMARK 465 SER m 36
REMARK 465 MET o 1
REMARK 465 LYS o 2
REMARK 465 TYR o 3
REMARK 465 ARG o 4
REMARK 465 ILE o 5
REMARK 465 LEU o 6
REMARK 465 MET o 7
REMARK 465 ALA o 8
REMARK 465 THR o 9
REMARK 465 LEU o 10
REMARK 465 LEU o 11
REMARK 465 ALA o 12
REMARK 465 VAL o 13
REMARK 465 CYS o 14
REMARK 465 LEU o 15
REMARK 465 GLY o 16
REMARK 465 ILE o 17
REMARK 465 PHE o 18
REMARK 465 SER o 19
REMARK 465 LEU o 20
REMARK 465 SER o 21
REMARK 465 ALA o 22
REMARK 465 PRO o 23
REMARK 465 ALA o 24
REMARK 465 PHE o 25
REMARK 465 ALA o 26
REMARK 465 ALA o 27
REMARK 465 LYS o 28
REMARK 465 GLN o 29
REMARK 465 MET u 1
REMARK 465 GLN u 2
REMARK 465 ARG u 3
REMARK 465 LEU u 4
REMARK 465 GLY u 5
REMARK 465 ARG u 6
REMARK 465 TRP u 7
REMARK 465 LEU u 8
REMARK 465 ALA u 9
REMARK 465 LEU u 10
REMARK 465 ALA u 11
REMARK 465 TYR u 12
REMARK 465 PHE u 13
REMARK 465 VAL u 14
REMARK 465 GLY u 15
REMARK 465 VAL u 16
REMARK 465 SER u 17
REMARK 465 LEU u 18
REMARK 465 LEU u 19
REMARK 465 GLY u 20
REMARK 465 TRP u 21
REMARK 465 ILE u 22
REMARK 465 ASN u 23
REMARK 465 TRP u 24
REMARK 465 SER u 25
REMARK 465 ALA u 26
REMARK 465 PRO u 27
REMARK 465 THR u 28
REMARK 465 LEU u 29
REMARK 465 ALA u 30
REMARK 465 ALA u 31
REMARK 465 THR u 32
REMARK 465 ALA u 33
REMARK 465 SER u 34
REMARK 465 THR u 35
REMARK 465 GLU u 36
REMARK 465 GLU u 37
REMARK 465 MET v 1
REMARK 465 LEU v 2
REMARK 465 LYS v 3
REMARK 465 LYS v 4
REMARK 465 CYS v 5
REMARK 465 VAL v 6
REMARK 465 TRP v 7
REMARK 465 LEU v 8
REMARK 465 ALA v 9
REMARK 465 VAL v 10
REMARK 465 ALA v 11
REMARK 465 LEU v 12
REMARK 465 CYS v 13
REMARK 465 LEU v 14
REMARK 465 CYS v 15
REMARK 465 LEU v 16
REMARK 465 TRP v 17
REMARK 465 GLN v 18
REMARK 465 PHE v 19
REMARK 465 THR v 20
REMARK 465 MET v 21
REMARK 465 GLY v 22
REMARK 465 THR v 23
REMARK 465 ALA v 24
REMARK 465 LEU v 25
REMARK 465 ALA v 26
REMARK 465 MET g 1
REMARK 465 GLY g 2
REMARK 465 ILE g 3
REMARK 465 PHE g 4
REMARK 465 ASN g 5
REMARK 465 GLY g 6
REMARK 465 ILE g 7
REMARK 465 ILE g 8
REMARK 465 GLU g 9
REMARK 465 PHE g 10
REMARK 465 LEU g 11
REMARK 465 SER g 12
REMARK 465 ASN g 13
REMARK 465 ILE g 14
REMARK 465 ASN g 15
REMARK 465 PHE g 16
REMARK 465 GLU g 17
REMARK 465 VAL g 18
REMARK 465 MET x 10
REMARK 465 ARG x 48
REMARK 465 SER x 49
REMARK 465 LEU x 50
REMARK 470
REMARK 470 MISSING ATOM
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 470 I=INSERTION CODE):
REMARK 470 M RES CSSEQI ATOMS
REMARK 470 TYR C 143 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 GLU C 462 CG CD OE1 OE2
REMARK 470 LYS H 20 CG CD CE NZ
REMARK 470 ARG O 53 CG CD NE CZ NH1 NH2
REMARK 470 GLU O 80 CG CD OE1 OE2
REMARK 470 LYS O 85 CG CD CE NZ
REMARK 470 ARG O 233 CG CD NE CZ NH1 NH2
REMARK 470 GLU V 41 CG CD OE1 OE2
REMARK 470 ARG y 43 CG CD NE CZ NH1 NH2
REMARK 470 TYR c 143 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 GLU c 462 CG CD OE1 OE2
REMARK 470 LYS h 20 CG CD CE NZ
REMARK 470 ARG o 53 CG CD NE CZ NH1 NH2
REMARK 470 GLU o 80 CG CD OE1 OE2
REMARK 470 LYS o 85 CG CD CE NZ
REMARK 470 ARG o 233 CG CD NE CZ NH1 NH2
REMARK 470 GLU v 41 CG CD OE1 OE2
REMARK 470 ARG g 43 CG CD NE CZ NH1 NH2
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT
REMARK 500
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.
REMARK 500
REMARK 500 ATM1 RES C SSEQI ATM2 RES C SSEQI DISTANCE
REMARK 500 O TRP C 250 OG1 THR C 254 2.11
REMARK 500 O TRP c 250 OG1 THR c 254 2.12
REMARK 500 O TRP C 291 OG1 THR C 305 2.13
REMARK 500 O TRP c 291 OG1 THR c 305 2.17
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES
REMARK 500
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)
REMARK 500
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996
REMARK 500
REMARK 500 M RES CSSEQI ATM1 ATM2 ATM3
REMARK 500 PRO B 484 C - N - CA ANGL. DEV. = 13.8 DEGREES
REMARK 500 PRO b 484 C - N - CA ANGL. DEV. = 13.9 DEGREES
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: TORSION ANGLES
REMARK 500
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)
REMARK 500
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400
REMARK 500
REMARK 500 M RES CSSEQI PSI PHI
REMARK 500 ASN A 12 113.55 156.68
REMARK 500 PRO A 141 -129.69 -74.18
REMARK 500 TRP A 142 -10.47 57.87
REMARK 500 LEU A 159 -50.96 -132.18
REMARK 500 SER A 222 43.06 -109.78
REMARK 500 GLU A 226 10.06 -147.12
REMARK 500 ILE A 259 -84.54 -103.94
REMARK 500 PHE A 302 32.40 -98.39
REMARK 500 ARG A 334 -71.03 -27.38
REMARK 500 ASP B 119 55.12 -91.78
REMARK 500 ARG B 127 -71.75 -63.31
REMARK 500 PRO B 183 175.19 -59.24
REMARK 500 LEU B 218 -67.61 -95.18
REMARK 500 ARG B 230 53.37 31.50
REMARK 500 SER B 294 27.72 -79.83
REMARK 500 ASP B 313 41.82 -91.60
REMARK 500 THR B 436 -70.31 -33.73
REMARK 500 SER B 480 -12.56 70.07
REMARK 500 ILE B 482 -165.91 -117.54
REMARK 500 PRO B 484 -143.81 -7.86
REMARK 500 GLU B 485 164.38 62.54
REMARK 500 LEU B 486 68.84 -155.03
REMARK 500 PRO B 488 -108.51 5.33
REMARK 500 GLU B 489 56.92 -65.19
REMARK 500 GLN B 490 107.87 -167.15
REMARK 500 GLU C 29 -149.64 -148.47
REMARK 500 ARG C 135 -62.72 -121.66
REMARK 500 SER C 144 112.05 -179.97
REMARK 500 ASN C 201 59.14 -168.57
REMARK 500 ILE C 209 -70.11 -53.63
REMARK 500 TRP C 223 -145.28 61.06
REMARK 500 LEU C 253 30.21 -96.38
REMARK 500 PHE C 257 -145.97 -71.51
REMARK 500 ARG C 320 -71.40 -59.53
REMARK 500 PRO C 368 -9.54 -59.70
REMARK 500 LEU C 375 114.06 -34.69
REMARK 500 ASN C 382 12.46 -161.40
REMARK 500 HIS C 398 33.97 -142.05
REMARK 500 SER C 406 65.49 60.08
REMARK 500 ALA C 411 -17.37 -49.62
REMARK 500 SER C 416 -60.84 -176.83
REMARK 500 PHE C 455 23.38 -150.16
REMARK 500 GLU C 462 -76.04 -68.52
REMARK 500 ARG D 26 -165.46 -102.53
REMARK 500 VAL D 30 -83.56 -89.78
REMARK 500 LEU D 37 -71.44 -56.83
REMARK 500 SER D 65 16.45 -141.31
REMARK 500 PRO D 140 37.12 -84.86
REMARK 500 LEU D 158 -65.10 -128.95
REMARK 500 ALA D 234 28.82 -76.04
REMARK 500
REMARK 500 THIS ENTRY HAS 248 RAMACHANDRAN OUTLIERS.
REMARK 500
REMARK 500 REMARK: NULL
REMARK 610
REMARK 610 MISSING HETEROATOM
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 610 I=INSERTION CODE):
REMARK 610 M RES C SSEQI
REMARK 610 PL9 A 406
REMARK 610 DGD A 408
REMARK 610 LHG A 409
REMARK 610 LMG A 410
REMARK 610 SQD A 413
REMARK 610 LMG A 415
REMARK 610 DGD B 620
REMARK 610 LMG B 621
REMARK 610 LMG B 624
REMARK 610 DGD B 625
REMARK 610 SQD B 626
REMARK 610 DGD C 515
REMARK 610 DGD C 516
REMARK 610 LMG C 518
REMARK 610 LHG C 519
REMARK 610 LMG C 522
REMARK 610 SQD D 403
REMARK 610 LMG D 408
REMARK 610 DGD D 409
REMARK 610 LMT D 410
REMARK 610 LMG D 412
REMARK 610 LMG E 101
REMARK 610 SQD F 102
REMARK 610 LMG I 101
REMARK 610 PL9 J 101
REMARK 610 LMG M 101
REMARK 610 LMG a 402
REMARK 610 PL9 a 409
REMARK 610 DGD a 411
REMARK 610 LHG a 412
REMARK 610 LMG a 413
REMARK 610 SQD a 415
REMARK 610 DGD b 601
REMARK 610 SQD b 602
REMARK 610 DGD b 624
REMARK 610 LMG b 625
REMARK 610 LMG b 628
REMARK 610 DGD c 515
REMARK 610 DGD c 516
REMARK 610 LMG c 518
REMARK 610 LHG c 519
REMARK 610 LMG c 522
REMARK 610 SQD d 402
REMARK 610 LMG d 407
REMARK 610 DGD d 408
REMARK 610 LMT d 409
REMARK 610 LMG d 410
REMARK 610 LMG e 101
REMARK 610 SQD f 103
REMARK 610 LMG i 101
REMARK 610 PL9 j 101
REMARK 610 LMG m 101
REMARK 620
REMARK 620 METAL COORDINATION
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 CA1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP A 170 OD1
REMARK 620 2 OEX A 412 O1 124.3
REMARK 620 3 OEX A 412 O2 60.4 63.8
REMARK 620 4 OEX A 412 O5 94.8 60.5 64.3
REMARK 620 5 GLU A 189 OE1 169.0 63.7 126.7 82.8
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN4
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP A 170 OD2
REMARK 620 2 OEX A 412 O5 106.7
REMARK 620 3 OEX A 412 O4 68.1 87.4
REMARK 620 4 GLU A 333 OE2 127.5 107.3 74.7
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU A 189 OE2
REMARK 620 2 OEX A 412 O1 83.1
REMARK 620 3 OEX A 412 O5 127.5 90.7
REMARK 620 4 OEX A 412 O3 143.8 89.5 87.8
REMARK 620 5 HIS A 332 NE2 74.7 157.2 106.8 105.4
REMARK 620 6 ASP A 342 OD2 66.2 89.8 166.2 78.5 76.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FE2 A 401 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS A 215 NE2
REMARK 620 2 HIS A 272 NE2 96.4
REMARK 620 3 HIS D 214 NE2 125.2 113.8
REMARK 620 4 HIS D 268 NE2 79.8 154.9 87.8
REMARK 620 5 BCT D 404 O3 129.9 91.6 95.2 73.0
REMARK 620 6 BCT D 404 O2 84.0 81.5 142.4 73.5 48.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN3
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU A 333 OE1
REMARK 620 2 OEX A 412 O2 136.6
REMARK 620 3 OEX A 412 O3 96.8 88.6
REMARK 620 4 OEX A 412 O4 83.9 92.0 178.2
REMARK 620 5 OEX A 412 O5 107.3 115.9 89.0 89.2
REMARK 620 6 GLU C 354 OE2 67.1 74.1 71.4 110.3 158.2
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP A 342 OD1
REMARK 620 2 OEX A 412 O1 111.4
REMARK 620 3 OEX A 412 O2 159.1 89.3
REMARK 620 4 OEX A 412 O3 93.3 87.0 85.3
REMARK 620 5 ALA A 344 OXT 98.9 130.1 67.4 130.9
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CLA C 510 MG
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASN C 39 OD1
REMARK 620 2 CLA C 510 NA 96.2
REMARK 620 3 CLA C 510 NB 75.2 92.2
REMARK 620 4 CLA C 510 NC 84.2 176.7 91.0
REMARK 620 5 CLA C 510 ND 104.1 90.7 177.0 86.0
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM F 101 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS E 23 NE2
REMARK 620 2 HEM F 101 NA 87.3
REMARK 620 3 HEM F 101 NB 104.3 89.3
REMARK 620 4 HEM F 101 NC 89.3 175.5 88.7
REMARK 620 5 HEM F 101 ND 67.2 90.4 171.6 90.9
REMARK 620 6 HIS F 24 NE2 157.7 70.4 75.3 112.9 112.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CA K 101 CA
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP K 19 OD2
REMARK 620 2 ASP K 23 OD1 132.5
REMARK 620 3 ASP K 23 OD2 124.7 46.4
REMARK 620 N 1 2
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM V 201 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS V 67 NE2
REMARK 620 2 HEM V 201 NA 86.9
REMARK 620 3 HEM V 201 NB 88.6 89.8
REMARK 620 4 HEM V 201 NC 88.5 175.4 90.1
REMARK 620 5 HEM V 201 ND 81.5 88.6 170.0 90.7
REMARK 620 6 HIS V 118 NE2 169.4 87.3 100.3 97.2 89.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 CA1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP a 170 OD1
REMARK 620 2 OEX a 414 O1 126.1
REMARK 620 3 OEX a 414 O2 62.6 63.6
REMARK 620 4 OEX a 414 O5 97.5 61.0 63.9
REMARK 620 5 GLU a 189 OE1 170.0 62.7 125.4 82.6
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN4
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP a 170 OD2
REMARK 620 2 OEX a 414 O5 110.5
REMARK 620 3 OEX a 414 O4 66.9 87.6
REMARK 620 4 GLU a 333 OE2 123.1 107.7 74.4
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU a 189 OE2
REMARK 620 2 OEX a 414 O1 85.0
REMARK 620 3 OEX a 414 O5 129.2 90.6
REMARK 620 4 OEX a 414 O3 142.5 89.4 87.7
REMARK 620 5 HIS a 332 NE2 70.8 155.4 107.6 107.2
REMARK 620 6 ASP a 342 OD2 63.0 89.8 167.7 80.0 75.9
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FE2 a 403 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS a 215 NE2
REMARK 620 2 HIS a 272 NE2 96.3
REMARK 620 3 HIS d 214 NE2 120.4 112.2
REMARK 620 4 HIS d 268 NE2 78.4 156.6 89.7
REMARK 620 5 BCT d 403 O2 87.1 85.3 143.5 71.7
REMARK 620 6 BCT d 403 O3 133.4 94.5 96.5 74.1 48.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN3
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU a 333 OE1
REMARK 620 2 OEX a 414 O2 136.8
REMARK 620 3 OEX a 414 O3 98.0 88.7
REMARK 620 4 OEX a 414 O4 82.3 92.0 178.6
REMARK 620 5 OEX a 414 O5 107.6 115.2 89.1 89.5
REMARK 620 6 GLU c 354 OE2 68.4 73.2 73.0 108.4 160.4
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP a 342 OD1
REMARK 620 2 OEX a 414 O1 109.3
REMARK 620 3 OEX a 414 O2 161.2 89.3
REMARK 620 4 OEX a 414 O3 93.0 87.1 85.4
REMARK 620 5 ALA a 344 OXT 101.6 129.0 66.6 131.3
REMARK 620 6 GLU c 354 OE1 66.9 158.2 95.0 72.0 71.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CLA c 510 MG
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASN c 39 OD1
REMARK 620 2 CLA c 510 NA 95.8
REMARK 620 3 CLA c 510 NB 75.2 92.2
REMARK 620 4 CLA c 510 NC 84.5 176.7 91.0
REMARK 620 5 CLA c 510 ND 104.2 90.7 177.1 86.1
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM f 101 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS e 23 NE2
REMARK 620 2 HEM f 101 NA 87.6
REMARK 620 3 HEM f 101 NB 103.5 89.5
REMARK 620 4 HEM f 101 NC 88.5 175.0 88.4
REMARK 620 5 HEM f 101 ND 67.4 90.2 170.8 91.2
REMARK 620 6 HIS f 24 NE2 157.7 70.2 78.1 113.7 110.3
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CA k 101 CA
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP k 19 OD2
REMARK 620 2 ASP k 23 OD1 124.2
REMARK 620 3 ASP k 23 OD2 115.3 41.7
REMARK 620 N 1 2
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM v 201 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS v 67 NE2
REMARK 620 2 HEM v 201 NA 86.2
REMARK 620 3 HEM v 201 NB 86.5 89.3
REMARK 620 4 HEM v 201 NC 89.3 175.5 90.2
REMARK 620 5 HEM v 201 ND 83.7 89.8 170.2 90.0
REMARK 620 6 HIS v 118 NE2 170.4 86.9 100.2 97.6 89.6
REMARK 620 N 1 2 3 4 5
REMARK 800
REMARK 800 SITE
REMARK 800 SITE_IDENTIFIER: AC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue FE2 A 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 A 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR A 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD A 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG A 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG A 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CL A 411
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue OEX A 412
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD A 413
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD A 414
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG A 415
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 601
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 602
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 603
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 604
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 605
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 606
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 607
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 608
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 609
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 610
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 611
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 612
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 613
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 614
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 615
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 616
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 617
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 618
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 619
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD B 620
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG B 621
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 622
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 623
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG B 624
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD B 625
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD B 626
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 627
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 628
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 503
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 504
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 505
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 506
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 507
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 508
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 509
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 510
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 511
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 512
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR C 513
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR C 514
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD C 515
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD C 516
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD C 517
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG C 518
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG C 519
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 520
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR C 521
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG C 522
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO D 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO D 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD D 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCT D 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA D 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA D 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 D 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG D 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD D 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT D 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR D 411
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG D 412
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG E 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM F 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD F 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA H 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR H 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG I 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT I 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 J 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR J 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA K 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG M 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT M 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT M 103
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA O 301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM V 201
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR y 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD a 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG a 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue FE2 a 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO a 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 a 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR a 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD a 411
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG a 412
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG a 413
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue OEX a 414
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD a 415
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CL a 416
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD b 601
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD b 602
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 603
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 604
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 605
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 606
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 607
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 608
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 609
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 610
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 611
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 612
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 613
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 614
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 615
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 616
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 617
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 618
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 619
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 620
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 621
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 622
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 623
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD b 624
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG b 625
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 626
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 627
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG b 628
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 503
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 504
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 505
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 506
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 507
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 508
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 509
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 510
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 511
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 512
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR c 513
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR c 514
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD c 515
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD c 516
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD c 517
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG c 518
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG c 519
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 520
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR c 521
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG c 522
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO d 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD d 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCT d 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA d 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA d 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 d 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG d 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD d 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT d 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG d 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG e 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM f 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR f 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD f 103
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA h 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG i 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT i 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 j 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR j 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA k 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG m 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA o 301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM v 201
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR g 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR x 101
REMARK 900
REMARK 900 RELATED ENTRIES
REMARK 900 RELATED ID: 4TNH RELATED DB: PDB
REMARK 900 RT STRUCTURE OF THE DARK STATE OF PHOTOSYSTEM II
REMARK 900 RELATED ID: 4TNI RELATED DB: PDB
REMARK 900 RELATED ID: 4TNK RELATED DB: PDB
REMARK 999
REMARK 999 SEQUENCE
REMARK 999 MOLECULE 19 (PHOTOSYSTEM II PROTEIN Y): THE DEPOSITORS STATE THAT
REMARK 999 THE SAMPLE SEQUENCE IS MDWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLLQKAKAA
REMARK 999 (UNP Q8DKM3).
SITE 1 AC1 5 HIS A 215 HIS A 272 HIS D 214 HIS D 268
SITE 2 AC1 5 BCT D 404
SITE 1 AC2 23 PHE A 119 TYR A 147 PRO A 150 SER A 153
SITE 2 AC2 23 VAL A 157 MET A 183 PHE A 186 GLN A 187
SITE 3 AC2 23 LEU A 193 HIS A 198 GLY A 201 VAL A 205
SITE 4 AC2 23 PHE A 206 VAL A 283 THR A 286 ILE A 290
SITE 5 AC2 23 CLA A 403 CLA A 404 LEU D 182 LEU D 205
SITE 6 AC2 23 PHO D 401 CLA D 405 PHE T 17
SITE 1 AC3 14 THR A 45 VAL A 157 PHE A 158 MET A 172
SITE 2 AC3 14 ILE A 176 THR A 179 MET A 183 CLA A 402
SITE 3 AC3 14 MET D 198 VAL D 201 ALA D 202 PHO D 401
SITE 4 AC3 14 CLA D 405 PL9 D 407
SITE 1 AC4 15 GLN A 199 VAL A 202 ALA A 203 LEU A 210
SITE 2 AC4 15 TRP A 278 CLA A 402 PL9 A 406 PHE D 157
SITE 3 AC4 15 VAL D 175 ILE D 178 PHE D 179 PHE D 181
SITE 4 AC4 15 LEU D 182 PHO D 402 CLA D 405
SITE 1 AC5 14 ILE A 36 PRO A 39 THR A 40 PHE A 93
SITE 2 AC5 14 PRO A 95 ILE A 96 TRP A 97 LEU A 114
SITE 3 AC5 14 HIS A 118 LEU A 121 BCR A 407 DGD A 408
SITE 4 AC5 14 TYR I 9 PHE I 15
SITE 1 AC6 15 HIS A 215 LEU A 218 HIS A 252 PHE A 255
SITE 2 AC6 15 SER A 264 PHE A 265 LEU A 271 PHE A 274
SITE 3 AC6 15 CLA A 404 PHE D 38 ALA D 41 TYR D 42
SITE 4 AC6 15 ALA F 22 THR F 25 PL9 J 101
SITE 1 AC7 8 ILE A 38 LEU A 42 ALA A 43 TRP A 105
SITE 2 AC7 8 CLA A 405 SQD A 414 PHE I 15 LMT b 603
SITE 1 AC8 13 PHE A 93 TRP A 97 GLU A 98 CLA A 405
SITE 2 AC8 13 LEU C 214 LYS C 215 SER C 216 PRO C 217
SITE 3 AC8 13 TRP C 223 PHE C 284 LYS I 5 TYR I 9
SITE 4 AC8 13 GLY O 38
SITE 1 AC9 14 ARG A 140 TRP A 142 PHE A 273 SQD A 413
SITE 2 AC9 14 TRP C 36 TRP C 443 ARG C 447 CLA C 507
SITE 3 AC9 14 CLA C 520 ASN D 220 ALA D 229 SER D 230
SITE 4 AC9 14 THR D 231 PHE D 232
SITE 1 AD1 12 SER A 232 ASN A 234 TRP B 5 TYR B 6
SITE 2 AD1 12 LMG B 624 TRP D 266 PHE D 269 PHE D 273
SITE 3 AD1 12 PL9 D 407 GLU L 11 ASN L 13 SER L 16
SITE 1 AD2 2 ASN A 181 LYS D 317
SITE 1 AD3 9 ASP A 170 GLU A 189 HIS A 332 GLU A 333
SITE 2 AD3 9 HIS A 337 ASP A 342 ALA A 344 GLU C 354
SITE 3 AD3 9 ARG C 357
SITE 1 AD4 14 ASN A 267 SER A 270 PHE A 273 PHE A 274
SITE 2 AD4 14 TRP A 278 LHG A 409 TRP C 36 DGD C 516
SITE 3 AD4 14 DGD C 517 LHG C 519 PHE D 232 ARG D 233
SITE 4 AD4 14 BCR J 102 PHE K 37
SITE 1 AD5 13 TRP A 20 ASN A 26 ARG A 27 LEU A 28
SITE 2 AD5 13 VAL A 30 THR A 45 BCR A 407 PHO D 401
SITE 3 AD5 13 TRP b 113 TYR b 117 CLA b 609 CLA b 619
SITE 4 AD5 13 BCR b 623
SITE 1 AD6 9 LEU A 72 LEU A 102 ASP A 103 ARG D 304
SITE 2 AD6 9 GLY O 138 ALA b 43 TRP b 75 SER b 76
SITE 3 AD6 9 LEU b 98
SITE 1 AD7 9 TRP B 185 PRO B 187 PHE B 190 ILE B 207
SITE 2 AD7 9 VAL B 208 PHE H 41 ILE H 44 CLA H 101
SITE 3 AD7 9 BCR H 102
SITE 1 AD8 20 ARG B 68 LEU B 69 ALA B 146 LEU B 149
SITE 2 AD8 20 CYS B 150 PHE B 153 VAL B 198 HIS B 201
SITE 3 AD8 20 HIS B 202 PHE B 247 ALA B 248 VAL B 252
SITE 4 AD8 20 THR B 262 CLA B 603 CLA B 604 CLA B 605
SITE 5 AD8 20 CLA B 608 PHE H 38 LEU H 42 CLA H 101
SITE 1 AD9 20 TRP B 33 PHE B 61 PHE B 65 ARG B 68
SITE 2 AD9 20 VAL B 245 ALA B 248 ALA B 249 VAL B 252
SITE 3 AD9 20 PHE B 451 HIS B 455 PHE B 458 ALA B 459
SITE 4 AD9 20 PHE B 462 CLA B 602 CLA B 604 CLA B 606
SITE 5 AD9 20 CLA B 610 CLA B 611 CLA B 612 CLA B 614
SITE 1 AE1 18 THR B 27 VAL B 30 ALA B 31 TRP B 33
SITE 2 AE1 18 ALA B 34 VAL B 62 PHE B 65 MET B 66
SITE 3 AE1 18 ARG B 68 LEU B 69 HIS B 100 LEU B 103
SITE 4 AE1 18 ALA B 205 CLA B 602 CLA B 603 CLA B 605
SITE 5 AE1 18 CLA B 609 CLA B 611
SITE 1 AE2 17 LEU B 69 TRP B 91 ALA B 99 LEU B 103
SITE 2 AE2 17 LEU B 106 GLY B 152 PHE B 153 PHE B 156
SITE 3 AE2 17 HIS B 157 PHE B 162 PRO B 164 CLA B 602
SITE 4 AE2 17 CLA B 604 CLA B 615 BCR B 619 LMT B 622
SITE 5 AE2 17 SQD a 401
SITE 1 AE3 20 TRP B 33 MET B 37 TYR B 40 GLN B 58
SITE 2 AE3 20 GLY B 59 PHE B 61 THR B 327 GLY B 328
SITE 3 AE3 20 PRO B 329 TRP B 450 ALA B 454 CLA B 603
SITE 4 AE3 20 BCR B 616 BCR B 617 BCR B 618 LMG B 621
SITE 5 AE3 20 LMG B 624 MET D 281 LEU L 27 PHE M 14
SITE 1 AE4 17 THR B 236 SER B 239 ALA B 243 PHE B 246
SITE 2 AE4 17 PHE B 247 PHE B 463 HIS B 466 LEU B 474
SITE 3 AE4 17 CLA B 608 CLA B 609 PHE D 120 ILE D 123
SITE 4 AE4 17 MET D 126 LEU D 127 PHE D 130 SQD D 403
SITE 5 AE4 17 LEU H 43
SITE 1 AE5 16 PHE B 139 ALA B 212 PHE B 215 HIS B 216
SITE 2 AE5 16 PRO B 221 PRO B 222 LEU B 229 CLA B 602
SITE 3 AE5 16 CLA B 607 CLA B 609 THR H 27 THR H 28
SITE 4 AE5 16 MET H 31 PHE H 34 MET H 35 BCR H 102
SITE 1 AE6 12 PHE B 139 HIS B 142 LEU B 143 ALA B 146
SITE 2 AE6 12 VAL B 237 SER B 240 CLA B 604 CLA B 607
SITE 3 AE6 12 CLA B 608 CLA B 611 CLA B 614 BCR H 102
SITE 1 AE7 17 TRP B 5 TYR B 6 ARG B 7 VAL B 8
SITE 2 AE7 17 HIS B 9 ILE B 242 LEU B 461 PHE B 462
SITE 3 AE7 17 GLY B 465 TRP B 468 HIS B 469 ARG B 472
SITE 4 AE7 17 CLA B 603 CLA B 611 CLA B 612 CLA B 613
SITE 5 AE7 17 LMG B 624
SITE 1 AE8 17 HIS B 9 LEU B 19 HIS B 23 HIS B 26
SITE 2 AE8 17 THR B 27 ILE B 234 VAL B 237 LEU B 238
SITE 3 AE8 17 SER B 241 VAL B 245 CLA B 603 CLA B 604
SITE 4 AE8 17 CLA B 609 CLA B 610 CLA B 612 CLA B 613
SITE 5 AE8 17 CLA B 614
SITE 1 AE9 10 HIS B 9 HIS B 26 VAL B 30 PHE B 462
SITE 2 AE9 10 CLA B 603 CLA B 610 CLA B 611 CLA B 613
SITE 3 AE9 10 BCR B 618 LMG B 624
SITE 1 AF1 14 VAL B 8 HIS B 9 VAL B 11 LEU B 12
SITE 2 AF1 14 LEU B 29 TRP B 115 CLA B 610 CLA B 611
SITE 3 AF1 14 CLA B 612 BCR B 616 SQD B 626 VAL L 10
SITE 4 AF1 14 LMG m 101 PHE t 8
SITE 1 AF2 12 HIS B 23 MET B 138 ILE B 141 HIS B 142
SITE 2 AF2 12 LEU B 145 CLA B 603 CLA B 609 CLA B 611
SITE 3 AF2 12 CLA B 615 BCR B 619 LEU H 14 ASN H 15
SITE 1 AF3 9 LEU B 24 ALA B 110 TRP B 113 HIS B 114
SITE 2 AF3 9 CLA B 605 CLA B 614 THR H 5 LEU H 7
SITE 3 AF3 9 SQD a 401
SITE 1 AF4 10 MET B 25 LEU B 29 TRP B 115 CLA B 606
SITE 2 AF4 10 CLA B 613 BCR B 617 BCR B 618 SQD B 626
SITE 3 AF4 10 LEU M 13 PHE t 19
SITE 1 AF5 12 TRP B 33 SER B 36 MET B 37 CLA B 606
SITE 2 AF5 12 BCR B 616 BCR B 618 LMT B 628 ILE t 4
SITE 3 AF5 12 PHE t 8 ALA t 11 PHE t 17 ILE t 21
SITE 1 AF6 9 LEU B 29 GLY B 32 TRP B 33 GLY B 105
SITE 2 AF6 9 CLA B 606 CLA B 612 BCR B 616 BCR B 617
SITE 3 AF6 9 DGD B 625
SITE 1 AF7 8 LEU B 109 CYS B 112 TYR B 117 CLA B 605
SITE 2 AF7 8 CLA B 614 SQD a 401 PHE t 18 PHE t 22
SITE 1 AF8 13 TYR B 193 PHE B 250 TYR B 258 TYR B 273
SITE 2 AF8 13 SER B 277 HIS D 87 LEU D 162 TYR H 49
SITE 3 AF8 13 ASN H 50 VAL H 60 SER H 61 TRP H 62
SITE 4 AF8 13 CLA H 101
SITE 1 AF9 10 THR B 327 GLY B 328 PRO B 329 LYS B 332
SITE 2 AF9 10 CLA B 606 ILE D 284 PHE L 35 ASN M 4
SITE 3 AF9 10 LEU M 6 LMT M 103
SITE 1 AG1 4 TRP B 91 PHE B 162 CLA B 605 DGD B 625
SITE 1 AG2 7 ARG B 224 LYS B 227 ASP D 16 ASP D 19
SITE 2 AG2 7 SQD D 403 ALA H 32 MET H 35
SITE 1 AG3 14 ASN A 234 LMG A 410 TRP B 5 TYR B 6
SITE 2 AG3 14 ARG B 7 PHE B 464 TRP B 468 CLA B 606
SITE 3 AG3 14 CLA B 610 CLA B 612 ARG D 139 TYR D 141
SITE 4 AG3 14 PHE D 269 PHE D 273
SITE 1 AG4 9 TRP B 75 ASP B 87 GLY B 89 PHE B 90
SITE 2 AG4 9 BCR B 618 LMT B 622 LMT B 627 ILE a 46
SITE 3 AG4 9 LMG i 101
SITE 1 AG5 13 ARG B 18 LEU B 29 SER B 104 PHE B 108
SITE 2 AG5 13 TRP B 115 CLA B 613 BCR B 616 ASN L 4
SITE 3 AG5 13 ARG l 14 TYR l 18 TYR m 26 PHE t 19
SITE 4 AG5 13 PHE t 23
SITE 1 AG6 8 GLY B 85 ASP B 87 DGD B 625 ALA a 100
SITE 2 AG6 8 BCR a 410 MET i 1 LMG i 101 LYS o 95
SITE 1 AG7 4 ALA B 43 LEU B 437 BCR B 617 VAL t 7
SITE 1 AG8 17 LEU C 95 LEU C 168 GLY C 171 ALA C 172
SITE 2 AG8 17 ILE C 224 VAL C 233 HIS C 237 ILE C 240
SITE 3 AG8 17 ALA C 278 MET C 282 PHE C 289 VAL C 296
SITE 4 AG8 17 TYR C 297 CLA C 502 CLA C 503 CLA C 506
SITE 5 AG8 17 BCR C 514
SITE 1 AG9 17 TRP C 63 HIS C 91 TRP C 97 LEU C 174
SITE 2 AG9 17 LYS C 178 PHE C 182 LEU C 279 MET C 282
SITE 3 AG9 17 ALA C 286 TYR C 297 HIS C 430 LEU C 433
SITE 4 AG9 17 PHE C 437 CLA C 501 CLA C 503 CLA C 508
SITE 5 AG9 17 CLA C 509
SITE 1 AH1 14 ILE C 60 VAL C 61 ALA C 64 THR C 68
SITE 2 AH1 14 LEU C 88 HIS C 91 ILE C 92 VAL C 114
SITE 3 AH1 14 HIS C 118 CLA C 501 CLA C 502 CLA C 509
SITE 4 AH1 14 CLA C 511 LMG C 518
SITE 1 AH2 16 PHE A 33 MET A 127 TRP A 131 PHE C 264
SITE 2 AH2 16 ILE C 265 TYR C 274 GLY C 277 ALA C 278
SITE 3 AH2 16 MET C 281 HIS C 441 LEU C 442 ALA C 445
SITE 4 AH2 16 ARG C 449 CLA C 506 BCR C 514 PHE I 23
SITE 1 AH3 13 LEU C 165 LEU C 213 ILE C 243 GLY C 247
SITE 2 AH3 13 TRP C 250 HIS C 251 THR C 255 PRO C 256
SITE 3 AH3 13 PHE C 257 TRP C 259 ALA C 260 PHE C 264
SITE 4 AH3 13 CLA C 506
SITE 1 AH4 15 MET C 157 LEU C 161 HIS C 164 ILE C 240
SITE 2 AH4 15 PHE C 264 TRP C 266 TYR C 271 TYR C 274
SITE 3 AH4 15 SER C 275 LEU C 279 CLA C 501 CLA C 504
SITE 4 AH4 15 CLA C 505 CLA C 508 BCR C 514
SITE 1 AH5 18 LHG A 409 TRP C 36 ALA C 37 ASN C 39
SITE 2 AH5 18 ALA C 40 GLU C 269 LEU C 276 PHE C 436
SITE 3 AH5 18 PHE C 437 GLY C 440 TRP C 443 HIS C 444
SITE 4 AH5 18 ARG C 447 CLA C 508 CLA C 509 DGD C 516
SITE 5 AH5 18 CLA C 520 VAL K 30
SITE 1 AH6 18 ASN C 39 LEU C 42 LEU C 49 ALA C 52
SITE 2 AH6 18 HIS C 53 HIS C 56 TYR C 149 GLY C 268
SITE 3 AH6 18 TYR C 271 LEU C 272 SER C 275 LEU C 279
SITE 4 AH6 18 CLA C 502 CLA C 506 CLA C 507 CLA C 509
SITE 5 AH6 18 CLA C 510 CLA C 511
SITE 1 AH7 15 ASN C 39 HIS C 56 LEU C 59 LEU C 279
SITE 2 AH7 15 PHE C 436 PHE C 437 CLA C 502 CLA C 503
SITE 3 AH7 15 CLA C 507 CLA C 508 CLA C 510 CLA C 520
SITE 4 AH7 15 PRO K 29 VAL K 30 LEU K 33
SITE 1 AH8 21 GLN C 28 TRP C 35 GLY C 38 ASN C 39
SITE 2 AH8 21 ARG C 41 LEU C 42 LYS C 48 ALA C 52
SITE 3 AH8 21 PHE C 127 ILE C 134 CLA C 508 CLA C 509
SITE 4 AH8 21 BCR C 513 PHE K 32 TRP K 39 GLN K 40
SITE 5 AH8 21 MET Z 19 VAL Z 20 PRO Z 24 ILE y 35
SITE 6 AH8 21 LEU y 46
SITE 1 AH9 12 HIS C 53 ALA C 57 PHE C 147 PHE C 163
SITE 2 AH9 12 HIS C 164 VAL C 167 ILE C 170 LEU C 174
SITE 3 AH9 12 CLA C 503 CLA C 508 CLA C 512 BCR C 521
SITE 1 AI1 9 LEU C 50 VAL C 124 GLY C 128 TYR C 131
SITE 2 AI1 9 HIS C 132 PRO C 137 PHE C 147 CLA C 511
SITE 3 AI1 9 BCR C 521
SITE 1 AI2 11 ALA C 55 LEU C 59 VAL C 116 LEU C 119
SITE 2 AI2 11 SER C 122 ALA C 123 CLA C 510 BCR C 521
SITE 3 AI2 11 PHE K 32 VAL Z 13 BCR y 101
SITE 1 AI3 11 ILE C 209 TYR C 212 LEU C 213 VAL C 227
SITE 2 AI3 11 ASP C 232 VAL C 233 ILE C 240 PHE C 264
SITE 3 AI3 11 CLA C 501 CLA C 504 CLA C 506
SITE 1 AI4 16 LEU A 91 PHE A 155 ILE A 163 PRO C 217
SITE 2 AI4 16 PHE C 218 GLY C 219 GLY C 220 VAL C 225
SITE 3 AI4 16 SER C 226 PHE C 284 CYS C 288 PHE C 292
SITE 4 AI4 16 ASN C 294 PRO C 307 PHE C 361 ARG C 362
SITE 1 AI5 20 PHE A 197 SQD A 413 TYR C 82 GLU C 83
SITE 2 AI5 20 GLN C 84 GLY C 85 LEU C 404 SER C 406
SITE 3 AI5 20 ASN C 418 PHE C 419 VAL C 420 TRP C 425
SITE 4 AI5 20 SER C 429 CLA C 507 DGD C 517 LHG C 519
SITE 5 AI5 20 CLA C 520 LMG C 522 TYR J 33 BCR J 102
SITE 1 AI6 20 LEU A 200 TRP A 278 PHE A 300 ASN A 301
SITE 2 AI6 20 SER A 305 SQD A 413 ASN C 405 VAL C 407
SITE 3 AI6 20 ASN C 415 SER C 416 ASN C 418 DGD C 516
SITE 4 AI6 20 CLA C 520 PHE J 29 ALA J 32 TYR J 33
SITE 5 AI6 20 GLY J 37 SER J 38 SER J 39 GLN V 60
SITE 1 AI7 7 TRP C 97 PHE C 109 VAL C 113 VAL C 117
SITE 2 AI7 7 HIS C 118 CLA C 503 PHE Z 59
SITE 1 AI8 8 TYR A 262 ASN A 266 SQD A 413 TRP C 35
SITE 2 AI8 8 DGD C 516 LMG E 101 BCR J 102 PHE K 45
SITE 1 AI9 17 PHE A 285 LHG A 409 TRP C 63 MET C 67
SITE 2 AI9 17 PHE C 70 GLN C 84 GLY C 85 ILE C 87
SITE 3 AI9 17 TRP C 425 SER C 429 CLA C 507 CLA C 509
SITE 4 AI9 17 DGD C 516 DGD C 517 LMG C 522 PRO K 26
SITE 5 AI9 17 VAL K 30
SITE 1 AJ1 11 PHE C 112 VAL C 116 SER C 121 VAL C 124
SITE 2 AJ1 11 CLA C 511 CLA C 512 BCR C 513 TYR K 15
SITE 3 AJ1 11 VAL Z 54 GLY Z 55 ASN Z 58
SITE 1 AJ2 7 HIS C 74 DGD C 516 CLA C 520 BCR J 102
SITE 2 AJ2 7 ASP K 23 VAL K 27 ILE y 25
SITE 1 AJ3 19 LEU A 41 ALA A 44 THR A 45 ILE A 115
SITE 2 AJ3 19 TYR A 126 GLN A 130 ALA A 146 TYR A 147
SITE 3 AJ3 19 VAL A 283 CLA A 402 CLA A 403 SQD A 414
SITE 4 AJ3 19 LEU D 205 ALA D 208 LEU D 209 ALA D 212
SITE 5 AJ3 19 ILE D 213 TRP D 253 PHE D 257
SITE 1 AJ4 20 PHE A 206 ALA A 209 LEU A 210 MET A 214
SITE 2 AJ4 20 LEU A 258 CLA A 404 ALA D 41 LEU D 45
SITE 3 AJ4 20 TRP D 48 GLY D 118 LEU D 122 PHE D 125
SITE 4 AJ4 20 GLN D 129 ASN D 142 PHE D 146 PHE D 153
SITE 5 AJ4 20 PHE D 173 PRO D 275 LEU D 279 CLA D 405
SITE 1 AJ5 10 LYS B 227 ALA B 228 ARG B 230 LEU B 474
SITE 2 AJ5 10 CLA B 607 LMT B 623 LYS D 23 TRP D 32
SITE 3 AJ5 10 ARG D 134 LEU D 135
SITE 1 AJ6 8 HIS A 215 GLU A 244 TYR A 246 HIS A 272
SITE 2 AJ6 8 FE2 A 401 TYR D 244 LYS D 264 HIS D 268
SITE 1 AJ7 22 PHE A 206 CLA A 402 CLA A 403 CLA A 404
SITE 2 AJ7 22 LEU D 122 VAL D 152 PHE D 153 VAL D 156
SITE 3 AJ7 22 LEU D 182 PHE D 185 GLN D 186 TRP D 191
SITE 4 AJ7 22 THR D 192 HIS D 197 GLY D 200 VAL D 201
SITE 5 AJ7 22 VAL D 204 LEU D 279 SER D 282 ALA D 283
SITE 6 AJ7 22 VAL D 286 PHO D 402
SITE 1 AJ8 14 LEU D 43 LEU D 89 LEU D 90 LEU D 91
SITE 2 AJ8 14 LEU D 92 TRP D 93 THR D 112 PHE D 113
SITE 3 AJ8 14 HIS D 117 PHE D 120 LMT D 410 GLY X 22
SITE 4 AJ8 14 LEU X 23 GLY X 26
SITE 1 AJ9 18 PHE A 52 ILE A 77 CLA A 403 LMG A 410
SITE 2 AJ9 18 MET D 199 LEU D 209 HIS D 214 THR D 217
SITE 3 AJ9 18 TRP D 253 ALA D 260 PHE D 261 LEU D 267
SITE 4 AJ9 18 PHE D 270 PHE D 273 VAL D 274 LMG D 408
SITE 5 AJ9 18 VAL L 26 PHE T 10
SITE 1 AK1 13 PHE D 257 ILE D 259 ALA D 260 PHE D 261
SITE 2 AK1 13 SER D 262 ASN D 263 TRP D 266 PL9 D 407
SITE 3 AK1 13 THR L 15 TYR L 18 LEU L 19 PHE T 17
SITE 4 AK1 13 ALA T 20
SITE 1 AK2 6 ASP D 100 PHE D 101 THR D 102 LMT D 410
SITE 2 AK2 6 ASP E 45 VAL E 46
SITE 1 AK3 8 LEU D 92 TRP D 93 GLY D 99 CLA D 406
SITE 2 AK3 8 DGD D 409 ILE X 21 SER X 25 GLY X 26
SITE 1 AK4 11 TYR D 42 GLY D 47 LEU D 49 THR D 50
SITE 2 AK4 11 PHE D 101 LMG D 412 PRO F 29 PHE F 33
SITE 3 AK4 11 VAL J 21 VAL J 25 PL9 J 101
SITE 1 AK5 13 TYR D 67 GLY D 70 CYS D 71 ASN D 72
SITE 2 AK5 13 PHE D 73 BCR D 411 ILE F 37 MET F 40
SITE 3 AK5 13 GLN F 41 PHE J 28 GLY J 31 ALA J 32
SITE 4 AK5 13 GLY J 37
SITE 1 AK6 7 TYR A 262 LHG C 519 PHE D 27 PRO E 9
SITE 2 AK6 7 PHE E 10 SER E 11 PL9 J 101
SITE 1 AK7 15 ARG E 8 PHE E 10 ILE E 13 ARG E 18
SITE 2 AK7 15 TYR E 19 HIS E 23 THR E 26 LEU E 30
SITE 3 AK7 15 ILE F 15 ARG F 19 TRP F 20 VAL F 23
SITE 4 AK7 15 HIS F 24 ALA F 27 ILE F 31
SITE 1 AK8 9 TRP D 21 ARG D 24 ARG D 26 GLU E 7
SITE 2 AK8 9 PHE F 16 THR F 17 VAL F 18 THR X 33
SITE 3 AK8 9 ASP X 44
SITE 1 AK9 16 GLU B 184 GLY B 189 GLY B 197 HIS B 201
SITE 2 AK9 16 ALA B 204 ALA B 205 VAL B 208 PHE B 247
SITE 3 AK9 16 CLA B 601 CLA B 602 DGD B 620 VAL D 154
SITE 4 AK9 16 PHE H 38 PHE H 41 ILE H 45 TYR H 49
SITE 1 AL1 10 CLA B 601 CLA B 608 CLA B 609 PHE H 34
SITE 2 AL1 10 MET H 35 LEU H 37 PHE H 38 PHE H 41
SITE 3 AL1 10 THR X 11 LEU X 16
SITE 1 AL2 6 MET I 1 THR I 3 LEU I 4 LMT I 102
SITE 2 AL2 6 DGD b 601 LMT b 603
SITE 1 AL3 4 THR I 3 ILE I 6 ILE I 10 LMG I 101
SITE 1 AL4 4 PL9 A 406 BCR D 411 LMG E 101 VAL J 16
SITE 1 AL5 6 SQD A 413 DGD C 516 LHG C 519 LMG C 522
SITE 2 AL5 6 PHE J 29 TYR J 33
SITE 1 AL6 2 ASP K 19 ASP K 23
SITE 1 AL7 9 GLU M 30 SER M 31 SQD b 602 CLA b 617
SITE 2 AL7 9 PRO l 9 VAL l 10 ILE m 24 GLN m 28
SITE 3 AL7 9 GLN m 32
SITE 1 AL8 7 MET M 1 GLU M 2 MET T 1 ILE T 4
SITE 2 AL8 7 TYR b 40 LMG b 625 GLN m 5
SITE 1 AL9 6 TYR B 40 LMG B 621 GLN M 5 MET m 1
SITE 2 AL9 6 GLU m 2 MET t 1
SITE 1 AM1 2 GLU O 140 HIS O 257
SITE 1 AM2 14 ALA V 62 CYS V 63 CYS V 66 HIS V 67
SITE 2 AM2 14 THR V 74 LEU V 78 ASP V 79 THR V 84
SITE 3 AM2 14 LEU V 85 TYR V 101 MET V 102 TYR V 108
SITE 4 AM2 14 HIS V 118 PRO V 119
SITE 1 AM3 14 BCR C 513 ALA J 14 THR J 15 MET J 19
SITE 2 AM3 14 ILE K 28 LEU K 31 ALA K 34 PHE K 37
SITE 3 AM3 14 VAL K 38 VAL Z 13 PHE Z 17 ILE y 28
SITE 4 AM3 14 GLY y 29 GLY y 32
SITE 1 AM4 13 TRP B 113 TYR B 117 CLA B 605 CLA B 615
SITE 2 AM4 13 BCR B 619 TRP a 20 ASN a 26 ARG a 27
SITE 3 AM4 13 LEU a 28 VAL a 30 THR a 45 BCR a 410
SITE 4 AM4 13 PHO d 401
SITE 1 AM5 8 ALA B 43 TRP B 75 SER B 76 LEU B 98
SITE 2 AM5 8 LEU a 72 ASP a 103 ARG d 304 GLY o 138
SITE 1 AM6 5 HIS a 215 HIS a 272 HIS d 214 HIS d 268
SITE 2 AM6 5 BCT d 403
SITE 1 AM7 24 PHE a 119 TYR a 147 PRO a 150 SER a 153
SITE 2 AM7 24 VAL a 157 MET a 183 PHE a 186 GLN a 187
SITE 3 AM7 24 LEU a 193 HIS a 198 GLY a 201 VAL a 205
SITE 4 AM7 24 PHE a 206 VAL a 283 THR a 286 ILE a 290
SITE 5 AM7 24 CLA a 405 CLA a 406 LEU d 182 LEU d 205
SITE 6 AM7 24 PHO d 401 CLA d 404 LMG d 407 PHE t 17
SITE 1 AM8 14 THR a 45 VAL a 157 PHE a 158 MET a 172
SITE 2 AM8 14 ILE a 176 THR a 179 PHE a 180 MET a 183
SITE 3 AM8 14 CLA a 404 MET d 198 VAL d 201 PHO d 401
SITE 4 AM8 14 CLA d 404 PL9 d 406
SITE 1 AM9 13 GLN a 199 VAL a 202 ALA a 203 TRP a 278
SITE 2 AM9 13 CLA a 404 PHO a 407 PHE d 157 VAL d 175
SITE 3 AM9 13 ILE d 178 PHE d 179 PHE d 181 LEU d 182
SITE 4 AM9 13 CLA d 404
SITE 1 AN1 21 PHE a 206 ALA a 209 LEU a 210 MET a 214
SITE 2 AN1 21 LEU a 258 CLA a 406 ALA d 41 TRP d 48
SITE 3 AN1 21 GLY d 118 LEU d 122 PHE d 125 GLN d 129
SITE 4 AN1 21 ASN d 142 ALA d 145 PHE d 146 ALA d 148
SITE 5 AN1 21 PHE d 153 PHE d 173 PRO d 275 LEU d 279
SITE 6 AN1 21 CLA d 404
SITE 1 AN2 14 ILE a 36 PRO a 39 THR a 40 PHE a 93
SITE 2 AN2 14 PRO a 95 ILE a 96 TRP a 97 LEU a 114
SITE 3 AN2 14 HIS a 118 LEU a 121 BCR a 410 DGD a 411
SITE 4 AN2 14 TYR i 9 PHE i 15
SITE 1 AN3 13 HIS a 215 LEU a 218 HIS a 252 PHE a 255
SITE 2 AN3 13 SER a 264 PHE a 265 LEU a 271 PHE a 274
SITE 3 AN3 13 PHE d 38 ALA d 41 TYR d 42 THR f 25
SITE 4 AN3 13 PL9 j 101
SITE 1 AN4 8 LMT B 627 LEU a 42 ALA a 43 TRP a 105
SITE 2 AN4 8 LEU a 106 SQD a 401 CLA a 408 PHE i 15
SITE 1 AN5 13 PHE a 93 TRP a 97 GLU a 98 CLA a 408
SITE 2 AN5 13 LEU c 214 LYS c 215 SER c 216 PRO c 217
SITE 3 AN5 13 TRP c 223 PHE c 284 LYS i 5 TYR i 9
SITE 4 AN5 13 GLY o 38
SITE 1 AN6 15 ARG a 140 TRP a 142 PHE a 273 SQD a 415
SITE 2 AN6 15 TRP c 36 PHE c 436 TRP c 443 ARG c 447
SITE 3 AN6 15 CLA c 507 CLA c 520 ASN d 220 ALA d 229
SITE 4 AN6 15 SER d 230 THR d 231 PHE d 232
SITE 1 AN7 13 SER a 232 ASN a 234 TRP b 5 TYR b 6
SITE 2 AN7 13 LMG b 628 TRP d 266 PHE d 269 PHE d 273
SITE 3 AN7 13 PL9 d 406 GLU l 11 ASN l 13 SER l 16
SITE 4 AN7 13 VAL l 26
SITE 1 AN8 9 ASP a 170 GLU a 189 HIS a 332 GLU a 333
SITE 2 AN8 9 HIS a 337 ASP a 342 ALA a 344 GLU c 354
SITE 3 AN8 9 ARG c 357
SITE 1 AN9 14 ASN a 267 SER a 270 PHE a 273 PHE a 274
SITE 2 AN9 14 TRP a 278 LHG a 412 TRP c 36 DGD c 516
SITE 3 AN9 14 DGD c 517 LHG c 519 PHE d 232 ARG d 233
SITE 4 AN9 14 BCR j 102 PHE k 37
SITE 1 AO1 3 ASN a 181 GLU a 333 LYS d 317
SITE 1 AO2 8 ILE A 46 LMG I 101 TRP b 75 ASP b 87
SITE 2 AO2 8 GLY b 89 PHE b 90 LMT b 603 LMT b 626
SITE 1 AO3 13 ARG L 14 TYR L 18 TYR M 26 LMG M 101
SITE 2 AO3 13 PHE T 19 PHE T 23 ARG b 18 LEU b 29
SITE 3 AO3 13 SER b 104 TRP b 115 CLA b 617 BCR b 620
SITE 4 AO3 13 ASN l 4
SITE 1 AO4 7 BCR A 407 MET I 1 LMG I 101 LYS O 95
SITE 2 AO4 7 GLY b 85 ASP b 87 DGD b 601
SITE 1 AO5 4 VAL T 7 ALA b 43 LEU b 437 BCR b 621
SITE 1 AO6 8 TRP b 185 PRO b 187 PHE b 190 ILE b 207
SITE 2 AO6 8 PHE h 41 ILE h 44 CLA h 101 BCR x 101
SITE 1 AO7 19 ARG b 68 LEU b 69 ALA b 146 LEU b 149
SITE 2 AO7 19 CYS b 150 PHE b 153 VAL b 198 HIS b 201
SITE 3 AO7 19 HIS b 202 PHE b 247 ALA b 248 VAL b 252
SITE 4 AO7 19 THR b 262 CLA b 607 CLA b 608 CLA b 609
SITE 5 AO7 19 CLA b 612 PHE h 38 CLA h 101
SITE 1 AO8 20 TRP b 33 PHE b 61 PHE b 65 ARG b 68
SITE 2 AO8 20 VAL b 245 ALA b 248 ALA b 249 VAL b 252
SITE 3 AO8 20 PHE b 451 HIS b 455 PHE b 458 ALA b 459
SITE 4 AO8 20 PHE b 462 CLA b 606 CLA b 608 CLA b 610
SITE 5 AO8 20 CLA b 614 CLA b 615 CLA b 616 CLA b 618
SITE 1 AO9 20 THR b 27 VAL b 30 ALA b 31 TRP b 33
SITE 2 AO9 20 ALA b 34 VAL b 62 PHE b 65 MET b 66
SITE 3 AO9 20 ARG b 68 LEU b 69 VAL b 96 HIS b 100
SITE 4 AO9 20 LEU b 103 ALA b 205 CLA b 606 CLA b 607
SITE 5 AO9 20 CLA b 609 CLA b 612 CLA b 613 CLA b 615
SITE 1 AP1 16 SQD A 414 LEU b 69 TRP b 91 ALA b 99
SITE 2 AP1 16 LEU b 103 LEU b 106 GLY b 152 PHE b 153
SITE 3 AP1 16 PHE b 156 HIS b 157 PHE b 162 PRO b 164
SITE 4 AP1 16 CLA b 606 CLA b 608 BCR b 623 LMT b 626
SITE 1 AP2 18 TRP b 33 TYR b 40 GLN b 58 GLY b 59
SITE 2 AP2 18 PHE b 61 THR b 327 GLY b 328 PRO b 329
SITE 3 AP2 18 TRP b 450 ALA b 454 CLA b 607 BCR b 620
SITE 4 AP2 18 BCR b 621 BCR b 622 LMG b 625 LMG b 628
SITE 5 AP2 18 MET d 281 LEU l 27
SITE 1 AP3 15 THR b 236 SER b 239 ALA b 243 PHE b 246
SITE 2 AP3 15 PHE b 247 HIS b 466 LEU b 474 CLA b 612
SITE 3 AP3 15 CLA b 613 PHE d 120 ILE d 123 MET d 126
SITE 4 AP3 15 LEU d 127 PHE d 130 SQD d 402
SITE 1 AP4 17 PHE b 139 ALA b 212 PHE b 215 HIS b 216
SITE 2 AP4 17 PRO b 221 PRO b 222 LEU b 229 CLA b 606
SITE 3 AP4 17 CLA b 608 CLA b 611 CLA b 613 THR h 27
SITE 4 AP4 17 THR h 28 MET h 31 PHE h 34 MET h 35
SITE 5 AP4 17 BCR x 101
SITE 1 AP5 13 LEU b 135 PHE b 139 HIS b 142 LEU b 143
SITE 2 AP5 13 THR b 236 VAL b 237 SER b 240 CLA b 608
SITE 3 AP5 13 CLA b 611 CLA b 612 CLA b 615 CLA b 618
SITE 4 AP5 13 BCR x 101
SITE 1 AP6 18 TRP b 5 TYR b 6 ARG b 7 VAL b 8
SITE 2 AP6 18 HIS b 9 THR b 10 ILE b 242 LEU b 461
SITE 3 AP6 18 PHE b 462 GLY b 465 TRP b 468 HIS b 469
SITE 4 AP6 18 ARG b 472 CLA b 607 CLA b 615 CLA b 616
SITE 5 AP6 18 CLA b 617 LMG b 628
SITE 1 AP7 17 HIS b 9 LEU b 19 HIS b 23 HIS b 26
SITE 2 AP7 17 THR b 27 ILE b 234 VAL b 237 LEU b 238
SITE 3 AP7 17 SER b 241 VAL b 245 CLA b 607 CLA b 608
SITE 4 AP7 17 CLA b 613 CLA b 614 CLA b 616 CLA b 617
SITE 5 AP7 17 CLA b 618
SITE 1 AP8 8 HIS b 9 HIS b 26 PHE b 462 CLA b 607
SITE 2 AP8 8 CLA b 614 CLA b 615 CLA b 617 LMG b 628
SITE 1 AP9 12 LMG M 101 PHE T 8 VAL b 8 HIS b 9
SITE 2 AP9 12 VAL b 11 TRP b 115 SQD b 602 CLA b 614
SITE 3 AP9 12 CLA b 615 CLA b 616 BCR b 620 VAL l 10
SITE 1 AQ1 11 HIS b 23 MET b 138 ILE b 141 HIS b 142
SITE 2 AQ1 11 LEU b 145 CLA b 607 CLA b 613 CLA b 615
SITE 3 AQ1 11 CLA b 619 BCR b 623 LEU h 14
SITE 1 AQ2 8 SQD A 414 LEU b 24 ALA b 110 TRP b 113
SITE 2 AQ2 8 HIS b 114 CLA b 618 THR h 5 LEU h 7
SITE 1 AQ3 11 PHE T 19 MET b 25 LEU b 29 TRP b 115
SITE 2 AQ3 11 SQD b 602 CLA b 610 CLA b 617 BCR b 621
SITE 3 AQ3 11 BCR b 622 ALA m 10 LEU m 13
SITE 1 AQ4 14 ILE T 4 PHE T 8 ALA T 11 PHE T 17
SITE 2 AQ4 14 PHE T 18 ILE T 21 PHE T 22 TRP b 33
SITE 3 AQ4 14 SER b 36 MET b 37 LMT b 604 CLA b 610
SITE 4 AQ4 14 BCR b 620 BCR b 622
SITE 1 AQ5 6 GLY b 32 TRP b 33 GLY b 105 CLA b 610
SITE 2 AQ5 6 BCR b 620 BCR b 621
SITE 1 AQ6 9 SQD A 414 PHE T 22 LEU b 106 LEU b 109
SITE 2 AQ6 9 ALA b 110 CYS b 112 TYR b 117 CLA b 609
SITE 3 AQ6 9 CLA b 618
SITE 1 AQ7 13 TYR b 193 PHE b 250 TYR b 258 TYR b 273
SITE 2 AQ7 13 SER b 277 HIS d 87 LEU d 162 TYR h 49
SITE 3 AQ7 13 ASN h 50 VAL h 60 SER h 61 TRP h 62
SITE 4 AQ7 13 CLA h 101
SITE 1 AQ8 11 LMT M 102 THR b 327 GLY b 328 PRO b 329
SITE 2 AQ8 11 LYS b 332 PHE b 453 CLA b 610 ILE d 284
SITE 3 AQ8 11 PHE l 35 ASN m 4 LEU m 6
SITE 1 AQ9 4 TRP b 91 PHE b 162 DGD b 601 CLA b 609
SITE 1 AR1 7 ARG b 224 LYS b 227 ASP d 16 ASP d 19
SITE 2 AR1 7 SQD d 402 ALA h 32 MET h 35
SITE 1 AR2 13 ASN a 234 LMG a 413 TRP b 5 TYR b 6
SITE 2 AR2 13 ARG b 7 PHE b 464 TRP b 468 CLA b 610
SITE 3 AR2 13 CLA b 614 CLA b 616 ARG d 139 TYR d 141
SITE 4 AR2 13 PHE d 269
SITE 1 AR3 16 LEU c 95 LEU c 168 GLY c 171 ALA c 172
SITE 2 AR3 16 ILE c 224 VAL c 233 HIS c 237 ILE c 240
SITE 3 AR3 16 MET c 282 PHE c 289 VAL c 296 TYR c 297
SITE 4 AR3 16 CLA c 502 CLA c 503 CLA c 506 BCR c 514
SITE 1 AR4 15 TRP c 63 HIS c 91 TRP c 97 LYS c 178
SITE 2 AR4 15 PHE c 182 LEU c 279 MET c 282 ALA c 286
SITE 3 AR4 15 TYR c 297 HIS c 430 LEU c 433 PHE c 437
SITE 4 AR4 15 CLA c 501 CLA c 503 CLA c 508
SITE 1 AR5 14 ILE c 60 VAL c 61 ALA c 64 THR c 68
SITE 2 AR5 14 LEU c 88 HIS c 91 ILE c 92 VAL c 114
SITE 3 AR5 14 HIS c 118 CLA c 501 CLA c 502 CLA c 509
SITE 4 AR5 14 CLA c 511 LMG c 518
SITE 1 AR6 17 PHE a 33 MET a 127 TRP a 131 PHE c 264
SITE 2 AR6 17 ILE c 265 TYR c 274 GLY c 277 ALA c 278
SITE 3 AR6 17 MET c 281 HIS c 441 LEU c 442 ALA c 445
SITE 4 AR6 17 ARG c 449 CLA c 506 BCR c 514 VAL i 12
SITE 5 AR6 17 PHE i 23
SITE 1 AR7 13 LEU c 165 LEU c 213 ILE c 243 GLY c 247
SITE 2 AR7 13 TRP c 250 HIS c 251 THR c 255 PRO c 256
SITE 3 AR7 13 PHE c 257 TRP c 259 ALA c 260 PHE c 264
SITE 4 AR7 13 CLA c 506
SITE 1 AR8 13 MET c 157 LEU c 161 HIS c 164 PHE c 264
SITE 2 AR8 13 TRP c 266 TYR c 271 TYR c 274 SER c 275
SITE 3 AR8 13 LEU c 279 CLA c 501 CLA c 504 CLA c 505
SITE 4 AR8 13 CLA c 508
SITE 1 AR9 16 LHG a 412 TRP c 36 ALA c 37 ASN c 39
SITE 2 AR9 16 ALA c 40 GLU c 269 LEU c 276 PHE c 436
SITE 3 AR9 16 PHE c 437 GLY c 440 TRP c 443 HIS c 444
SITE 4 AR9 16 ARG c 447 CLA c 508 CLA c 509 DGD c 516
SITE 1 AS1 19 ASN c 39 LEU c 42 LEU c 49 ALA c 52
SITE 2 AS1 19 HIS c 53 HIS c 56 TYR c 149 TRP c 151
SITE 3 AS1 19 GLY c 268 TYR c 271 LEU c 272 SER c 275
SITE 4 AS1 19 LEU c 279 CLA c 502 CLA c 506 CLA c 507
SITE 5 AS1 19 CLA c 509 CLA c 510 CLA c 511
SITE 1 AS2 14 ASN c 39 HIS c 56 LEU c 59 LEU c 279
SITE 2 AS2 14 PHE c 436 PHE c 437 CLA c 503 CLA c 507
SITE 3 AS2 14 CLA c 508 CLA c 510 CLA c 520 PRO k 29
SITE 4 AS2 14 VAL k 30 LEU k 33
SITE 1 AS3 21 GLN c 28 TRP c 35 GLY c 38 ASN c 39
SITE 2 AS3 21 ARG c 41 LEU c 42 LYS c 48 ALA c 52
SITE 3 AS3 21 PHE c 127 ILE c 134 CLA c 508 CLA c 509
SITE 4 AS3 21 BCR c 513 ILE g 35 LEU g 46 PHE k 32
SITE 5 AS3 21 TRP k 39 GLN k 40 MET z 19 VAL z 20
SITE 6 AS3 21 PRO z 24
SITE 1 AS4 12 HIS c 53 ALA c 57 PHE c 147 PHE c 163
SITE 2 AS4 12 HIS c 164 VAL c 167 ILE c 170 LEU c 174
SITE 3 AS4 12 CLA c 503 CLA c 508 CLA c 512 BCR c 521
SITE 1 AS5 9 LEU c 50 VAL c 124 GLY c 128 TYR c 131
SITE 2 AS5 9 HIS c 132 PRO c 137 PHE c 147 CLA c 511
SITE 3 AS5 9 BCR c 521
SITE 1 AS6 10 ALA c 55 VAL c 116 LEU c 119 SER c 122
SITE 2 AS6 10 ALA c 123 CLA c 510 BCR c 521 BCR g 101
SITE 3 AS6 10 PHE k 32 VAL z 13
SITE 1 AS7 11 ILE c 209 TYR c 212 LEU c 213 VAL c 227
SITE 2 AS7 11 ASP c 232 VAL c 233 GLY c 236 ILE c 240
SITE 3 AS7 11 PHE c 264 CLA c 501 CLA c 504
SITE 1 AS8 16 LEU a 91 PHE a 155 ILE a 163 PRO c 217
SITE 2 AS8 16 PHE c 218 GLY c 219 GLY c 220 VAL c 225
SITE 3 AS8 16 SER c 226 PHE c 284 CYS c 288 PHE c 292
SITE 4 AS8 16 ASN c 294 PRO c 307 PHE c 361 ARG c 362
SITE 1 AS9 19 PHE a 197 SQD a 415 TYR c 82 GLU c 83
SITE 2 AS9 19 GLN c 84 GLY c 85 SER c 406 ASN c 418
SITE 3 AS9 19 PHE c 419 VAL c 420 TRP c 425 SER c 429
SITE 4 AS9 19 CLA c 507 DGD c 517 LHG c 519 CLA c 520
SITE 5 AS9 19 LMG c 522 TYR j 33 BCR j 102
SITE 1 AT1 22 LEU a 200 TRP a 278 PHE a 300 ASN a 301
SITE 2 AT1 22 SER a 305 SQD a 415 ASN c 405 SER c 406
SITE 3 AT1 22 VAL c 407 ASN c 415 SER c 416 ASN c 418
SITE 4 AT1 22 DGD c 516 CLA c 520 LMG d 410 PHE j 29
SITE 5 AT1 22 ALA j 32 TYR j 33 GLY j 37 SER j 38
SITE 6 AT1 22 SER j 39 GLN v 60
SITE 1 AT2 7 TRP c 97 PHE c 109 VAL c 113 VAL c 117
SITE 2 AT2 7 HIS c 118 CLA c 503 PHE z 59
SITE 1 AT3 8 TYR a 262 ASN a 266 SQD a 415 TRP c 35
SITE 2 AT3 8 DGD c 516 LMG e 101 BCR j 102 PHE k 45
SITE 1 AT4 16 PHE a 285 LHG a 412 TRP c 63 MET c 67
SITE 2 AT4 16 PHE c 70 GLN c 84 GLY c 85 ILE c 87
SITE 3 AT4 16 TRP c 425 SER c 429 CLA c 509 DGD c 516
SITE 4 AT4 16 DGD c 517 LMG c 522 PRO k 26 VAL k 30
SITE 1 AT5 10 VAL c 116 SER c 121 VAL c 124 CLA c 511
SITE 2 AT5 10 CLA c 512 BCR c 513 TYR k 15 VAL z 54
SITE 3 AT5 10 GLY z 55 ASN z 58
SITE 1 AT6 8 PHE c 70 HIS c 74 DGD c 516 CLA c 520
SITE 2 AT6 8 ILE g 25 BCR j 102 ASP k 23 VAL k 27
SITE 1 AT7 19 ALA a 44 THR a 45 ILE a 115 TYR a 126
SITE 2 AT7 19 GLN a 130 TYR a 147 PRO a 150 LEU a 174
SITE 3 AT7 19 GLY a 175 VAL a 283 SQD a 401 CLA a 404
SITE 4 AT7 19 CLA a 405 LEU d 205 ALA d 208 LEU d 209
SITE 5 AT7 19 ILE d 213 TRP d 253 PHE d 257
SITE 1 AT8 10 LYS b 227 ALA b 228 ARG b 230 LEU b 474
SITE 2 AT8 10 CLA b 611 LMT b 627 LYS d 23 TRP d 32
SITE 3 AT8 10 ARG d 134 LEU d 135
SITE 1 AT9 8 HIS a 215 GLU a 244 TYR a 246 HIS a 272
SITE 2 AT9 8 FE2 a 403 TYR d 244 LYS d 264 HIS d 268
SITE 1 AU1 22 PHE a 206 CLA a 404 CLA a 405 CLA a 406
SITE 2 AU1 22 PHO a 407 TRP d 48 VAL d 152 PHE d 153
SITE 3 AU1 22 VAL d 156 LEU d 182 PHE d 185 GLN d 186
SITE 4 AU1 22 TRP d 191 THR d 192 HIS d 197 GLY d 200
SITE 5 AU1 22 VAL d 201 VAL d 204 LEU d 279 SER d 282
SITE 6 AU1 22 ALA d 283 VAL d 286
SITE 1 AU2 14 LEU d 43 LEU d 89 LEU d 90 LEU d 91
SITE 2 AU2 14 LEU d 92 TRP d 93 THR d 112 PHE d 113
SITE 3 AU2 14 HIS d 117 PHE d 120 LMT d 409 GLY x 22
SITE 4 AU2 14 LEU x 23 GLY x 26
SITE 1 AU3 14 CLA a 405 LMG a 413 MET d 199 HIS d 214
SITE 2 AU3 14 THR d 217 TRP d 253 ILE d 259 ALA d 260
SITE 3 AU3 14 PHE d 261 LEU d 267 PHE d 273 VAL d 274
SITE 4 AU3 14 VAL l 26 PHE t 10
SITE 1 AU4 13 CLA a 404 PHE d 257 ILE d 259 ALA d 260
SITE 2 AU4 13 PHE d 261 SER d 262 ASN d 263 TRP d 266
SITE 3 AU4 13 THR l 15 TYR l 18 LEU l 19 PHE t 17
SITE 4 AU4 13 ALA t 20
SITE 1 AU5 6 ASP d 100 PHE d 101 THR d 102 LMT d 409
SITE 2 AU5 6 ASP e 45 VAL e 46
SITE 1 AU6 8 LEU d 92 TRP d 93 GLY d 99 CLA d 405
SITE 2 AU6 8 DGD d 408 ILE x 21 SER x 25 GLY x 26
SITE 1 AU7 13 DGD c 517 TYR d 67 GLY d 70 ASN d 72
SITE 2 AU7 13 PHE d 73 ILE f 37 MET f 40 GLN f 41
SITE 3 AU7 13 BCR f 102 PHE j 28 GLY j 31 ALA j 32
SITE 4 AU7 13 GLY j 37
SITE 1 AU8 7 TYR a 262 LHG c 519 PHE d 27 PRO e 9
SITE 2 AU8 7 PHE e 10 SER e 11 PL9 j 101
SITE 1 AU9 14 ARG e 8 PHE e 10 ILE e 13 ARG e 18
SITE 2 AU9 14 TYR e 19 HIS e 23 THR e 26 LEU e 30
SITE 3 AU9 14 ILE f 15 ARG f 19 TRP f 20 HIS f 24
SITE 4 AU9 14 ALA f 27 ILE f 31
SITE 1 AV1 12 TYR d 42 GLY d 46 GLY d 47 LEU d 49
SITE 2 AV1 12 THR d 50 PHE d 101 LMG d 410 PRO f 29
SITE 3 AV1 12 PHE f 33 VAL j 21 VAL j 25 PL9 j 101
SITE 1 AV2 9 TRP d 21 ARG d 24 ARG d 26 GLU e 7
SITE 2 AV2 9 PHE f 16 THR f 17 VAL f 18 THR x 33
SITE 3 AV2 9 VAL x 36
SITE 1 AV3 15 GLU b 184 GLY b 189 GLY b 197 HIS b 201
SITE 2 AV3 15 ALA b 204 VAL b 208 PHE b 247 CLA b 605
SITE 3 AV3 15 CLA b 606 DGD b 624 VAL d 154 PHE h 38
SITE 4 AV3 15 PHE h 41 ILE h 45 TYR h 49
SITE 1 AV4 6 DGD B 625 LMT B 627 MET i 1 THR i 3
SITE 2 AV4 6 LEU i 4 LMT i 102
SITE 1 AV5 5 THR i 3 ILE i 6 THR i 7 ILE i 10
SITE 2 AV5 5 LMG i 101
SITE 1 AV6 3 PL9 a 409 LMG e 101 BCR f 102
SITE 1 AV7 8 SQD a 415 DGD c 516 LHG c 519 LMG c 522
SITE 2 AV7 8 BCR g 101 PHE j 29 TYR j 30 TYR j 33
SITE 1 AV8 2 ASP k 19 ASP k 23
SITE 1 AV9 7 CLA B 613 VAL L 10 GLN M 28 GLN M 32
SITE 2 AV9 7 VAL m 27 GLU m 30 SER m 31
SITE 1 AW1 2 GLU o 140 HIS o 257
SITE 1 AW2 14 ALA v 62 CYS v 63 CYS v 66 HIS v 67
SITE 2 AW2 14 THR v 74 LEU v 78 ASP v 79 THR v 84
SITE 3 AW2 14 LEU v 85 TYR v 101 MET v 102 TYR v 108
SITE 4 AW2 14 HIS v 118 PRO v 119
SITE 1 AW3 13 BCR c 513 ILE g 28 GLY g 29 GLY g 32
SITE 2 AW3 13 ALA j 14 THR j 15 BCR j 102 ILE k 28
SITE 3 AW3 13 LEU k 31 ALA k 34 PHE k 37 VAL k 38
SITE 4 AW3 13 VAL z 13
SITE 1 AW4 10 CLA b 605 CLA b 612 CLA b 613 PHE h 34
SITE 2 AW4 10 MET h 35 LEU h 37 PHE h 38 PHE h 41
SITE 3 AW4 10 THR x 11 LEU x 16
SEQRES 1 A 344 MET THR THR THR LEU GLN ARG ARG GLU SER ALA ASN LEU
SEQRES 2 A 344 TRP GLU ARG PHE CYS ASN TRP VAL THR SER THR ASP ASN
SEQRES 3 A 344 ARG LEU TYR VAL GLY TRP PHE GLY VAL ILE MET ILE PRO
SEQRES 4 A 344 THR LEU LEU ALA ALA THR ILE CYS PHE VAL ILE ALA PHE
SEQRES 5 A 344 ILE ALA ALA PRO PRO VAL ASP ILE ASP GLY ILE ARG GLU
SEQRES 6 A 344 PRO VAL SER GLY SER LEU LEU TYR GLY ASN ASN ILE ILE
SEQRES 7 A 344 THR GLY ALA VAL VAL PRO SER SER ASN ALA ILE GLY LEU
SEQRES 8 A 344 HIS PHE TYR PRO ILE TRP GLU ALA ALA SER LEU ASP GLU
SEQRES 9 A 344 TRP LEU TYR ASN GLY GLY PRO TYR GLN LEU ILE ILE PHE
SEQRES 10 A 344 HIS PHE LEU LEU GLY ALA SER CYS TYR MET GLY ARG GLN
SEQRES 11 A 344 TRP GLU LEU SER TYR ARG LEU GLY MET ARG PRO TRP ILE
SEQRES 12 A 344 CYS VAL ALA TYR SER ALA PRO LEU ALA SER ALA PHE ALA
SEQRES 13 A 344 VAL PHE LEU ILE TYR PRO ILE GLY GLN GLY SER PHE SER
SEQRES 14 A 344 ASP GLY MET PRO LEU GLY ILE SER GLY THR PHE ASN PHE
SEQRES 15 A 344 MET ILE VAL PHE GLN ALA GLU HIS ASN ILE LEU MET HIS
SEQRES 16 A 344 PRO PHE HIS GLN LEU GLY VAL ALA GLY VAL PHE GLY GLY
SEQRES 17 A 344 ALA LEU PHE CYS ALA MET HIS GLY SER LEU VAL THR SER
SEQRES 18 A 344 SER LEU ILE ARG GLU THR THR GLU THR GLU SER ALA ASN
SEQRES 19 A 344 TYR GLY TYR LYS PHE GLY GLN GLU GLU GLU THR TYR ASN
SEQRES 20 A 344 ILE VAL ALA ALA HIS GLY TYR PHE GLY ARG LEU ILE PHE
SEQRES 21 A 344 GLN TYR ALA SER PHE ASN ASN SER ARG SER LEU HIS PHE
SEQRES 22 A 344 PHE LEU ALA ALA TRP PRO VAL VAL GLY VAL TRP PHE THR
SEQRES 23 A 344 ALA LEU GLY ILE SER THR MET ALA PHE ASN LEU ASN GLY
SEQRES 24 A 344 PHE ASN PHE ASN HIS SER VAL ILE ASP ALA LYS GLY ASN
SEQRES 25 A 344 VAL ILE ASN THR TRP ALA ASP ILE ILE ASN ARG ALA ASN
SEQRES 26 A 344 LEU GLY MET GLU VAL MET HIS GLU ARG ASN ALA HIS ASN
SEQRES 27 A 344 PHE PRO LEU ASP LEU ALA
SEQRES 1 B 510 MET GLY LEU PRO TRP TYR ARG VAL HIS THR VAL LEU ILE
SEQRES 2 B 510 ASN ASP PRO GLY ARG LEU ILE ALA ALA HIS LEU MET HIS
SEQRES 3 B 510 THR ALA LEU VAL ALA GLY TRP ALA GLY SER MET ALA LEU
SEQRES 4 B 510 TYR GLU LEU ALA THR PHE ASP PRO SER ASP PRO VAL LEU
SEQRES 5 B 510 ASN PRO MET TRP ARG GLN GLY MET PHE VAL LEU PRO PHE
SEQRES 6 B 510 MET ALA ARG LEU GLY VAL THR GLY SER TRP SER GLY TRP
SEQRES 7 B 510 SER ILE THR GLY GLU THR GLY ILE ASP PRO GLY PHE TRP
SEQRES 8 B 510 SER PHE GLU GLY VAL ALA LEU ALA HIS ILE VAL LEU SER
SEQRES 9 B 510 GLY LEU LEU PHE LEU ALA ALA CYS TRP HIS TRP VAL TYR
SEQRES 10 B 510 TRP ASP LEU GLU LEU PHE ARG ASP PRO ARG THR GLY GLU
SEQRES 11 B 510 PRO ALA LEU ASP LEU PRO LYS MET PHE GLY ILE HIS LEU
SEQRES 12 B 510 PHE LEU ALA GLY LEU LEU CYS PHE GLY PHE GLY ALA PHE
SEQRES 13 B 510 HIS LEU THR GLY LEU PHE GLY PRO GLY MET TRP VAL SER
SEQRES 14 B 510 ASP PRO TYR GLY LEU THR GLY SER VAL GLN PRO VAL ALA
SEQRES 15 B 510 PRO GLU TRP GLY PRO ASP GLY PHE ASN PRO TYR ASN PRO
SEQRES 16 B 510 GLY GLY VAL VAL ALA HIS HIS ILE ALA ALA GLY ILE VAL
SEQRES 17 B 510 GLY ILE ILE ALA GLY LEU PHE HIS ILE LEU VAL ARG PRO
SEQRES 18 B 510 PRO GLN ARG LEU TYR LYS ALA LEU ARG MET GLY ASN ILE
SEQRES 19 B 510 GLU THR VAL LEU SER SER SER ILE ALA ALA VAL PHE PHE
SEQRES 20 B 510 ALA ALA PHE VAL VAL ALA GLY THR MET TRP TYR GLY SER
SEQRES 21 B 510 ALA THR THR PRO ILE GLU LEU PHE GLY PRO THR ARG TYR
SEQRES 22 B 510 GLN TRP ASP SER SER TYR PHE GLN GLN GLU ILE ASN ARG
SEQRES 23 B 510 ARG VAL GLN ALA SER LEU ALA SER GLY ALA THR LEU GLU
SEQRES 24 B 510 GLU ALA TRP SER ALA ILE PRO GLU LYS LEU ALA PHE TYR
SEQRES 25 B 510 ASP TYR ILE GLY ASN ASN PRO ALA LYS GLY GLY LEU PHE
SEQRES 26 B 510 ARG THR GLY PRO MET ASN LYS GLY ASP GLY ILE ALA GLN
SEQRES 27 B 510 ALA TRP LYS GLY HIS ALA VAL PHE ARG ASN LYS GLU GLY
SEQRES 28 B 510 GLU GLU LEU PHE VAL ARG ARG MET PRO ALA PHE PHE GLU
SEQRES 29 B 510 SER PHE PRO VAL ILE LEU THR ASP LYS ASN GLY VAL VAL
SEQRES 30 B 510 LYS ALA ASP ILE PRO PHE ARG ARG ALA GLU SER LYS TYR
SEQRES 31 B 510 SER PHE GLU GLN GLN GLY VAL THR VAL SER PHE TYR GLY
SEQRES 32 B 510 GLY GLU LEU ASN GLY GLN THR PHE THR ASP PRO PRO THR
SEQRES 33 B 510 VAL LYS SER TYR ALA ARG LYS ALA ILE PHE GLY GLU ILE
SEQRES 34 B 510 PHE GLU PHE ASP THR GLU THR LEU ASN SER ASP GLY ILE
SEQRES 35 B 510 PHE ARG THR SER PRO ARG GLY TRP PHE THR PHE ALA HIS
SEQRES 36 B 510 ALA VAL PHE ALA LEU LEU PHE PHE PHE GLY HIS ILE TRP
SEQRES 37 B 510 HIS GLY ALA ARG THR LEU PHE ARG ASP VAL PHE SER GLY
SEQRES 38 B 510 ILE ASP PRO GLU LEU SER PRO GLU GLN VAL GLU TRP GLY
SEQRES 39 B 510 PHE TYR GLN LYS VAL GLY ASP VAL THR THR ARG ARG LYS
SEQRES 40 B 510 GLU ALA VAL
SEQRES 1 C 461 MET VAL THR LEU SER SER ASN SER ILE PHE ALA THR ASN
SEQRES 2 C 461 ARG ASP GLN GLU SER SER GLY PHE ALA TRP TRP ALA GLY
SEQRES 3 C 461 ASN ALA ARG LEU ILE ASN LEU SER GLY LYS LEU LEU GLY
SEQRES 4 C 461 ALA HIS VAL ALA HIS ALA GLY LEU ILE VAL PHE TRP ALA
SEQRES 5 C 461 GLY ALA MET THR LEU PHE GLU LEU ALA HIS PHE ILE PRO
SEQRES 6 C 461 GLU LYS PRO MET TYR GLU GLN GLY LEU ILE LEU ILE PRO
SEQRES 7 C 461 HIS ILE ALA THR LEU GLY TRP GLY VAL GLY PRO GLY GLY
SEQRES 8 C 461 GLU VAL VAL ASP THR PHE PRO PHE PHE VAL VAL GLY VAL
SEQRES 9 C 461 VAL HIS LEU ILE SER SER ALA VAL LEU GLY PHE GLY GLY
SEQRES 10 C 461 VAL TYR HIS ALA ILE ARG GLY PRO GLU THR LEU GLU GLU
SEQRES 11 C 461 TYR SER SER PHE PHE GLY TYR ASP TRP LYS ASP LYS ASN
SEQRES 12 C 461 LYS MET THR THR ILE LEU GLY PHE HIS LEU ILE VAL LEU
SEQRES 13 C 461 GLY ILE GLY ALA LEU LEU LEU VAL ALA LYS ALA MET PHE
SEQRES 14 C 461 PHE GLY GLY LEU TYR ASP THR TRP ALA PRO GLY GLY GLY
SEQRES 15 C 461 ASP VAL ARG VAL ILE THR ASN PRO THR LEU ASP PRO ARG
SEQRES 16 C 461 VAL ILE PHE GLY TYR LEU LEU LYS SER PRO PHE GLY GLY
SEQRES 17 C 461 GLU GLY TRP ILE VAL SER VAL ASN ASN LEU GLU ASP VAL
SEQRES 18 C 461 VAL GLY GLY HIS ILE TRP ILE GLY LEU ILE CYS ILE ALA
SEQRES 19 C 461 GLY GLY ILE TRP HIS ILE LEU THR THR PRO PHE GLY TRP
SEQRES 20 C 461 ALA ARG ARG ALA PHE ILE TRP SER GLY GLU ALA TYR LEU
SEQRES 21 C 461 SER TYR SER LEU GLY ALA LEU SER MET MET GLY PHE ILE
SEQRES 22 C 461 ALA THR CYS PHE VAL TRP PHE ASN ASN THR VAL TYR PRO
SEQRES 23 C 461 SER GLU PHE TYR GLY PRO THR GLY PRO GLU ALA SER GLN
SEQRES 24 C 461 ALA GLN ALA MET THR PHE LEU ILE ARG ASP GLN LYS LEU
SEQRES 25 C 461 GLY ALA ASN VAL GLY SER ALA GLN GLY PRO THR GLY LEU
SEQRES 26 C 461 GLY LYS TYR LEU MET ARG SER PRO THR GLY GLU ILE ILE
SEQRES 27 C 461 PHE GLY GLY GLU THR MET ARG PHE TRP ASP PHE ARG GLY
SEQRES 28 C 461 PRO TRP LEU GLU PRO LEU ARG GLY PRO ASN GLY LEU ASP
SEQRES 29 C 461 LEU ASN LYS ILE LYS ASN ASP ILE GLN PRO TRP GLN GLU
SEQRES 30 C 461 ARG ARG ALA ALA GLU TYR MET THR HIS ALA PRO LEU GLY
SEQRES 31 C 461 SER LEU ASN SER VAL GLY GLY VAL ALA THR GLU ILE ASN
SEQRES 32 C 461 SER VAL ASN PHE VAL SER PRO ARG SER TRP LEU ALA THR
SEQRES 33 C 461 SER HIS PHE VAL LEU ALA PHE PHE PHE LEU VAL GLY HIS
SEQRES 34 C 461 LEU TRP HIS ALA GLY ARG ALA ARG ALA ALA ALA ALA GLY
SEQRES 35 C 461 PHE GLU LYS GLY ILE ASP ARG GLU SER GLU PRO VAL LEU
SEQRES 36 C 461 SER MET PRO SER LEU ASP
SEQRES 1 D 352 MET THR ILE ALA ILE GLY ARG ALA PRO ALA GLU ARG GLY
SEQRES 2 D 352 TRP PHE ASP ILE LEU ASP ASP TRP LEU LYS ARG ASP ARG
SEQRES 3 D 352 PHE VAL PHE VAL GLY TRP SER GLY ILE LEU LEU PHE PRO
SEQRES 4 D 352 CYS ALA TYR LEU ALA LEU GLY GLY TRP LEU THR GLY THR
SEQRES 5 D 352 THR PHE VAL THR SER TRP TYR THR HIS GLY LEU ALA SER
SEQRES 6 D 352 SER TYR LEU GLU GLY CYS ASN PHE LEU THR VAL ALA VAL
SEQRES 7 D 352 SER THR PRO ALA ASN SER MET GLY HIS SER LEU LEU LEU
SEQRES 8 D 352 LEU TRP GLY PRO GLU ALA GLN GLY ASP PHE THR ARG TRP
SEQRES 9 D 352 CYS GLN LEU GLY GLY LEU TRP THR PHE ILE ALA LEU HIS
SEQRES 10 D 352 GLY ALA PHE GLY LEU ILE GLY PHE MET LEU ARG GLN PHE
SEQRES 11 D 352 GLU ILE ALA ARG LEU VAL GLY VAL ARG PRO TYR ASN ALA
SEQRES 12 D 352 ILE ALA PHE SER ALA PRO ILE ALA VAL PHE VAL SER VAL
SEQRES 13 D 352 PHE LEU ILE TYR PRO LEU GLY GLN SER SER TRP PHE PHE
SEQRES 14 D 352 ALA PRO SER PHE GLY VAL ALA ALA ILE PHE ARG PHE LEU
SEQRES 15 D 352 LEU PHE PHE GLN GLY PHE HIS ASN TRP THR LEU ASN PRO
SEQRES 16 D 352 PHE HIS MET MET GLY VAL ALA GLY VAL LEU GLY GLY ALA
SEQRES 17 D 352 LEU LEU CYS ALA ILE HIS GLY ALA THR VAL GLU ASN THR
SEQRES 18 D 352 LEU PHE GLN ASP GLY GLU GLY ALA SER THR PHE ARG ALA
SEQRES 19 D 352 PHE ASN PRO THR GLN ALA GLU GLU THR TYR SER MET VAL
SEQRES 20 D 352 THR ALA ASN ARG PHE TRP SER GLN ILE PHE GLY ILE ALA
SEQRES 21 D 352 PHE SER ASN LYS ARG TRP LEU HIS PHE PHE MET LEU PHE
SEQRES 22 D 352 VAL PRO VAL THR GLY LEU TRP MET SER ALA ILE GLY VAL
SEQRES 23 D 352 VAL GLY LEU ALA LEU ASN LEU ARG SER TYR ASP PHE ILE
SEQRES 24 D 352 SER GLN GLU ILE ARG ALA ALA GLU ASP PRO GLU PHE GLU
SEQRES 25 D 352 THR PHE TYR THR LYS ASN LEU LEU LEU ASN GLU GLY ILE
SEQRES 26 D 352 ARG ALA TRP MET ALA PRO GLN ASP GLN PRO HIS GLU ASN
SEQRES 27 D 352 PHE VAL PHE PRO GLU GLU VAL LEU PRO ARG GLY ASN ALA
SEQRES 28 D 352 LEU
SEQRES 1 E 84 MET ALA GLY THR THR GLY GLU ARG PRO PHE SER ASP ILE
SEQRES 2 E 84 ILE THR SER VAL ARG TYR TRP VAL ILE HIS SER ILE THR
SEQRES 3 E 84 ILE PRO ALA LEU PHE ILE ALA GLY TRP LEU PHE VAL SER
SEQRES 4 E 84 THR GLY LEU ALA TYR ASP VAL PHE GLY THR PRO ARG PRO
SEQRES 5 E 84 ASP SER TYR TYR ALA GLN GLU GLN ARG SER ILE PRO LEU
SEQRES 6 E 84 VAL THR ASP ARG PHE GLU ALA LYS GLN GLN VAL GLU THR
SEQRES 7 E 84 PHE LEU GLU GLN LEU LYS
SEQRES 1 F 45 MET THR SER ASN THR PRO ASN GLN GLU PRO VAL SER TYR
SEQRES 2 F 45 PRO ILE PHE THR VAL ARG TRP VAL ALA VAL HIS THR LEU
SEQRES 3 F 45 ALA VAL PRO THR ILE PHE PHE LEU GLY ALA ILE ALA ALA
SEQRES 4 F 45 MET GLN PHE ILE GLN ARG
SEQRES 1 H 66 MET ALA ARG ARG THR TRP LEU GLY ASP ILE LEU ARG PRO
SEQRES 2 H 66 LEU ASN SER GLU TYR GLY LYS VAL ALA PRO GLY TRP GLY
SEQRES 3 H 66 THR THR PRO LEU MET ALA VAL PHE MET GLY LEU PHE LEU
SEQRES 4 H 66 VAL PHE LEU LEU ILE ILE LEU GLU ILE TYR ASN SER THR
SEQRES 5 H 66 LEU ILE LEU ASP GLY VAL ASN VAL SER TRP LYS ALA LEU
SEQRES 6 H 66 GLY
SEQRES 1 I 38 MET GLU THR LEU LYS ILE THR VAL TYR ILE VAL VAL THR
SEQRES 2 I 38 PHE PHE VAL LEU LEU PHE VAL PHE GLY PHE LEU SER GLY
SEQRES 3 I 38 ASP PRO ALA ARG ASN PRO LYS ARG LYS ASP LEU GLU
SEQRES 1 J 40 MET MET SER GLU GLY GLY ARG ILE PRO LEU TRP ILE VAL
SEQRES 2 J 40 ALA THR VAL ALA GLY MET GLY VAL ILE VAL ILE VAL GLY
SEQRES 3 J 40 LEU PHE PHE TYR GLY ALA TYR ALA GLY LEU GLY SER SER
SEQRES 4 J 40 LEU
SEQRES 1 K 46 MET ILE ASP ALA LEU VAL LEU VAL ALA LYS LEU PRO GLU
SEQRES 2 K 46 ALA TYR ALA ILE PHE ASP PRO LEU VAL ASP VAL LEU PRO
SEQRES 3 K 46 VAL ILE PRO VAL LEU PHE LEU ALA LEU ALA PHE VAL TRP
SEQRES 4 K 46 GLN ALA ALA VAL GLY PHE ARG
SEQRES 1 L 37 MET GLU PRO ASN PRO ASN ARG GLN PRO VAL GLU LEU ASN
SEQRES 2 L 37 ARG THR SER LEU TYR LEU GLY LEU LEU LEU ILE LEU VAL
SEQRES 3 L 37 LEU ALA LEU LEU PHE SER SER TYR PHE PHE ASN
SEQRES 1 M 36 MET GLU VAL ASN GLN LEU GLY LEU ILE ALA THR ALA LEU
SEQRES 2 M 36 PHE VAL LEU VAL PRO SER VAL PHE LEU ILE ILE LEU TYR
SEQRES 3 M 36 VAL GLN THR GLU SER GLN GLN LYS SER SER
SEQRES 1 O 272 MET LYS TYR ARG ILE LEU MET ALA THR LEU LEU ALA VAL
SEQRES 2 O 272 CYS LEU GLY ILE PHE SER LEU SER ALA PRO ALA PHE ALA
SEQRES 3 O 272 ALA LYS GLN THR LEU THR TYR ASP ASP ILE VAL GLY THR
SEQRES 4 O 272 GLY LEU ALA ASN LYS CYS PRO THR LEU ASP ASP THR ALA
SEQRES 5 O 272 ARG GLY ALA TYR PRO ILE ASP SER SER GLN THR TYR ARG
SEQRES 6 O 272 ILE ALA ARG LEU CYS LEU GLN PRO THR THR PHE LEU VAL
SEQRES 7 O 272 LYS GLU GLU PRO LYS ASN LYS ARG GLN GLU ALA GLU PHE
SEQRES 8 O 272 VAL PRO THR LYS LEU VAL THR ARG GLU THR THR SER LEU
SEQRES 9 O 272 ASP GLN ILE GLN GLY GLU LEU LYS VAL ASN SER ASP GLY
SEQRES 10 O 272 SER LEU THR PHE VAL GLU GLU ASP GLY ILE ASP PHE GLN
SEQRES 11 O 272 PRO VAL THR VAL GLN MET ALA GLY GLY GLU ARG ILE PRO
SEQRES 12 O 272 LEU LEU PHE THR VAL LYS ASN LEU VAL ALA SER THR GLN
SEQRES 13 O 272 PRO ASN VAL THR SER ILE THR THR SER THR ASP PHE LYS
SEQRES 14 O 272 GLY GLU PHE ASN VAL PRO SER TYR ARG THR ALA ASN PHE
SEQRES 15 O 272 LEU ASP PRO LYS GLY ARG GLY LEU ALA SER GLY TYR ASP
SEQRES 16 O 272 SER ALA ILE ALA LEU PRO GLN ALA LYS GLU GLU GLU LEU
SEQRES 17 O 272 ALA ARG ALA ASN VAL LYS ARG PHE SER LEU THR LYS GLY
SEQRES 18 O 272 GLN ILE SER LEU ASN VAL ALA LYS VAL ASP GLY ARG THR
SEQRES 19 O 272 GLY GLU ILE ALA GLY THR PHE GLU SER GLU GLN LEU SER
SEQRES 20 O 272 ASP ASP ASP MET GLY ALA HIS GLU PRO HIS GLU VAL LYS
SEQRES 21 O 272 ILE GLN GLY VAL PHE TYR ALA SER ILE GLU PRO ALA
SEQRES 1 T 32 MET GLU THR ILE THR TYR VAL PHE ILE PHE ALA CYS ILE
SEQRES 2 T 32 ILE ALA LEU PHE PHE PHE ALA ILE PHE PHE ARG GLU PRO
SEQRES 3 T 32 PRO ARG ILE THR LYS LYS
SEQRES 1 U 134 MET GLN ARG LEU GLY ARG TRP LEU ALA LEU ALA TYR PHE
SEQRES 2 U 134 VAL GLY VAL SER LEU LEU GLY TRP ILE ASN TRP SER ALA
SEQRES 3 U 134 PRO THR LEU ALA ALA THR ALA SER THR GLU GLU GLU LEU
SEQRES 4 U 134 VAL ASN VAL VAL ASP GLU LYS LEU GLY THR ALA TYR GLY
SEQRES 5 U 134 GLU LYS ILE ASP LEU ASN ASN THR ASN ILE ALA ALA PHE
SEQRES 6 U 134 ILE GLN TYR ARG GLY LEU TYR PRO THR LEU ALA LYS LEU
SEQRES 7 U 134 ILE VAL LYS ASN ALA PRO TYR GLU SER VAL GLU ASP VAL
SEQRES 8 U 134 LEU ASN ILE PRO GLY LEU THR GLU ARG GLN LYS GLN ILE
SEQRES 9 U 134 LEU ARG GLU ASN LEU GLU HIS PHE THR VAL THR GLU VAL
SEQRES 10 U 134 GLU THR ALA LEU VAL GLU GLY GLY ASP ARG TYR ASN ASN
SEQRES 11 U 134 GLY LEU TYR LYS
SEQRES 1 V 163 MET LEU LYS LYS CYS VAL TRP LEU ALA VAL ALA LEU CYS
SEQRES 2 V 163 LEU CYS LEU TRP GLN PHE THR MET GLY THR ALA LEU ALA
SEQRES 3 V 163 ALA GLU LEU THR PRO GLU VAL LEU THR VAL PRO LEU ASN
SEQRES 4 V 163 SER GLU GLY LYS THR ILE THR LEU THR GLU LYS GLN TYR
SEQRES 5 V 163 LEU GLU GLY LYS ARG LEU PHE GLN TYR ALA CYS ALA SER
SEQRES 6 V 163 CYS HIS VAL GLY GLY ILE THR LYS THR ASN PRO SER LEU
SEQRES 7 V 163 ASP LEU ARG THR GLU THR LEU ALA LEU ALA THR PRO PRO
SEQRES 8 V 163 ARG ASP ASN ILE GLU GLY LEU VAL ASP TYR MET LYS ASN
SEQRES 9 V 163 PRO THR THR TYR ASP GLY GLU GLN GLU ILE ALA GLU VAL
SEQRES 10 V 163 HIS PRO SER LEU ARG SER ALA ASP ILE PHE PRO LYS MET
SEQRES 11 V 163 ARG ASN LEU THR GLU LYS ASP LEU VAL ALA ILE ALA GLY
SEQRES 12 V 163 HIS ILE LEU VAL GLU PRO LYS ILE LEU GLY ASP LYS TRP
SEQRES 13 V 163 GLY GLY GLY LYS VAL TYR TYR
SEQRES 1 y 46 MET GLY ILE PHE ASN GLY ILE ILE GLU PHE LEU SER ASN
SEQRES 2 y 46 ILE ASN PHE GLU VAL ILE ALA GLN LEU THR MET ILE ALA
SEQRES 3 y 46 MET ILE GLY ILE ALA GLY PRO MET ILE ILE PHE LEU LEU
SEQRES 4 y 46 ALA VAL ARG ARG GLY ASN LEU
SEQRES 1 X 41 MET THR ILE THR PRO SER LEU LYS GLY PHE PHE ILE GLY
SEQRES 2 X 41 LEU LEU SER GLY ALA VAL VAL LEU GLY LEU THR PHE ALA
SEQRES 3 X 41 VAL LEU ILE ALA ILE SER GLN ILE ASP LYS VAL GLN ARG
SEQRES 4 X 41 SER LEU
SEQRES 1 Y 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 Y 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 3 Y 28 UNK UNK
SEQRES 1 Z 62 MET THR ILE LEU PHE GLN LEU ALA LEU ALA ALA LEU VAL
SEQRES 2 Z 62 ILE LEU SER PHE VAL MET VAL ILE GLY VAL PRO VAL ALA
SEQRES 3 Z 62 TYR ALA SER PRO GLN ASP TRP ASP ARG SER LYS GLN LEU
SEQRES 4 Z 62 ILE PHE LEU GLY SER GLY LEU TRP ILE ALA LEU VAL LEU
SEQRES 5 Z 62 VAL VAL GLY VAL LEU ASN PHE PHE VAL VAL
SEQRES 1 a 344 MET THR THR THR LEU GLN ARG ARG GLU SER ALA ASN LEU
SEQRES 2 a 344 TRP GLU ARG PHE CYS ASN TRP VAL THR SER THR ASP ASN
SEQRES 3 a 344 ARG LEU TYR VAL GLY TRP PHE GLY VAL ILE MET ILE PRO
SEQRES 4 a 344 THR LEU LEU ALA ALA THR ILE CYS PHE VAL ILE ALA PHE
SEQRES 5 a 344 ILE ALA ALA PRO PRO VAL ASP ILE ASP GLY ILE ARG GLU
SEQRES 6 a 344 PRO VAL SER GLY SER LEU LEU TYR GLY ASN ASN ILE ILE
SEQRES 7 a 344 THR GLY ALA VAL VAL PRO SER SER ASN ALA ILE GLY LEU
SEQRES 8 a 344 HIS PHE TYR PRO ILE TRP GLU ALA ALA SER LEU ASP GLU
SEQRES 9 a 344 TRP LEU TYR ASN GLY GLY PRO TYR GLN LEU ILE ILE PHE
SEQRES 10 a 344 HIS PHE LEU LEU GLY ALA SER CYS TYR MET GLY ARG GLN
SEQRES 11 a 344 TRP GLU LEU SER TYR ARG LEU GLY MET ARG PRO TRP ILE
SEQRES 12 a 344 CYS VAL ALA TYR SER ALA PRO LEU ALA SER ALA PHE ALA
SEQRES 13 a 344 VAL PHE LEU ILE TYR PRO ILE GLY GLN GLY SER PHE SER
SEQRES 14 a 344 ASP GLY MET PRO LEU GLY ILE SER GLY THR PHE ASN PHE
SEQRES 15 a 344 MET ILE VAL PHE GLN ALA GLU HIS ASN ILE LEU MET HIS
SEQRES 16 a 344 PRO PHE HIS GLN LEU GLY VAL ALA GLY VAL PHE GLY GLY
SEQRES 17 a 344 ALA LEU PHE CYS ALA MET HIS GLY SER LEU VAL THR SER
SEQRES 18 a 344 SER LEU ILE ARG GLU THR THR GLU THR GLU SER ALA ASN
SEQRES 19 a 344 TYR GLY TYR LYS PHE GLY GLN GLU GLU GLU THR TYR ASN
SEQRES 20 a 344 ILE VAL ALA ALA HIS GLY TYR PHE GLY ARG LEU ILE PHE
SEQRES 21 a 344 GLN TYR ALA SER PHE ASN ASN SER ARG SER LEU HIS PHE
SEQRES 22 a 344 PHE LEU ALA ALA TRP PRO VAL VAL GLY VAL TRP PHE THR
SEQRES 23 a 344 ALA LEU GLY ILE SER THR MET ALA PHE ASN LEU ASN GLY
SEQRES 24 a 344 PHE ASN PHE ASN HIS SER VAL ILE ASP ALA LYS GLY ASN
SEQRES 25 a 344 VAL ILE ASN THR TRP ALA ASP ILE ILE ASN ARG ALA ASN
SEQRES 26 a 344 LEU GLY MET GLU VAL MET HIS GLU ARG ASN ALA HIS ASN
SEQRES 27 a 344 PHE PRO LEU ASP LEU ALA
SEQRES 1 b 510 MET GLY LEU PRO TRP TYR ARG VAL HIS THR VAL LEU ILE
SEQRES 2 b 510 ASN ASP PRO GLY ARG LEU ILE ALA ALA HIS LEU MET HIS
SEQRES 3 b 510 THR ALA LEU VAL ALA GLY TRP ALA GLY SER MET ALA LEU
SEQRES 4 b 510 TYR GLU LEU ALA THR PHE ASP PRO SER ASP PRO VAL LEU
SEQRES 5 b 510 ASN PRO MET TRP ARG GLN GLY MET PHE VAL LEU PRO PHE
SEQRES 6 b 510 MET ALA ARG LEU GLY VAL THR GLY SER TRP SER GLY TRP
SEQRES 7 b 510 SER ILE THR GLY GLU THR GLY ILE ASP PRO GLY PHE TRP
SEQRES 8 b 510 SER PHE GLU GLY VAL ALA LEU ALA HIS ILE VAL LEU SER
SEQRES 9 b 510 GLY LEU LEU PHE LEU ALA ALA CYS TRP HIS TRP VAL TYR
SEQRES 10 b 510 TRP ASP LEU GLU LEU PHE ARG ASP PRO ARG THR GLY GLU
SEQRES 11 b 510 PRO ALA LEU ASP LEU PRO LYS MET PHE GLY ILE HIS LEU
SEQRES 12 b 510 PHE LEU ALA GLY LEU LEU CYS PHE GLY PHE GLY ALA PHE
SEQRES 13 b 510 HIS LEU THR GLY LEU PHE GLY PRO GLY MET TRP VAL SER
SEQRES 14 b 510 ASP PRO TYR GLY LEU THR GLY SER VAL GLN PRO VAL ALA
SEQRES 15 b 510 PRO GLU TRP GLY PRO ASP GLY PHE ASN PRO TYR ASN PRO
SEQRES 16 b 510 GLY GLY VAL VAL ALA HIS HIS ILE ALA ALA GLY ILE VAL
SEQRES 17 b 510 GLY ILE ILE ALA GLY LEU PHE HIS ILE LEU VAL ARG PRO
SEQRES 18 b 510 PRO GLN ARG LEU TYR LYS ALA LEU ARG MET GLY ASN ILE
SEQRES 19 b 510 GLU THR VAL LEU SER SER SER ILE ALA ALA VAL PHE PHE
SEQRES 20 b 510 ALA ALA PHE VAL VAL ALA GLY THR MET TRP TYR GLY SER
SEQRES 21 b 510 ALA THR THR PRO ILE GLU LEU PHE GLY PRO THR ARG TYR
SEQRES 22 b 510 GLN TRP ASP SER SER TYR PHE GLN GLN GLU ILE ASN ARG
SEQRES 23 b 510 ARG VAL GLN ALA SER LEU ALA SER GLY ALA THR LEU GLU
SEQRES 24 b 510 GLU ALA TRP SER ALA ILE PRO GLU LYS LEU ALA PHE TYR
SEQRES 25 b 510 ASP TYR ILE GLY ASN ASN PRO ALA LYS GLY GLY LEU PHE
SEQRES 26 b 510 ARG THR GLY PRO MET ASN LYS GLY ASP GLY ILE ALA GLN
SEQRES 27 b 510 ALA TRP LYS GLY HIS ALA VAL PHE ARG ASN LYS GLU GLY
SEQRES 28 b 510 GLU GLU LEU PHE VAL ARG ARG MET PRO ALA PHE PHE GLU
SEQRES 29 b 510 SER PHE PRO VAL ILE LEU THR ASP LYS ASN GLY VAL VAL
SEQRES 30 b 510 LYS ALA ASP ILE PRO PHE ARG ARG ALA GLU SER LYS TYR
SEQRES 31 b 510 SER PHE GLU GLN GLN GLY VAL THR VAL SER PHE TYR GLY
SEQRES 32 b 510 GLY GLU LEU ASN GLY GLN THR PHE THR ASP PRO PRO THR
SEQRES 33 b 510 VAL LYS SER TYR ALA ARG LYS ALA ILE PHE GLY GLU ILE
SEQRES 34 b 510 PHE GLU PHE ASP THR GLU THR LEU ASN SER ASP GLY ILE
SEQRES 35 b 510 PHE ARG THR SER PRO ARG GLY TRP PHE THR PHE ALA HIS
SEQRES 36 b 510 ALA VAL PHE ALA LEU LEU PHE PHE PHE GLY HIS ILE TRP
SEQRES 37 b 510 HIS GLY ALA ARG THR LEU PHE ARG ASP VAL PHE SER GLY
SEQRES 38 b 510 ILE ASP PRO GLU LEU SER PRO GLU GLN VAL GLU TRP GLY
SEQRES 39 b 510 PHE TYR GLN LYS VAL GLY ASP VAL THR THR ARG ARG LYS
SEQRES 40 b 510 GLU ALA VAL
SEQRES 1 c 461 MET VAL THR LEU SER SER ASN SER ILE PHE ALA THR ASN
SEQRES 2 c 461 ARG ASP GLN GLU SER SER GLY PHE ALA TRP TRP ALA GLY
SEQRES 3 c 461 ASN ALA ARG LEU ILE ASN LEU SER GLY LYS LEU LEU GLY
SEQRES 4 c 461 ALA HIS VAL ALA HIS ALA GLY LEU ILE VAL PHE TRP ALA
SEQRES 5 c 461 GLY ALA MET THR LEU PHE GLU LEU ALA HIS PHE ILE PRO
SEQRES 6 c 461 GLU LYS PRO MET TYR GLU GLN GLY LEU ILE LEU ILE PRO
SEQRES 7 c 461 HIS ILE ALA THR LEU GLY TRP GLY VAL GLY PRO GLY GLY
SEQRES 8 c 461 GLU VAL VAL ASP THR PHE PRO PHE PHE VAL VAL GLY VAL
SEQRES 9 c 461 VAL HIS LEU ILE SER SER ALA VAL LEU GLY PHE GLY GLY
SEQRES 10 c 461 VAL TYR HIS ALA ILE ARG GLY PRO GLU THR LEU GLU GLU
SEQRES 11 c 461 TYR SER SER PHE PHE GLY TYR ASP TRP LYS ASP LYS ASN
SEQRES 12 c 461 LYS MET THR THR ILE LEU GLY PHE HIS LEU ILE VAL LEU
SEQRES 13 c 461 GLY ILE GLY ALA LEU LEU LEU VAL ALA LYS ALA MET PHE
SEQRES 14 c 461 PHE GLY GLY LEU TYR ASP THR TRP ALA PRO GLY GLY GLY
SEQRES 15 c 461 ASP VAL ARG VAL ILE THR ASN PRO THR LEU ASP PRO ARG
SEQRES 16 c 461 VAL ILE PHE GLY TYR LEU LEU LYS SER PRO PHE GLY GLY
SEQRES 17 c 461 GLU GLY TRP ILE VAL SER VAL ASN ASN LEU GLU ASP VAL
SEQRES 18 c 461 VAL GLY GLY HIS ILE TRP ILE GLY LEU ILE CYS ILE ALA
SEQRES 19 c 461 GLY GLY ILE TRP HIS ILE LEU THR THR PRO PHE GLY TRP
SEQRES 20 c 461 ALA ARG ARG ALA PHE ILE TRP SER GLY GLU ALA TYR LEU
SEQRES 21 c 461 SER TYR SER LEU GLY ALA LEU SER MET MET GLY PHE ILE
SEQRES 22 c 461 ALA THR CYS PHE VAL TRP PHE ASN ASN THR VAL TYR PRO
SEQRES 23 c 461 SER GLU PHE TYR GLY PRO THR GLY PRO GLU ALA SER GLN
SEQRES 24 c 461 ALA GLN ALA MET THR PHE LEU ILE ARG ASP GLN LYS LEU
SEQRES 25 c 461 GLY ALA ASN VAL GLY SER ALA GLN GLY PRO THR GLY LEU
SEQRES 26 c 461 GLY LYS TYR LEU MET ARG SER PRO THR GLY GLU ILE ILE
SEQRES 27 c 461 PHE GLY GLY GLU THR MET ARG PHE TRP ASP PHE ARG GLY
SEQRES 28 c 461 PRO TRP LEU GLU PRO LEU ARG GLY PRO ASN GLY LEU ASP
SEQRES 29 c 461 LEU ASN LYS ILE LYS ASN ASP ILE GLN PRO TRP GLN GLU
SEQRES 30 c 461 ARG ARG ALA ALA GLU TYR MET THR HIS ALA PRO LEU GLY
SEQRES 31 c 461 SER LEU ASN SER VAL GLY GLY VAL ALA THR GLU ILE ASN
SEQRES 32 c 461 SER VAL ASN PHE VAL SER PRO ARG SER TRP LEU ALA THR
SEQRES 33 c 461 SER HIS PHE VAL LEU ALA PHE PHE PHE LEU VAL GLY HIS
SEQRES 34 c 461 LEU TRP HIS ALA GLY ARG ALA ARG ALA ALA ALA ALA GLY
SEQRES 35 c 461 PHE GLU LYS GLY ILE ASP ARG GLU SER GLU PRO VAL LEU
SEQRES 36 c 461 SER MET PRO SER LEU ASP
SEQRES 1 d 352 MET THR ILE ALA ILE GLY ARG ALA PRO ALA GLU ARG GLY
SEQRES 2 d 352 TRP PHE ASP ILE LEU ASP ASP TRP LEU LYS ARG ASP ARG
SEQRES 3 d 352 PHE VAL PHE VAL GLY TRP SER GLY ILE LEU LEU PHE PRO
SEQRES 4 d 352 CYS ALA TYR LEU ALA LEU GLY GLY TRP LEU THR GLY THR
SEQRES 5 d 352 THR PHE VAL THR SER TRP TYR THR HIS GLY LEU ALA SER
SEQRES 6 d 352 SER TYR LEU GLU GLY CYS ASN PHE LEU THR VAL ALA VAL
SEQRES 7 d 352 SER THR PRO ALA ASN SER MET GLY HIS SER LEU LEU LEU
SEQRES 8 d 352 LEU TRP GLY PRO GLU ALA GLN GLY ASP PHE THR ARG TRP
SEQRES 9 d 352 CYS GLN LEU GLY GLY LEU TRP THR PHE ILE ALA LEU HIS
SEQRES 10 d 352 GLY ALA PHE GLY LEU ILE GLY PHE MET LEU ARG GLN PHE
SEQRES 11 d 352 GLU ILE ALA ARG LEU VAL GLY VAL ARG PRO TYR ASN ALA
SEQRES 12 d 352 ILE ALA PHE SER ALA PRO ILE ALA VAL PHE VAL SER VAL
SEQRES 13 d 352 PHE LEU ILE TYR PRO LEU GLY GLN SER SER TRP PHE PHE
SEQRES 14 d 352 ALA PRO SER PHE GLY VAL ALA ALA ILE PHE ARG PHE LEU
SEQRES 15 d 352 LEU PHE PHE GLN GLY PHE HIS ASN TRP THR LEU ASN PRO
SEQRES 16 d 352 PHE HIS MET MET GLY VAL ALA GLY VAL LEU GLY GLY ALA
SEQRES 17 d 352 LEU LEU CYS ALA ILE HIS GLY ALA THR VAL GLU ASN THR
SEQRES 18 d 352 LEU PHE GLN ASP GLY GLU GLY ALA SER THR PHE ARG ALA
SEQRES 19 d 352 PHE ASN PRO THR GLN ALA GLU GLU THR TYR SER MET VAL
SEQRES 20 d 352 THR ALA ASN ARG PHE TRP SER GLN ILE PHE GLY ILE ALA
SEQRES 21 d 352 PHE SER ASN LYS ARG TRP LEU HIS PHE PHE MET LEU PHE
SEQRES 22 d 352 VAL PRO VAL THR GLY LEU TRP MET SER ALA ILE GLY VAL
SEQRES 23 d 352 VAL GLY LEU ALA LEU ASN LEU ARG SER TYR ASP PHE ILE
SEQRES 24 d 352 SER GLN GLU ILE ARG ALA ALA GLU ASP PRO GLU PHE GLU
SEQRES 25 d 352 THR PHE TYR THR LYS ASN LEU LEU LEU ASN GLU GLY ILE
SEQRES 26 d 352 ARG ALA TRP MET ALA PRO GLN ASP GLN PRO HIS GLU ASN
SEQRES 27 d 352 PHE VAL PHE PRO GLU GLU VAL LEU PRO ARG GLY ASN ALA
SEQRES 28 d 352 LEU
SEQRES 1 e 84 MET ALA GLY THR THR GLY GLU ARG PRO PHE SER ASP ILE
SEQRES 2 e 84 ILE THR SER VAL ARG TYR TRP VAL ILE HIS SER ILE THR
SEQRES 3 e 84 ILE PRO ALA LEU PHE ILE ALA GLY TRP LEU PHE VAL SER
SEQRES 4 e 84 THR GLY LEU ALA TYR ASP VAL PHE GLY THR PRO ARG PRO
SEQRES 5 e 84 ASP SER TYR TYR ALA GLN GLU GLN ARG SER ILE PRO LEU
SEQRES 6 e 84 VAL THR ASP ARG PHE GLU ALA LYS GLN GLN VAL GLU THR
SEQRES 7 e 84 PHE LEU GLU GLN LEU LYS
SEQRES 1 f 45 MET THR SER ASN THR PRO ASN GLN GLU PRO VAL SER TYR
SEQRES 2 f 45 PRO ILE PHE THR VAL ARG TRP VAL ALA VAL HIS THR LEU
SEQRES 3 f 45 ALA VAL PRO THR ILE PHE PHE LEU GLY ALA ILE ALA ALA
SEQRES 4 f 45 MET GLN PHE ILE GLN ARG
SEQRES 1 h 66 MET ALA ARG ARG THR TRP LEU GLY ASP ILE LEU ARG PRO
SEQRES 2 h 66 LEU ASN SER GLU TYR GLY LYS VAL ALA PRO GLY TRP GLY
SEQRES 3 h 66 THR THR PRO LEU MET ALA VAL PHE MET GLY LEU PHE LEU
SEQRES 4 h 66 VAL PHE LEU LEU ILE ILE LEU GLU ILE TYR ASN SER THR
SEQRES 5 h 66 LEU ILE LEU ASP GLY VAL ASN VAL SER TRP LYS ALA LEU
SEQRES 6 h 66 GLY
SEQRES 1 i 38 MET GLU THR LEU LYS ILE THR VAL TYR ILE VAL VAL THR
SEQRES 2 i 38 PHE PHE VAL LEU LEU PHE VAL PHE GLY PHE LEU SER GLY
SEQRES 3 i 38 ASP PRO ALA ARG ASN PRO LYS ARG LYS ASP LEU GLU
SEQRES 1 j 40 MET MET SER GLU GLY GLY ARG ILE PRO LEU TRP ILE VAL
SEQRES 2 j 40 ALA THR VAL ALA GLY MET GLY VAL ILE VAL ILE VAL GLY
SEQRES 3 j 40 LEU PHE PHE TYR GLY ALA TYR ALA GLY LEU GLY SER SER
SEQRES 4 j 40 LEU
SEQRES 1 k 46 MET ILE ASP ALA LEU VAL LEU VAL ALA LYS LEU PRO GLU
SEQRES 2 k 46 ALA TYR ALA ILE PHE ASP PRO LEU VAL ASP VAL LEU PRO
SEQRES 3 k 46 VAL ILE PRO VAL LEU PHE LEU ALA LEU ALA PHE VAL TRP
SEQRES 4 k 46 GLN ALA ALA VAL GLY PHE ARG
SEQRES 1 l 37 MET GLU PRO ASN PRO ASN ARG GLN PRO VAL GLU LEU ASN
SEQRES 2 l 37 ARG THR SER LEU TYR LEU GLY LEU LEU LEU ILE LEU VAL
SEQRES 3 l 37 LEU ALA LEU LEU PHE SER SER TYR PHE PHE ASN
SEQRES 1 m 36 MET GLU VAL ASN GLN LEU GLY LEU ILE ALA THR ALA LEU
SEQRES 2 m 36 PHE VAL LEU VAL PRO SER VAL PHE LEU ILE ILE LEU TYR
SEQRES 3 m 36 VAL GLN THR GLU SER GLN GLN LYS SER SER
SEQRES 1 o 272 MET LYS TYR ARG ILE LEU MET ALA THR LEU LEU ALA VAL
SEQRES 2 o 272 CYS LEU GLY ILE PHE SER LEU SER ALA PRO ALA PHE ALA
SEQRES 3 o 272 ALA LYS GLN THR LEU THR TYR ASP ASP ILE VAL GLY THR
SEQRES 4 o 272 GLY LEU ALA ASN LYS CYS PRO THR LEU ASP ASP THR ALA
SEQRES 5 o 272 ARG GLY ALA TYR PRO ILE ASP SER SER GLN THR TYR ARG
SEQRES 6 o 272 ILE ALA ARG LEU CYS LEU GLN PRO THR THR PHE LEU VAL
SEQRES 7 o 272 LYS GLU GLU PRO LYS ASN LYS ARG GLN GLU ALA GLU PHE
SEQRES 8 o 272 VAL PRO THR LYS LEU VAL THR ARG GLU THR THR SER LEU
SEQRES 9 o 272 ASP GLN ILE GLN GLY GLU LEU LYS VAL ASN SER ASP GLY
SEQRES 10 o 272 SER LEU THR PHE VAL GLU GLU ASP GLY ILE ASP PHE GLN
SEQRES 11 o 272 PRO VAL THR VAL GLN MET ALA GLY GLY GLU ARG ILE PRO
SEQRES 12 o 272 LEU LEU PHE THR VAL LYS ASN LEU VAL ALA SER THR GLN
SEQRES 13 o 272 PRO ASN VAL THR SER ILE THR THR SER THR ASP PHE LYS
SEQRES 14 o 272 GLY GLU PHE ASN VAL PRO SER TYR ARG THR ALA ASN PHE
SEQRES 15 o 272 LEU ASP PRO LYS GLY ARG GLY LEU ALA SER GLY TYR ASP
SEQRES 16 o 272 SER ALA ILE ALA LEU PRO GLN ALA LYS GLU GLU GLU LEU
SEQRES 17 o 272 ALA ARG ALA ASN VAL LYS ARG PHE SER LEU THR LYS GLY
SEQRES 18 o 272 GLN ILE SER LEU ASN VAL ALA LYS VAL ASP GLY ARG THR
SEQRES 19 o 272 GLY GLU ILE ALA GLY THR PHE GLU SER GLU GLN LEU SER
SEQRES 20 o 272 ASP ASP ASP MET GLY ALA HIS GLU PRO HIS GLU VAL LYS
SEQRES 21 o 272 ILE GLN GLY VAL PHE TYR ALA SER ILE GLU PRO ALA
SEQRES 1 t 32 MET GLU THR ILE THR TYR VAL PHE ILE PHE ALA CYS ILE
SEQRES 2 t 32 ILE ALA LEU PHE PHE PHE ALA ILE PHE PHE ARG GLU PRO
SEQRES 3 t 32 PRO ARG ILE THR LYS LYS
SEQRES 1 u 134 MET GLN ARG LEU GLY ARG TRP LEU ALA LEU ALA TYR PHE
SEQRES 2 u 134 VAL GLY VAL SER LEU LEU GLY TRP ILE ASN TRP SER ALA
SEQRES 3 u 134 PRO THR LEU ALA ALA THR ALA SER THR GLU GLU GLU LEU
SEQRES 4 u 134 VAL ASN VAL VAL ASP GLU LYS LEU GLY THR ALA TYR GLY
SEQRES 5 u 134 GLU LYS ILE ASP LEU ASN ASN THR ASN ILE ALA ALA PHE
SEQRES 6 u 134 ILE GLN TYR ARG GLY LEU TYR PRO THR LEU ALA LYS LEU
SEQRES 7 u 134 ILE VAL LYS ASN ALA PRO TYR GLU SER VAL GLU ASP VAL
SEQRES 8 u 134 LEU ASN ILE PRO GLY LEU THR GLU ARG GLN LYS GLN ILE
SEQRES 9 u 134 LEU ARG GLU ASN LEU GLU HIS PHE THR VAL THR GLU VAL
SEQRES 10 u 134 GLU THR ALA LEU VAL GLU GLY GLY ASP ARG TYR ASN ASN
SEQRES 11 u 134 GLY LEU TYR LYS
SEQRES 1 v 163 MET LEU LYS LYS CYS VAL TRP LEU ALA VAL ALA LEU CYS
SEQRES 2 v 163 LEU CYS LEU TRP GLN PHE THR MET GLY THR ALA LEU ALA
SEQRES 3 v 163 ALA GLU LEU THR PRO GLU VAL LEU THR VAL PRO LEU ASN
SEQRES 4 v 163 SER GLU GLY LYS THR ILE THR LEU THR GLU LYS GLN TYR
SEQRES 5 v 163 LEU GLU GLY LYS ARG LEU PHE GLN TYR ALA CYS ALA SER
SEQRES 6 v 163 CYS HIS VAL GLY GLY ILE THR LYS THR ASN PRO SER LEU
SEQRES 7 v 163 ASP LEU ARG THR GLU THR LEU ALA LEU ALA THR PRO PRO
SEQRES 8 v 163 ARG ASP ASN ILE GLU GLY LEU VAL ASP TYR MET LYS ASN
SEQRES 9 v 163 PRO THR THR TYR ASP GLY GLU GLN GLU ILE ALA GLU VAL
SEQRES 10 v 163 HIS PRO SER LEU ARG SER ALA ASP ILE PHE PRO LYS MET
SEQRES 11 v 163 ARG ASN LEU THR GLU LYS ASP LEU VAL ALA ILE ALA GLY
SEQRES 12 v 163 HIS ILE LEU VAL GLU PRO LYS ILE LEU GLY ASP LYS TRP
SEQRES 13 v 163 GLY GLY GLY LYS VAL TYR TYR
SEQRES 1 g 46 MET GLY ILE PHE ASN GLY ILE ILE GLU PHE LEU SER ASN
SEQRES 2 g 46 ILE ASN PHE GLU VAL ILE ALA GLN LEU THR MET ILE ALA
SEQRES 3 g 46 MET ILE GLY ILE ALA GLY PRO MET ILE ILE PHE LEU LEU
SEQRES 4 g 46 ALA VAL ARG ARG GLY ASN LEU
SEQRES 1 x 41 MET THR ILE THR PRO SER LEU LYS GLY PHE PHE ILE GLY
SEQRES 2 x 41 LEU LEU SER GLY ALA VAL VAL LEU GLY LEU THR PHE ALA
SEQRES 3 x 41 VAL LEU ILE ALA ILE SER GLN ILE ASP LYS VAL GLN ARG
SEQRES 4 x 41 SER LEU
SEQRES 1 G 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 G 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 3 G 28 UNK UNK
SEQRES 1 z 62 MET THR ILE LEU PHE GLN LEU ALA LEU ALA ALA LEU VAL
SEQRES 2 z 62 ILE LEU SER PHE VAL MET VAL ILE GLY VAL PRO VAL ALA
SEQRES 3 z 62 TYR ALA SER PRO GLN ASP TRP ASP ARG SER LYS GLN LEU
SEQRES 4 z 62 ILE PHE LEU GLY SER GLY LEU TRP ILE ALA LEU VAL LEU
SEQRES 5 z 62 VAL VAL GLY VAL LEU ASN PHE PHE VAL VAL
ATOM 1 N SER A 10 -48.711 17.041 20.116 1.00174.72 N
ATOM 2 CA SER A 10 -48.038 18.049 19.305 1.00176.16 C
ATOM 3 C SER A 10 -48.413 19.458 19.757 1.00176.97 C
ATOM 4 O SER A 10 -49.583 19.844 19.698 1.00178.05 O
ATOM 5 CB SER A 10 -48.381 17.860 17.824 1.00175.02 C
ATOM 6 OG SER A 10 -47.651 18.761 17.009 1.00173.96 O
ATOM 7 N ALA A 11 -47.419 20.221 20.206 1.00175.99 N
ATOM 8 CA ALA A 11 -47.653 21.593 20.649 1.00175.17 C
ATOM 9 C ALA A 11 -48.147 22.466 19.496 1.00174.98 C
ATOM 10 O ALA A 11 -48.880 23.432 19.721 1.00174.91 O
ATOM 11 CB ALA A 11 -46.389 22.177 21.252 1.00173.70 C
ATOM 12 N ASN A 12 -47.762 22.066 18.280 1.00174.80 N
ATOM 13 CA ASN A 12 -48.141 22.660 16.990 1.00175.18 C
ATOM 14 C ASN A 12 -47.074 22.301 15.964 1.00175.05 C
ATOM 15 O ASN A 12 -45.932 22.746 16.082 1.00175.48 O
ATOM 16 CB ASN A 12 -48.295 24.185 17.049 1.00175.35 C
ATOM 17 CG ASN A 12 -48.707 24.782 15.714 1.00174.24 C
ATOM 18 OD1 ASN A 12 -48.091 25.730 15.222 1.00173.26 O
ATOM 19 ND2 ASN A 12 -49.751 24.220 15.115 1.00173.89 N
ATOM 20 N LEU A 13 -47.453 21.493 14.975 1.00174.70 N
ATOM 21 CA LEU A 13 -46.554 21.045 13.907 1.00174.26 C
ATOM 22 C LEU A 13 -45.613 22.134 13.385 1.00173.77 C
ATOM 23 O LEU A 13 -44.392 21.998 13.464 1.00173.79 O
ATOM 24 CB LEU A 13 -47.366 20.477 12.738 1.00174.32 C
ATOM 25 CG LEU A 13 -47.850 19.026 12.850 1.00175.41 C
ATOM 26 CD1 LEU A 13 -48.931 18.858 13.918 1.00174.91 C
ATOM 27 CD2 LEU A 13 -48.334 18.511 11.500 1.00175.33 C
ATOM 28 N TRP A 14 -46.190 23.203 12.845 1.00173.55 N
ATOM 29 CA TRP A 14 -45.410 24.326 12.332 1.00173.63 C
ATOM 30 C TRP A 14 -44.520 24.953 13.405 1.00173.49 C
ATOM 31 O TRP A 14 -43.370 25.299 13.139 1.00173.43 O
ATOM 32 CB TRP A 14 -46.338 25.388 11.737 1.00175.30 C
ATOM 33 CG TRP A 14 -45.641 26.664 11.371 1.00175.85 C
ATOM 34 CD1 TRP A 14 -45.590 27.814 12.108 1.00175.96 C
ATOM 35 CD2 TRP A 14 -44.890 26.919 10.180 1.00175.34 C
ATOM 36 NE1 TRP A 14 -44.859 28.770 11.444 1.00174.91 N
ATOM 37 CE2 TRP A 14 -44.416 28.244 10.256 1.00174.47 C
ATOM 38 CE3 TRP A 14 -44.572 26.156 9.051 1.00175.24 C
ATOM 39 CZ2 TRP A 14 -43.644 28.822 9.254 1.00174.35 C
ATOM 40 CZ3 TRP A 14 -43.805 26.731 8.056 1.00175.50 C
ATOM 41 CH2 TRP A 14 -43.350 28.051 8.163 1.00175.04 C
ATOM 42 N GLU A 15 -45.056 25.097 14.614 1.00173.55 N
ATOM 43 CA GLU A 15 -44.293 25.640 15.735 1.00174.02 C
ATOM 44 C GLU A 15 -43.103 24.746 16.073 1.00174.12 C
ATOM 45 O GLU A 15 -42.018 25.236 16.387 1.00173.83 O
ATOM 46 CB GLU A 15 -45.191 25.810 16.963 1.00174.57 C
ATOM 47 CG GLU A 15 -44.494 26.380 18.186 1.00174.59 C
ATOM 48 CD GLU A 15 -45.236 26.075 19.475 1.00174.44 C
ATOM 49 OE1 GLU A 15 -45.319 24.887 19.849 1.00173.28 O
ATOM 50 OE2 GLU A 15 -45.741 27.024 20.112 1.00175.10 O
ATOM 51 N ARG A 16 -43.313 23.436 15.999 1.00174.61 N
ATOM 52 CA ARG A 16 -42.240 22.469 16.213 1.00174.68 C
ATOM 53 C ARG A 16 -41.223 22.532 15.078 1.00174.75 C
ATOM 54 O ARG A 16 -40.016 22.536 15.318 1.00174.79 O
ATOM 55 CB ARG A 16 -42.802 21.050 16.335 1.00174.82 C
ATOM 56 CG ARG A 16 -43.811 20.861 17.455 1.00174.56 C
ATOM 57 CD ARG A 16 -44.308 19.428 17.486 1.00174.55 C
ATOM 58 NE ARG A 16 -43.204 18.476 17.565 1.00175.51 N
ATOM 59 CZ ARG A 16 -43.338 17.165 17.397 1.00176.31 C
ATOM 60 NH1 ARG A 16 -44.532 16.647 17.140 1.00176.53 N
ATOM 61 NH2 ARG A 16 -42.279 16.371 17.487 1.00176.19 N
ATOM 62 N PHE A 17 -41.727 22.555 13.847 1.00174.93 N
ATOM 63 CA PHE A 17 -40.893 22.711 12.657 1.00174.98 C
ATOM 64 C PHE A 17 -39.934 23.891 12.781 1.00174.25 C
ATOM 65 O PHE A 17 -38.729 23.748 12.578 1.00173.85 O
ATOM 66 CB PHE A 17 -41.769 22.882 11.413 1.00174.96 C
ATOM 67 CG PHE A 17 -40.999 22.890 10.123 1.00175.59 C
ATOM 68 CD1 PHE A 17 -40.729 21.706 9.459 1.00176.08 C
ATOM 69 CD2 PHE A 17 -40.550 24.080 9.572 1.00175.03 C
ATOM 70 CE1 PHE A 17 -40.018 21.706 8.274 1.00176.01 C
ATOM 71 CE2 PHE A 17 -39.840 24.087 8.387 1.00175.76 C
ATOM 72 CZ PHE A 17 -39.574 22.898 7.737 1.00176.22 C
ATOM 73 N CYS A 18 -40.483 25.056 13.111 1.00174.12 N
ATOM 74 CA CYS A 18 -39.684 26.260 13.298 1.00174.16 C
ATOM 75 C CYS A 18 -38.672 26.083 14.424 1.00174.42 C
ATOM 76 O CYS A 18 -37.591 26.667 14.395 1.00174.19 O
ATOM 77 CB CYS A 18 -40.587 27.460 13.587 1.00173.77 C
ATOM 78 SG CYS A 18 -41.673 27.914 12.221 1.00172.54 S
ATOM 79 N ASN A 19 -39.029 25.269 15.412 1.00174.60 N
ATOM 80 CA ASN A 19 -38.147 25.010 16.542 1.00174.85 C
ATOM 81 C ASN A 19 -37.013 24.056 16.179 1.00174.91 C
ATOM 82 O ASN A 19 -35.918 24.149 16.733 1.00175.13 O
ATOM 83 CB ASN A 19 -38.943 24.452 17.723 1.00174.65 C
ATOM 84 CG ASN A 19 -39.648 25.535 18.514 1.00174.49 C
ATOM 85 OD1 ASN A 19 -39.314 25.791 19.670 1.00176.00 O
ATOM 86 ND2 ASN A 19 -40.626 26.182 17.893 1.00173.56 N
ATOM 87 N TRP A 20 -37.275 23.141 15.252 1.00175.05 N
ATOM 88 CA TRP A 20 -36.242 22.215 14.793 1.00175.48 C
ATOM 89 C TRP A 20 -35.233 22.913 13.894 1.00175.18 C
ATOM 90 O TRP A 20 -34.025 22.746 14.058 1.00175.74 O
ATOM 91 CB TRP A 20 -36.847 21.031 14.042 1.00175.74 C
ATOM 92 CG TRP A 20 -35.800 20.267 13.293 1.00175.79 C
ATOM 93 CD1 TRP A 20 -34.851 19.444 13.823 1.00174.70 C
ATOM 94 CD2 TRP A 20 -35.576 20.280 11.876 1.00175.51 C
ATOM 95 NE1 TRP A 20 -34.054 18.937 12.825 1.00174.69 N
ATOM 96 CE2 TRP A 20 -34.479 19.433 11.621 1.00175.11 C
ATOM 97 CE3 TRP A 20 -36.198 20.920 10.800 1.00174.42 C
ATOM 98 CZ2 TRP A 20 -33.992 19.209 10.335 1.00174.15 C
ATOM 99 CZ3 TRP A 20 -35.714 20.696 9.523 1.00173.10 C
ATOM 100 CH2 TRP A 20 -34.621 19.848 9.302 1.00173.25 C
ATOM 101 N VAL A 21 -35.742 23.663 12.922 1.00174.34 N
ATOM 102 CA VAL A 21 -34.903 24.471 12.047 1.00174.13 C
ATOM 103 C VAL A 21 -33.970 25.363 12.863 1.00174.06 C
ATOM 104 O VAL A 21 -32.750 25.260 12.762 1.00174.36 O
ATOM 105 CB VAL A 21 -35.750 25.341 11.103 1.00173.99 C
ATOM 106 CG1 VAL A 21 -34.862 26.298 10.329 1.00174.07 C
ATOM 107 CG2 VAL A 21 -36.537 24.463 10.148 1.00173.47 C
ATOM 108 N THR A 22 -34.555 26.224 13.688 1.00173.47 N
ATOM 109 CA THR A 22 -33.788 27.176 14.483 1.00173.68 C
ATOM 110 C THR A 22 -32.939 26.519 15.576 1.00174.02 C
ATOM 111 O THR A 22 -32.101 27.181 16.188 1.00174.09 O
ATOM 112 CB THR A 22 -34.715 28.210 15.149 1.00174.06 C
ATOM 113 OG1 THR A 22 -33.972 29.395 15.458 1.00174.89 O
ATOM 114 CG2 THR A 22 -35.313 27.639 16.428 1.00174.02 C
ATOM 115 N SER A 23 -33.164 25.230 15.824 1.00174.17 N
ATOM 116 CA SER A 23 -32.484 24.517 16.907 1.00174.08 C
ATOM 117 C SER A 23 -30.961 24.604 16.823 1.00173.57 C
ATOM 118 O SER A 23 -30.372 24.417 15.758 1.00173.79 O
ATOM 119 CB SER A 23 -32.905 23.045 16.926 1.00174.25 C
ATOM 120 OG SER A 23 -32.092 22.290 17.807 1.00173.90 O
ATOM 121 N THR A 24 -30.338 24.891 17.960 1.00172.97 N
ATOM 122 CA THR A 24 -28.888 24.993 18.044 1.00172.58 C
ATOM 123 C THR A 24 -28.281 23.664 18.476 1.00172.82 C
ATOM 124 O THR A 24 -27.097 23.588 18.799 1.00171.80 O
ATOM 125 CB THR A 24 -28.458 26.084 19.033 1.00172.23 C
ATOM 126 OG1 THR A 24 -28.718 25.642 20.370 1.00172.57 O
ATOM 127 CG2 THR A 24 -29.226 27.366 18.770 1.00172.86 C
ATOM 128 N ASP A 25 -29.103 22.620 18.481 1.00173.67 N
ATOM 129 CA ASP A 25 -28.662 21.306 18.932 1.00174.22 C
ATOM 130 C ASP A 25 -28.459 20.373 17.746 1.00174.24 C
ATOM 131 O ASP A 25 -28.272 19.168 17.914 1.00174.46 O
ATOM 132 CB ASP A 25 -29.673 20.702 19.911 1.00174.18 C
ATOM 133 CG ASP A 25 -29.816 21.518 21.182 1.00173.76 C
ATOM 134 OD1 ASP A 25 -28.815 22.121 21.624 1.00174.20 O
ATOM 135 OD2 ASP A 25 -30.930 21.549 21.745 1.00171.96 O
ATOM 136 N ASN A 26 -28.494 20.940 16.546 1.00174.47 N
ATOM 137 CA ASN A 26 -28.242 20.179 15.332 1.00175.32 C
ATOM 138 C ASN A 26 -26.748 20.120 15.038 1.00174.77 C
ATOM 139 O ASN A 26 -26.035 21.107 15.226 1.00174.82 O
ATOM 140 CB ASN A 26 -28.994 20.791 14.147 1.00175.17 C
ATOM 141 CG ASN A 26 -30.497 20.583 14.234 1.00174.26 C
ATOM 142 OD1 ASN A 26 -30.967 19.514 14.625 1.00174.04 O
ATOM 143 ND2 ASN A 26 -31.257 21.605 13.860 1.00173.69 N
ATOM 144 N ARG A 27 -26.275 18.957 14.597 1.00173.85 N
ATOM 145 CA ARG A 27 -24.875 18.784 14.221 1.00173.22 C
ATOM 146 C ARG A 27 -24.444 19.835 13.200 1.00173.60 C
ATOM 147 O ARG A 27 -23.366 20.417 13.307 1.00173.39 O
ATOM 148 CB ARG A 27 -24.641 17.382 13.662 1.00173.13 C
ATOM 149 CG ARG A 27 -23.206 17.124 13.256 1.00173.81 C
ATOM 150 CD ARG A 27 -22.274 17.247 14.449 1.00174.40 C
ATOM 151 NE ARG A 27 -20.868 17.246 14.055 1.00174.65 N
ATOM 152 CZ ARG A 27 -20.250 18.273 13.483 1.00174.54 C
ATOM 153 NH1 ARG A 27 -20.908 19.400 13.245 1.00174.11 N
ATOM 154 NH2 ARG A 27 -18.968 18.178 13.156 1.00175.26 N
ATOM 155 N LEU A 28 -25.299 20.064 12.210 1.00173.80 N
ATOM 156 CA LEU A 28 -25.115 21.156 11.263 1.00172.90 C
ATOM 157 C LEU A 28 -26.309 22.093 11.369 1.00172.79 C
ATOM 158 O LEU A 28 -27.450 21.670 11.198 1.00172.81 O
ATOM 159 CB LEU A 28 -24.967 20.627 9.836 1.00172.86 C
ATOM 160 CG LEU A 28 -23.769 19.714 9.571 1.00172.97 C
ATOM 161 CD1 LEU A 28 -23.859 19.099 8.183 1.00173.83 C
ATOM 162 CD2 LEU A 28 -22.461 20.472 9.744 1.00172.64 C
ATOM 163 N TYR A 29 -26.052 23.364 11.657 1.00172.55 N
ATOM 164 CA TYR A 29 -27.140 24.305 11.873 1.00172.43 C
ATOM 165 C TYR A 29 -27.861 24.664 10.579 1.00172.99 C
ATOM 166 O TYR A 29 -27.497 25.624 9.903 1.00173.38 O
ATOM 167 CB TYR A 29 -26.631 25.582 12.543 1.00172.94 C
ATOM 168 CG TYR A 29 -27.729 26.595 12.770 1.00173.75 C
ATOM 169 CD1 TYR A 29 -28.817 26.294 13.577 1.00173.99 C
ATOM 170 CD2 TYR A 29 -27.687 27.845 12.164 1.00174.41 C
ATOM 171 CE1 TYR A 29 -29.829 27.211 13.784 1.00174.63 C
ATOM 172 CE2 TYR A 29 -28.697 28.770 12.365 1.00174.38 C
ATOM 173 CZ TYR A 29 -29.764 28.446 13.175 1.00174.59 C
ATOM 174 OH TYR A 29 -30.771 29.361 13.379 1.00174.86 O
ATOM 175 N VAL A 30 -28.882 23.889 10.235 1.00172.87 N
ATOM 176 CA VAL A 30 -29.764 24.258 9.138 1.00173.15 C
ATOM 177 C VAL A 30 -30.667 25.404 9.594 1.00173.28 C
ATOM 178 O VAL A 30 -31.604 25.202 10.360 1.00173.97 O
ATOM 179 CB VAL A 30 -30.610 23.049 8.653 1.00173.69 C
ATOM 180 CG1 VAL A 30 -31.111 22.219 9.834 1.00173.69 C
ATOM 181 CG2 VAL A 30 -31.761 23.505 7.758 1.00173.55 C
ATOM 182 N GLY A 31 -30.373 26.615 9.138 1.00172.53 N
ATOM 183 CA GLY A 31 -31.126 27.771 9.582 1.00172.52 C
ATOM 184 C GLY A 31 -32.277 28.082 8.651 1.00172.79 C
ATOM 185 O GLY A 31 -32.686 27.236 7.860 1.00173.14 O
ATOM 186 N TRP A 32 -32.803 29.298 8.741 1.00173.43 N
ATOM 187 CA TRP A 32 -33.868 29.724 7.844 1.00174.30 C
ATOM 188 C TRP A 32 -33.273 30.039 6.482 1.00174.21 C
ATOM 189 O TRP A 32 -33.885 29.783 5.443 1.00173.98 O
ATOM 190 CB TRP A 32 -34.609 30.936 8.406 1.00174.67 C
ATOM 191 CG TRP A 32 -35.662 30.590 9.421 1.00175.04 C
ATOM 192 CD1 TRP A 32 -35.823 31.154 10.656 1.00175.11 C
ATOM 193 CD2 TRP A 32 -36.706 29.615 9.290 1.00175.19 C
ATOM 194 NE1 TRP A 32 -36.894 30.589 11.300 1.00175.14 N
ATOM 195 CE2 TRP A 32 -37.455 29.642 10.485 1.00175.69 C
ATOM 196 CE3 TRP A 32 -37.081 28.720 8.281 1.00174.43 C
ATOM 197 CZ2 TRP A 32 -38.554 28.809 10.698 1.00175.96 C
ATOM 198 CZ3 TRP A 32 -38.172 27.894 8.495 1.00174.49 C
ATOM 199 CH2 TRP A 32 -38.895 27.945 9.692 1.00175.23 C
ATOM 200 N PHE A 33 -32.071 30.601 6.499 1.00173.93 N
ATOM 201 CA PHE A 33 -31.299 30.781 5.283 1.00173.97 C
ATOM 202 C PHE A 33 -30.888 29.413 4.749 1.00174.25 C
ATOM 203 O PHE A 33 -30.773 29.215 3.540 1.00174.63 O
ATOM 204 CB PHE A 33 -30.071 31.649 5.547 1.00173.72 C
ATOM 205 CG PHE A 33 -30.373 33.116 5.612 1.00174.23 C
ATOM 206 CD1 PHE A 33 -30.635 33.831 4.455 1.00174.60 C
ATOM 207 CD2 PHE A 33 -30.397 33.782 6.825 1.00173.68 C
ATOM 208 CE1 PHE A 33 -30.914 35.182 4.506 1.00174.03 C
ATOM 209 CE2 PHE A 33 -30.674 35.133 6.883 1.00173.71 C
ATOM 210 CZ PHE A 33 -30.933 35.833 5.720 1.00173.81 C
ATOM 211 N GLY A 34 -30.675 28.474 5.667 1.00174.06 N
ATOM 212 CA GLY A 34 -30.331 27.107 5.318 1.00174.20 C
ATOM 213 C GLY A 34 -31.403 26.411 4.503 1.00174.10 C
ATOM 214 O GLY A 34 -31.104 25.561 3.663 1.00174.05 O
ATOM 215 N VAL A 35 -32.658 26.769 4.761 1.00174.00 N
ATOM 216 CA VAL A 35 -33.795 26.201 4.044 1.00173.97 C
ATOM 217 C VAL A 35 -33.700 26.520 2.551 1.00174.24 C
ATOM 218 O VAL A 35 -34.196 25.771 1.708 1.00174.39 O
ATOM 219 CB VAL A 35 -35.134 26.728 4.611 1.00174.30 C
ATOM 220 CG1 VAL A 35 -36.316 26.132 3.863 1.00174.54 C
ATOM 221 CG2 VAL A 35 -35.241 26.401 6.089 1.00174.01 C
ATOM 222 N ILE A 36 -33.037 27.625 2.229 1.00174.04 N
ATOM 223 CA ILE A 36 -32.806 27.995 0.840 1.00173.61 C
ATOM 224 C ILE A 36 -31.418 27.534 0.399 1.00173.53 C
ATOM 225 O ILE A 36 -31.234 27.066 -0.725 1.00173.44 O
ATOM 226 CB ILE A 36 -32.939 29.516 0.631 1.00173.08 C
ATOM 227 CG1 ILE A 36 -34.357 29.977 0.971 1.00173.72 C
ATOM 228 CG2 ILE A 36 -32.566 29.902 -0.794 1.00173.24 C
ATOM 229 CD1 ILE A 36 -35.424 29.367 0.088 1.00174.63 C
ATOM 230 N MET A 37 -30.455 27.650 1.309 1.00173.90 N
ATOM 231 CA MET A 37 -29.063 27.307 1.026 1.00174.10 C
ATOM 232 C MET A 37 -28.877 25.845 0.632 1.00173.60 C
ATOM 233 O MET A 37 -28.429 25.547 -0.476 1.00173.82 O
ATOM 234 CB MET A 37 -28.186 27.610 2.240 1.00174.60 C
ATOM 235 CG MET A 37 -26.719 27.303 2.011 1.00174.26 C
ATOM 236 SD MET A 37 -25.703 27.488 3.486 1.00174.56 S
ATOM 237 CE MET A 37 -26.009 25.919 4.289 1.00174.54 C
ATOM 238 N ILE A 38 -29.206 24.945 1.553 1.00173.04 N
ATOM 239 CA ILE A 38 -29.007 23.510 1.361 1.00172.81 C
ATOM 240 C ILE A 38 -29.564 22.961 0.033 1.00173.07 C
ATOM 241 O ILE A 38 -28.869 22.208 -0.647 1.00172.88 O
ATOM 242 CB ILE A 38 -29.616 22.709 2.538 1.00173.18 C
ATOM 243 CG1 ILE A 38 -28.904 23.065 3.844 1.00173.76 C
ATOM 244 CG2 ILE A 38 -29.540 21.211 2.275 1.00173.56 C
ATOM 245 CD1 ILE A 38 -29.531 22.444 5.070 1.00174.77 C
ATOM 246 N PRO A 39 -30.802 23.334 -0.352 1.00173.31 N
ATOM 247 CA PRO A 39 -31.270 22.791 -1.633 1.00173.13 C
ATOM 248 C PRO A 39 -30.506 23.358 -2.823 1.00173.67 C
ATOM 249 O PRO A 39 -30.104 22.599 -3.707 1.00174.12 O
ATOM 250 CB PRO A 39 -32.739 23.225 -1.683 1.00172.89 C
ATOM 251 CG PRO A 39 -33.111 23.455 -0.266 1.00173.87 C
ATOM 252 CD PRO A 39 -31.884 24.052 0.343 1.00173.76 C
ATOM 253 N THR A 40 -30.316 24.673 -2.841 1.00174.26 N
ATOM 254 CA THR A 40 -29.599 25.336 -3.925 1.00174.58 C
ATOM 255 C THR A 40 -28.161 24.841 -4.062 1.00174.34 C
ATOM 256 O THR A 40 -27.680 24.629 -5.175 1.00173.85 O
ATOM 257 CB THR A 40 -29.581 26.865 -3.736 1.00174.36 C
ATOM 258 OG1 THR A 40 -29.079 27.182 -2.432 1.00174.48 O
ATOM 259 CG2 THR A 40 -30.980 27.436 -3.890 1.00174.41 C
ATOM 260 N LEU A 41 -27.473 24.661 -2.938 1.00174.21 N
ATOM 261 CA LEU A 41 -26.094 24.179 -2.978 1.00173.91 C
ATOM 262 C LEU A 41 -26.016 22.732 -3.449 1.00174.06 C
ATOM 263 O LEU A 41 -25.057 22.346 -4.115 1.00173.96 O
ATOM 264 CB LEU A 41 -25.421 24.311 -1.610 1.00172.56 C
ATOM 265 CG LEU A 41 -24.985 25.714 -1.185 1.00172.43 C
ATOM 266 CD1 LEU A 41 -24.246 25.660 0.141 1.00171.97 C
ATOM 267 CD2 LEU A 41 -24.126 26.363 -2.254 1.00173.55 C
ATOM 268 N LEU A 42 -27.021 21.933 -3.104 1.00174.14 N
ATOM 269 CA LEU A 42 -27.047 20.536 -3.522 1.00174.34 C
ATOM 270 C LEU A 42 -27.310 20.409 -5.019 1.00174.55 C
ATOM 271 O LEU A 42 -26.776 19.519 -5.675 1.00174.22 O
ATOM 272 CB LEU A 42 -28.101 19.751 -2.735 1.00173.98 C
ATOM 273 CG LEU A 42 -27.728 19.309 -1.318 1.00174.26 C
ATOM 274 CD1 LEU A 42 -28.764 18.338 -0.769 1.00174.28 C
ATOM 275 CD2 LEU A 42 -26.349 18.679 -1.300 1.00174.18 C
ATOM 276 N ALA A 43 -28.125 21.308 -5.557 1.00174.57 N
ATOM 277 CA ALA A 43 -28.405 21.317 -6.987 1.00173.41 C
ATOM 278 C ALA A 43 -27.165 21.740 -7.765 1.00172.90 C
ATOM 279 O ALA A 43 -26.816 21.136 -8.779 1.00172.59 O
ATOM 280 CB ALA A 43 -29.573 22.238 -7.296 1.00173.49 C
ATOM 281 N ALA A 44 -26.505 22.786 -7.277 1.00172.86 N
ATOM 282 CA ALA A 44 -25.290 23.302 -7.895 1.00173.31 C
ATOM 283 C ALA A 44 -24.179 22.255 -7.954 1.00173.63 C
ATOM 284 O ALA A 44 -23.615 22.007 -9.019 1.00174.36 O
ATOM 285 CB ALA A 44 -24.808 24.537 -7.147 1.00173.80 C
ATOM 286 N THR A 45 -23.865 21.648 -6.813 1.00173.17 N
ATOM 287 CA THR A 45 -22.760 20.695 -6.739 1.00173.05 C
ATOM 288 C THR A 45 -23.015 19.432 -7.570 1.00173.15 C
ATOM 289 O THR A 45 -22.114 18.956 -8.259 1.00173.24 O
ATOM 290 CB THR A 45 -22.438 20.301 -5.272 1.00173.27 C
ATOM 291 OG1 THR A 45 -21.312 19.414 -5.246 1.00173.73 O
ATOM 292 CG2 THR A 45 -23.622 19.630 -4.590 1.00173.93 C
ATOM 293 N ILE A 46 -24.232 18.894 -7.514 1.00172.91 N
ATOM 294 CA ILE A 46 -24.564 17.681 -8.256 1.00172.92 C
ATOM 295 C ILE A 46 -24.466 17.912 -9.758 1.00173.22 C
ATOM 296 O ILE A 46 -23.902 17.096 -10.486 1.00173.36 O
ATOM 297 CB ILE A 46 -25.977 17.171 -7.906 1.00172.83 C
ATOM 298 CG1 ILE A 46 -26.001 16.619 -6.480 1.00174.25 C
ATOM 299 CG2 ILE A 46 -26.412 16.081 -8.873 1.00173.11 C
ATOM 300 CD1 ILE A 46 -27.342 16.054 -6.071 1.00174.56 C
ATOM 301 N CYS A 47 -25.001 19.040 -10.214 1.00173.70 N
ATOM 302 CA CYS A 47 -24.946 19.393 -11.627 1.00174.46 C
ATOM 303 C CYS A 47 -23.502 19.605 -12.064 1.00174.38 C
ATOM 304 O CYS A 47 -23.102 19.174 -13.145 1.00173.77 O
ATOM 305 CB CYS A 47 -25.776 20.649 -11.905 1.00174.52 C
ATOM 306 SG CYS A 47 -25.846 21.125 -13.649 1.00173.57 S
ATOM 307 N PHE A 48 -22.727 20.267 -11.209 1.00174.54 N
ATOM 308 CA PHE A 48 -21.307 20.505 -11.454 1.00173.80 C
ATOM 309 C PHE A 48 -20.538 19.202 -11.643 1.00173.19 C
ATOM 310 O PHE A 48 -19.935 18.979 -12.692 1.00173.39 O
ATOM 311 CB PHE A 48 -20.694 21.310 -10.304 1.00173.36 C
ATOM 312 CG PHE A 48 -19.211 21.520 -10.431 1.00172.54 C
ATOM 313 CD1 PHE A 48 -18.707 22.499 -11.268 1.00172.87 C
ATOM 314 CD2 PHE A 48 -18.322 20.743 -9.706 1.00173.48 C
ATOM 315 CE1 PHE A 48 -17.344 22.695 -11.388 1.00173.37 C
ATOM 316 CE2 PHE A 48 -16.958 20.934 -9.822 1.00173.75 C
ATOM 317 CZ PHE A 48 -16.469 21.911 -10.663 1.00172.95 C
ATOM 318 N VAL A 49 -20.559 18.359 -10.615 1.00172.87 N
ATOM 319 CA VAL A 49 -19.869 17.071 -10.638 1.00173.07 C
ATOM 320 C VAL A 49 -20.190 16.258 -11.893 1.00172.78 C
ATOM 321 O VAL A 49 -19.293 15.696 -12.519 1.00172.77 O
ATOM 322 CB VAL A 49 -20.215 16.235 -9.386 1.00174.21 C
ATOM 323 CG1 VAL A 49 -19.679 14.817 -9.517 1.00175.47 C
ATOM 324 CG2 VAL A 49 -19.656 16.899 -8.140 1.00174.94 C
ATOM 325 N ILE A 50 -21.463 16.222 -12.271 1.00172.54 N
ATOM 326 CA ILE A 50 -21.880 15.470 -13.451 1.00172.54 C
ATOM 327 C ILE A 50 -21.349 16.136 -14.713 1.00172.88 C
ATOM 328 O ILE A 50 -20.826 15.468 -15.606 1.00173.43 O
ATOM 329 CB ILE A 50 -23.415 15.349 -13.539 1.00172.57 C
ATOM 330 CG1 ILE A 50 -23.953 14.520 -12.373 1.00173.56 C
ATOM 331 CG2 ILE A 50 -23.825 14.704 -14.851 1.00172.90 C
ATOM 332 CD1 ILE A 50 -25.462 14.440 -12.326 1.00173.40 C
ATOM 333 N ALA A 51 -21.483 17.456 -14.778 1.00172.62 N
ATOM 334 CA ALA A 51 -20.978 18.230 -15.906 1.00173.15 C
ATOM 335 C ALA A 51 -19.471 18.048 -16.086 1.00173.08 C
ATOM 336 O ALA A 51 -19.015 17.613 -17.142 1.00173.11 O
ATOM 337 CB ALA A 51 -21.314 19.702 -15.729 1.00173.76 C
ATOM 338 N PHE A 52 -18.709 18.385 -15.049 1.00173.32 N
ATOM 339 CA PHE A 52 -17.245 18.307 -15.073 1.00173.50 C
ATOM 340 C PHE A 52 -16.720 16.965 -15.581 1.00172.93 C
ATOM 341 O PHE A 52 -15.631 16.889 -16.150 1.00173.05 O
ATOM 342 CB PHE A 52 -16.687 18.581 -13.672 1.00173.93 C
ATOM 343 CG PHE A 52 -15.197 18.785 -13.638 1.00173.31 C
ATOM 344 CD1 PHE A 52 -14.655 20.043 -13.842 1.00173.68 C
ATOM 345 CD2 PHE A 52 -14.342 17.725 -13.387 1.00172.96 C
ATOM 346 CE1 PHE A 52 -13.288 20.237 -13.810 1.00173.86 C
ATOM 347 CE2 PHE A 52 -12.974 17.914 -13.352 1.00172.81 C
ATOM 348 CZ PHE A 52 -12.446 19.172 -13.563 1.00173.20 C
ATOM 349 N ILE A 53 -17.498 15.911 -15.369 1.00172.84 N
ATOM 350 CA ILE A 53 -17.092 14.574 -15.774 1.00173.17 C
ATOM 351 C ILE A 53 -17.599 14.178 -17.163 1.00173.73 C
ATOM 352 O ILE A 53 -16.825 13.697 -17.990 1.00173.84 O
ATOM 353 CB ILE A 53 -17.569 13.526 -14.751 1.00173.17 C
ATOM 354 CG1 ILE A 53 -16.939 13.804 -13.386 1.00172.80 C
ATOM 355 CG2 ILE A 53 -17.237 12.119 -15.228 1.00173.14 C
ATOM 356 CD1 ILE A 53 -17.151 12.702 -12.378 1.00173.18 C
ATOM 357 N ALA A 54 -18.885 14.392 -17.429 1.00174.00 N
ATOM 358 CA ALA A 54 -19.519 13.784 -18.601 1.00174.27 C
ATOM 359 C ALA A 54 -20.172 14.754 -19.592 1.00173.89 C
ATOM 360 O ALA A 54 -20.687 14.321 -20.624 1.00173.72 O
ATOM 361 CB ALA A 54 -20.554 12.763 -18.141 1.00174.93 C
ATOM 362 N ALA A 55 -20.166 16.050 -19.291 1.00173.87 N
ATOM 363 CA ALA A 55 -20.792 17.028 -20.185 1.00173.92 C
ATOM 364 C ALA A 55 -20.106 17.081 -21.548 1.00173.75 C
ATOM 365 O ALA A 55 -18.889 16.942 -21.642 1.00174.05 O
ATOM 366 CB ALA A 55 -20.795 18.408 -19.553 1.00174.18 C
ATOM 367 N PRO A 56 -20.893 17.285 -22.612 1.00173.45 N
ATOM 368 CA PRO A 56 -20.371 17.399 -23.973 1.00173.46 C
ATOM 369 C PRO A 56 -19.860 18.813 -24.263 1.00172.57 C
ATOM 370 O PRO A 56 -20.185 19.731 -23.510 1.00172.44 O
ATOM 371 CB PRO A 56 -21.593 17.060 -24.829 1.00173.94 C
ATOM 372 CG PRO A 56 -22.727 17.564 -24.029 1.00174.11 C
ATOM 373 CD PRO A 56 -22.366 17.264 -22.599 1.00173.75 C
ATOM 374 N PRO A 57 -19.062 18.981 -25.333 1.00172.07 N
ATOM 375 CA PRO A 57 -18.487 20.272 -25.722 1.00172.25 C
ATOM 376 C PRO A 57 -19.518 21.395 -25.814 1.00172.92 C
ATOM 377 O PRO A 57 -20.667 21.151 -26.181 1.00173.21 O
ATOM 378 CB PRO A 57 -17.885 19.974 -27.094 1.00173.42 C
ATOM 379 CG PRO A 57 -17.495 18.548 -27.003 1.00173.23 C
ATOM 380 CD PRO A 57 -18.609 17.904 -26.233 1.00172.58 C
ATOM 381 N VAL A 58 -19.105 22.611 -25.468 1.00173.08 N
ATOM 382 CA VAL A 58 -20.004 23.761 -25.456 1.00173.36 C
ATOM 383 C VAL A 58 -19.553 24.880 -26.396 1.00173.64 C
ATOM 384 O VAL A 58 -18.390 25.284 -26.382 1.00173.47 O
ATOM 385 CB VAL A 58 -20.141 24.334 -24.029 1.00173.37 C
ATOM 386 CG1 VAL A 58 -20.884 25.661 -24.047 1.00173.42 C
ATOM 387 CG2 VAL A 58 -20.828 23.333 -23.114 1.00174.27 C
ATOM 388 N ASP A 59 -20.483 25.375 -27.209 1.00174.07 N
ATOM 389 CA ASP A 59 -20.223 26.505 -28.094 1.00173.27 C
ATOM 390 C ASP A 59 -20.279 27.815 -27.313 1.00172.43 C
ATOM 391 O ASP A 59 -21.243 28.575 -27.416 1.00172.51 O
ATOM 392 CB ASP A 59 -21.227 26.523 -29.253 1.00173.85 C
ATOM 393 CG ASP A 59 -20.967 27.650 -30.238 1.00173.96 C
ATOM 394 OD1 ASP A 59 -19.787 27.979 -30.476 1.00173.69 O
ATOM 395 OD2 ASP A 59 -21.948 28.200 -30.783 1.00174.01 O
ATOM 396 N ILE A 60 -19.236 28.067 -26.529 1.00171.61 N
ATOM 397 CA ILE A 60 -19.168 29.238 -25.658 1.00172.38 C
ATOM 398 C ILE A 60 -19.301 30.577 -26.389 1.00172.45 C
ATOM 399 O ILE A 60 -20.061 31.445 -25.960 1.00172.78 O
ATOM 400 CB ILE A 60 -17.849 29.237 -24.846 1.00173.63 C
ATOM 401 CG1 ILE A 60 -17.712 30.532 -24.043 1.00174.27 C
ATOM 402 CG2 ILE A 60 -16.642 29.033 -25.752 1.00173.85 C
ATOM 403 CD1 ILE A 60 -16.632 30.479 -22.990 1.00175.63 C
ATOM 404 N ASP A 61 -18.581 30.741 -27.494 1.00172.79 N
ATOM 405 CA ASP A 61 -18.537 32.025 -28.185 1.00174.13 C
ATOM 406 C ASP A 61 -19.668 32.182 -29.201 1.00173.99 C
ATOM 407 O ASP A 61 -19.686 33.137 -29.978 1.00173.03 O
ATOM 408 CB ASP A 61 -17.181 32.201 -28.874 1.00175.25 C
ATOM 409 CG ASP A 61 -16.015 32.030 -27.916 1.00173.78 C
ATOM 410 OD1 ASP A 61 -16.161 32.398 -26.731 1.00172.18 O
ATOM 411 OD2 ASP A 61 -14.957 31.519 -28.344 1.00173.90 O
ATOM 412 N GLY A 62 -20.613 31.246 -29.185 1.00173.96 N
ATOM 413 CA GLY A 62 -21.758 31.297 -30.076 1.00173.78 C
ATOM 414 C GLY A 62 -21.416 31.261 -31.555 1.00172.87 C
ATOM 415 O GLY A 62 -22.248 31.592 -32.398 1.00172.57 O
ATOM 416 N ILE A 63 -20.192 30.856 -31.873 1.00172.59 N
ATOM 417 CA ILE A 63 -19.734 30.837 -33.255 1.00172.92 C
ATOM 418 C ILE A 63 -19.654 29.413 -33.800 1.00173.15 C
ATOM 419 O ILE A 63 -18.880 29.134 -34.717 1.00174.15 O
ATOM 420 CB ILE A 63 -18.356 31.509 -33.396 1.00173.65 C
ATOM 421 CG1 ILE A 63 -17.329 30.820 -32.496 1.00173.87 C
ATOM 422 CG2 ILE A 63 -18.450 32.985 -33.048 1.00173.14 C
ATOM 423 CD1 ILE A 63 -15.897 31.217 -32.789 1.00174.42 C
ATOM 424 N ARG A 64 -20.473 28.526 -33.235 1.00172.59 N
ATOM 425 CA ARG A 64 -20.505 27.112 -33.611 1.00172.70 C
ATOM 426 C ARG A 64 -19.113 26.489 -33.563 1.00172.60 C
ATOM 427 O ARG A 64 -18.659 25.876 -34.527 1.00171.78 O
ATOM 428 CB ARG A 64 -21.115 26.937 -35.003 1.00172.87 C
ATOM 429 CG ARG A 64 -22.387 27.740 -35.230 1.00174.24 C
ATOM 430 CD ARG A 64 -23.424 27.470 -34.150 1.00173.19 C
ATOM 431 NE ARG A 64 -24.595 28.336 -34.277 1.00173.77 N
ATOM 432 CZ ARG A 64 -25.548 28.185 -35.192 1.00174.23 C
ATOM 433 NH1 ARG A 64 -25.485 27.190 -36.066 1.00174.23 N
ATOM 434 NH2 ARG A 64 -26.571 29.027 -35.228 1.00174.63 N
ATOM 435 N GLU A 65 -18.446 26.655 -32.426 1.00173.08 N
ATOM 436 CA GLU A 65 -17.098 26.135 -32.233 1.00172.84 C
ATOM 437 C GLU A 65 -16.977 25.537 -30.834 1.00173.69 C
ATOM 438 O GLU A 65 -16.338 26.119 -29.961 1.00174.60 O
ATOM 439 CB GLU A 65 -16.059 27.240 -32.444 1.00172.77 C
ATOM 440 CG GLU A 65 -14.613 26.757 -32.480 1.00173.32 C
ATOM 441 CD GLU A 65 -13.618 27.903 -32.510 1.00174.46 C
ATOM 442 OE1 GLU A 65 -13.691 28.731 -33.442 1.00176.03 O
ATOM 443 OE2 GLU A 65 -12.756 27.973 -31.610 1.00173.69 O
ATOM 444 N PRO A 66 -17.616 24.374 -30.619 1.00173.85 N
ATOM 445 CA PRO A 66 -17.727 23.695 -29.324 1.00173.99 C
ATOM 446 C PRO A 66 -16.398 23.491 -28.600 1.00173.57 C
ATOM 447 O PRO A 66 -15.435 23.007 -29.195 1.00172.80 O
ATOM 448 CB PRO A 66 -18.342 22.343 -29.706 1.00173.94 C
ATOM 449 CG PRO A 66 -19.130 22.641 -30.926 1.00173.65 C
ATOM 450 CD PRO A 66 -18.252 23.585 -31.687 1.00174.03 C
ATOM 451 N VAL A 67 -16.361 23.865 -27.325 1.00173.56 N
ATOM 452 CA VAL A 67 -15.184 23.658 -26.492 1.00173.48 C
ATOM 453 C VAL A 67 -15.450 22.592 -25.435 1.00173.63 C
ATOM 454 O VAL A 67 -16.260 22.792 -24.529 1.00173.92 O
ATOM 455 CB VAL A 67 -14.742 24.960 -25.795 1.00173.16 C
ATOM 456 CG1 VAL A 67 -13.526 24.701 -24.919 1.00172.96 C
ATOM 457 CG2 VAL A 67 -14.442 26.037 -26.822 1.00174.06 C
ATOM 458 N SER A 68 -14.771 21.458 -25.561 1.00173.44 N
ATOM 459 CA SER A 68 -14.915 20.371 -24.600 1.00172.97 C
ATOM 460 C SER A 68 -14.100 20.661 -23.346 1.00173.17 C
ATOM 461 O SER A 68 -12.926 21.021 -23.433 1.00173.32 O
ATOM 462 CB SER A 68 -14.481 19.040 -25.218 1.00173.32 C
ATOM 463 OG SER A 68 -13.070 18.931 -25.261 1.00174.49 O
ATOM 464 N GLY A 69 -14.724 20.511 -22.182 1.00173.16 N
ATOM 465 CA GLY A 69 -14.045 20.758 -20.923 1.00173.34 C
ATOM 466 C GLY A 69 -14.298 19.694 -19.871 1.00173.57 C
ATOM 467 O GLY A 69 -14.049 19.916 -18.686 1.00174.20 O
ATOM 468 N SER A 70 -14.786 18.534 -20.297 1.00173.91 N
ATOM 469 CA SER A 70 -15.094 17.461 -19.357 1.00173.99 C
ATOM 470 C SER A 70 -14.095 16.311 -19.445 1.00173.51 C
ATOM 471 O SER A 70 -13.478 16.087 -20.487 1.00173.37 O
ATOM 472 CB SER A 70 -16.511 16.935 -19.594 1.00173.93 C
ATOM 473 OG SER A 70 -16.552 16.048 -20.696 1.00173.52 O
ATOM 474 N LEU A 71 -13.950 15.590 -18.337 1.00173.50 N
ATOM 475 CA LEU A 71 -13.011 14.477 -18.223 1.00173.64 C
ATOM 476 C LEU A 71 -13.203 13.428 -19.314 1.00173.36 C
ATOM 477 O LEU A 71 -12.265 13.096 -20.039 1.00173.06 O
ATOM 478 CB LEU A 71 -13.142 13.820 -16.848 1.00173.92 C
ATOM 479 CG LEU A 71 -12.955 14.746 -15.646 1.00173.61 C
ATOM 480 CD1 LEU A 71 -13.066 13.962 -14.350 1.00174.35 C
ATOM 481 CD2 LEU A 71 -11.620 15.470 -15.734 1.00173.67 C
ATOM 482 N LEU A 72 -14.423 12.910 -19.421 1.00173.19 N
ATOM 483 CA LEU A 72 -14.747 11.878 -20.401 1.00172.73 C
ATOM 484 C LEU A 72 -14.535 12.333 -21.840 1.00173.21 C
ATOM 485 O LEU A 72 -14.491 11.511 -22.754 1.00173.46 O
ATOM 486 CB LEU A 72 -16.196 11.418 -20.226 1.00172.81 C
ATOM 487 CG LEU A 72 -16.497 10.532 -19.018 1.00172.97 C
ATOM 488 CD1 LEU A 72 -17.975 10.174 -18.975 1.00172.35 C
ATOM 489 CD2 LEU A 72 -15.640 9.280 -19.064 1.00174.08 C
ATOM 490 N TYR A 73 -14.395 13.640 -22.044 1.00173.66 N
ATOM 491 CA TYR A 73 -14.216 14.174 -23.387 1.00174.10 C
ATOM 492 C TYR A 73 -12.806 14.721 -23.603 1.00174.30 C
ATOM 493 O TYR A 73 -12.623 15.741 -24.267 1.00174.04 O
ATOM 494 CB TYR A 73 -15.257 15.262 -23.672 1.00173.89 C
ATOM 495 CG TYR A 73 -16.633 14.721 -24.011 1.00173.65 C
ATOM 496 CD1 TYR A 73 -17.437 14.147 -23.033 1.00173.41 C
ATOM 497 CD2 TYR A 73 -17.124 14.775 -25.309 1.00173.43 C
ATOM 498 CE1 TYR A 73 -18.692 13.648 -23.336 1.00172.72 C
ATOM 499 CE2 TYR A 73 -18.378 14.278 -25.622 1.00172.99 C
ATOM 500 CZ TYR A 73 -19.156 13.716 -24.632 1.00172.04 C
ATOM 501 OH TYR A 73 -20.403 13.222 -24.941 1.00170.26 O
ATOM 502 N GLY A 74 -11.812 14.040 -23.038 1.00174.59 N
ATOM 503 CA GLY A 74 -10.419 14.347 -23.315 1.00174.45 C
ATOM 504 C GLY A 74 -9.715 15.301 -22.366 1.00174.00 C
ATOM 505 O GLY A 74 -8.595 15.730 -22.640 1.00174.22 O
ATOM 506 N ASN A 75 -10.361 15.644 -21.256 1.00173.59 N
ATOM 507 CA ASN A 75 -9.762 16.568 -20.297 1.00173.14 C
ATOM 508 C ASN A 75 -9.236 15.898 -19.033 1.00173.16 C
ATOM 509 O ASN A 75 -9.610 14.772 -18.708 1.00173.20 O
ATOM 510 CB ASN A 75 -10.768 17.650 -19.906 1.00172.68 C
ATOM 511 CG ASN A 75 -10.940 18.697 -20.981 1.00172.86 C
ATOM 512 OD1 ASN A 75 -10.283 19.737 -20.962 1.00172.62 O
ATOM 513 ND2 ASN A 75 -11.828 18.429 -21.930 1.00173.81 N
ATOM 514 N ASN A 76 -8.358 16.607 -18.332 1.00172.99 N
ATOM 515 CA ASN A 76 -7.931 16.217 -16.996 1.00172.84 C
ATOM 516 C ASN A 76 -8.311 17.314 -16.005 1.00173.03 C
ATOM 517 O ASN A 76 -8.851 18.344 -16.403 1.00173.56 O
ATOM 518 CB ASN A 76 -6.425 15.928 -16.958 1.00172.48 C
ATOM 519 CG ASN A 76 -5.582 17.098 -17.442 1.00172.59 C
ATOM 520 OD1 ASN A 76 -6.012 18.250 -17.408 1.00172.57 O
ATOM 521 ND2 ASN A 76 -4.371 16.801 -17.899 1.00172.38 N
ATOM 522 N ILE A 77 -8.039 17.085 -14.724 1.00173.09 N
ATOM 523 CA ILE A 77 -8.372 18.039 -13.668 1.00173.05 C
ATOM 524 C ILE A 77 -7.906 19.466 -13.968 1.00172.44 C
ATOM 525 O ILE A 77 -8.654 20.425 -13.779 1.00172.69 O
ATOM 526 CB ILE A 77 -7.768 17.603 -12.322 1.00174.46 C
ATOM 527 CG1 ILE A 77 -8.201 16.177 -11.980 1.00174.56 C
ATOM 528 CG2 ILE A 77 -8.185 18.559 -11.214 1.00174.84 C
ATOM 529 CD1 ILE A 77 -9.684 16.037 -11.732 1.00173.96 C
ATOM 530 N ILE A 78 -6.671 19.599 -14.438 1.00171.97 N
ATOM 531 CA ILE A 78 -6.087 20.913 -14.685 1.00172.82 C
ATOM 532 C ILE A 78 -6.716 21.627 -15.885 1.00173.55 C
ATOM 533 O ILE A 78 -6.958 22.832 -15.840 1.00174.04 O
ATOM 534 CB ILE A 78 -4.565 20.807 -14.902 1.00173.44 C
ATOM 535 CG1 ILE A 78 -3.911 20.096 -13.717 1.00172.64 C
ATOM 536 CG2 ILE A 78 -3.952 22.185 -15.088 1.00174.57 C
ATOM 537 CD1 ILE A 78 -4.116 20.804 -12.397 1.00172.57 C
ATOM 538 N THR A 79 -6.992 20.884 -16.951 1.00173.33 N
ATOM 539 CA THR A 79 -7.564 21.482 -18.154 1.00173.40 C
ATOM 540 C THR A 79 -9.086 21.544 -18.100 1.00172.96 C
ATOM 541 O THR A 79 -9.690 22.519 -18.547 1.00173.28 O
ATOM 542 CB THR A 79 -7.149 20.712 -19.420 1.00173.72 C
ATOM 543 OG1 THR A 79 -7.756 19.414 -19.410 1.00173.06 O
ATOM 544 CG2 THR A 79 -5.637 20.563 -19.480 1.00174.41 C
ATOM 545 N GLY A 80 -9.695 20.497 -17.555 1.00173.11 N
ATOM 546 CA GLY A 80 -11.141 20.397 -17.466 1.00173.49 C
ATOM 547 C GLY A 80 -11.833 21.585 -16.825 1.00172.56 C
ATOM 548 O GLY A 80 -11.275 22.242 -15.944 1.00172.19 O
ATOM 549 N ALA A 81 -13.053 21.858 -17.276 1.00171.93 N
ATOM 550 CA ALA A 81 -13.833 22.980 -16.770 1.00171.25 C
ATOM 551 C ALA A 81 -15.297 22.863 -17.179 1.00171.33 C
ATOM 552 O ALA A 81 -15.642 22.083 -18.066 1.00171.83 O
ATOM 553 CB ALA A 81 -13.255 24.293 -17.273 1.00172.14 C
ATOM 554 N VAL A 82 -16.154 23.647 -16.538 1.00170.74 N
ATOM 555 CA VAL A 82 -17.539 23.756 -16.978 1.00171.98 C
ATOM 556 C VAL A 82 -17.665 25.023 -17.809 1.00173.54 C
ATOM 557 O VAL A 82 -17.511 26.132 -17.298 1.00174.54 O
ATOM 558 CB VAL A 82 -18.525 23.792 -15.800 1.00172.05 C
ATOM 559 CG1 VAL A 82 -19.917 24.161 -16.286 1.00172.87 C
ATOM 560 CG2 VAL A 82 -18.549 22.449 -15.092 1.00173.55 C
ATOM 561 N VAL A 83 -17.946 24.849 -19.095 1.00173.61 N
ATOM 562 CA VAL A 83 -17.909 25.951 -20.045 1.00172.23 C
ATOM 563 C VAL A 83 -19.132 26.854 -19.922 1.00172.19 C
ATOM 564 O VAL A 83 -20.262 26.370 -19.876 1.00172.75 O
ATOM 565 CB VAL A 83 -17.813 25.423 -21.486 1.00172.19 C
ATOM 566 CG1 VAL A 83 -17.614 26.563 -22.462 1.00172.53 C
ATOM 567 CG2 VAL A 83 -16.677 24.419 -21.601 1.00174.28 C
ATOM 568 N PRO A 84 -18.903 28.177 -19.872 1.00171.99 N
ATOM 569 CA PRO A 84 -19.966 29.181 -19.799 1.00172.73 C
ATOM 570 C PRO A 84 -20.974 29.066 -20.938 1.00172.83 C
ATOM 571 O PRO A 84 -20.647 28.527 -21.996 1.00173.03 O
ATOM 572 CB PRO A 84 -19.196 30.499 -19.879 1.00173.06 C
ATOM 573 CG PRO A 84 -17.887 30.179 -19.246 1.00172.66 C
ATOM 574 CD PRO A 84 -17.571 28.795 -19.738 1.00171.94 C
ATOM 575 N SER A 85 -22.187 29.559 -20.704 1.00172.92 N
ATOM 576 CA SER A 85 -23.251 29.528 -21.703 1.00173.12 C
ATOM 577 C SER A 85 -22.835 30.231 -22.990 1.00173.38 C
ATOM 578 O SER A 85 -21.902 31.031 -22.994 1.00173.01 O
ATOM 579 CB SER A 85 -24.522 30.171 -21.145 1.00173.58 C
ATOM 580 OG SER A 85 -24.298 31.530 -20.815 1.00172.99 O
ATOM 581 N SER A 86 -23.534 29.923 -24.076 1.00174.07 N
ATOM 582 CA SER A 86 -23.210 30.477 -25.386 1.00173.63 C
ATOM 583 C SER A 86 -23.321 31.996 -25.415 1.00173.20 C
ATOM 584 O SER A 86 -24.025 32.598 -24.604 1.00173.25 O
ATOM 585 CB SER A 86 -24.122 29.874 -26.458 1.00173.72 C
ATOM 586 OG SER A 86 -23.959 30.542 -27.697 1.00172.56 O
ATOM 587 N ASN A 87 -22.619 32.611 -26.362 1.00172.91 N
ATOM 588 CA ASN A 87 -22.662 34.054 -26.525 1.00173.34 C
ATOM 589 C ASN A 87 -23.905 34.455 -27.311 1.00173.85 C
ATOM 590 O ASN A 87 -24.314 35.616 -27.304 1.00174.60 O
ATOM 591 CB ASN A 87 -21.394 34.552 -27.222 1.00173.42 C
ATOM 592 CG ASN A 87 -21.333 36.063 -27.311 1.00173.30 C
ATOM 593 OD1 ASN A 87 -21.310 36.755 -26.294 1.00172.60 O
ATOM 594 ND2 ASN A 87 -21.298 36.583 -28.531 1.00173.63 N
ATOM 595 N ALA A 88 -24.503 33.477 -27.986 1.00174.04 N
ATOM 596 CA ALA A 88 -25.756 33.684 -28.699 1.00174.88 C
ATOM 597 C ALA A 88 -26.907 33.881 -27.721 1.00174.53 C
ATOM 598 O ALA A 88 -27.928 34.480 -28.058 1.00174.49 O
ATOM 599 CB ALA A 88 -26.042 32.513 -29.623 1.00175.15 C
ATOM 600 N ILE A 89 -26.736 33.367 -26.507 1.00173.79 N
ATOM 601 CA ILE A 89 -27.736 33.519 -25.460 1.00173.18 C
ATOM 602 C ILE A 89 -27.563 34.864 -24.760 1.00172.36 C
ATOM 603 O ILE A 89 -28.539 35.522 -24.403 1.00171.58 O
ATOM 604 CB ILE A 89 -27.644 32.379 -24.427 1.00173.79 C
ATOM 605 CG1 ILE A 89 -27.852 31.025 -25.108 1.00173.89 C
ATOM 606 CG2 ILE A 89 -28.654 32.582 -23.307 1.00174.13 C
ATOM 607 CD1 ILE A 89 -27.505 29.844 -24.231 1.00174.19 C
ATOM 608 N GLY A 90 -26.310 35.274 -24.588 1.00172.65 N
ATOM 609 CA GLY A 90 -25.999 36.527 -23.926 1.00173.38 C
ATOM 610 C GLY A 90 -26.440 36.550 -22.475 1.00173.45 C
ATOM 611 O GLY A 90 -25.992 35.736 -21.668 1.00173.90 O
ATOM 612 N LEU A 91 -27.324 37.486 -22.144 1.00173.05 N
ATOM 613 CA LEU A 91 -27.830 37.607 -20.782 1.00172.94 C
ATOM 614 C LEU A 91 -29.221 37.004 -20.644 1.00172.87 C
ATOM 615 O LEU A 91 -29.855 37.135 -19.598 1.00173.63 O
ATOM 616 CB LEU A 91 -27.856 39.072 -20.341 1.00172.42 C
ATOM 617 CG LEU A 91 -26.497 39.720 -20.075 1.00172.93 C
ATOM 618 CD1 LEU A 91 -26.668 41.164 -19.633 1.00173.45 C
ATOM 619 CD2 LEU A 91 -25.711 38.925 -19.043 1.00173.09 C
ATOM 620 N HIS A 92 -29.700 36.358 -21.702 1.00172.28 N
ATOM 621 CA HIS A 92 -31.008 35.713 -21.656 1.00172.82 C
ATOM 622 C HIS A 92 -31.022 34.580 -20.639 1.00174.07 C
ATOM 623 O HIS A 92 -30.019 33.895 -20.439 1.00175.03 O
ATOM 624 CB HIS A 92 -31.406 35.173 -23.031 1.00172.58 C
ATOM 625 CG HIS A 92 -31.864 36.227 -23.987 1.00172.61 C
ATOM 626 ND1 HIS A 92 -32.888 36.019 -24.887 1.00172.66 N
ATOM 627 CD2 HIS A 92 -31.437 37.496 -24.190 1.00173.58 C
ATOM 628 CE1 HIS A 92 -33.074 37.115 -25.601 1.00173.42 C
ATOM 629 NE2 HIS A 92 -32.206 38.027 -25.197 1.00174.24 N
ATOM 630 N PHE A 93 -32.170 34.389 -19.999 1.00173.84 N
ATOM 631 CA PHE A 93 -32.338 33.310 -19.038 1.00173.45 C
ATOM 632 C PHE A 93 -32.543 31.987 -19.766 1.00173.66 C
ATOM 633 O PHE A 93 -33.463 31.852 -20.571 1.00174.26 O
ATOM 634 CB PHE A 93 -33.514 33.606 -18.110 1.00173.37 C
ATOM 635 CG PHE A 93 -33.572 32.718 -16.907 1.00173.72 C
ATOM 636 CD1 PHE A 93 -32.553 32.735 -15.969 1.00173.93 C
ATOM 637 CD2 PHE A 93 -34.648 31.873 -16.706 1.00174.17 C
ATOM 638 CE1 PHE A 93 -32.605 31.921 -14.858 1.00174.50 C
ATOM 639 CE2 PHE A 93 -34.705 31.054 -15.596 1.00174.28 C
ATOM 640 CZ PHE A 93 -33.682 31.079 -14.672 1.00174.71 C
ATOM 641 N TYR A 94 -31.680 31.013 -19.485 1.00173.50 N
ATOM 642 CA TYR A 94 -31.701 29.747 -20.216 1.00173.78 C
ATOM 643 C TYR A 94 -31.819 28.520 -19.307 1.00174.12 C
ATOM 644 O TYR A 94 -30.842 27.799 -19.102 1.00173.85 O
ATOM 645 CB TYR A 94 -30.446 29.626 -21.086 1.00174.00 C
ATOM 646 CG TYR A 94 -30.535 28.562 -22.162 1.00174.60 C
ATOM 647 CD1 TYR A 94 -31.434 28.684 -23.216 1.00174.52 C
ATOM 648 CD2 TYR A 94 -29.715 27.441 -22.130 1.00174.98 C
ATOM 649 CE1 TYR A 94 -31.518 27.714 -24.204 1.00174.75 C
ATOM 650 CE2 TYR A 94 -29.791 26.468 -23.112 1.00174.82 C
ATOM 651 CZ TYR A 94 -30.693 26.609 -24.146 1.00174.82 C
ATOM 652 OH TYR A 94 -30.768 25.642 -25.122 1.00174.24 O
ATOM 653 N PRO A 95 -33.017 28.288 -18.744 1.00174.42 N
ATOM 654 CA PRO A 95 -33.291 27.085 -17.953 1.00174.64 C
ATOM 655 C PRO A 95 -33.492 25.858 -18.841 1.00174.42 C
ATOM 656 O PRO A 95 -33.627 26.011 -20.055 1.00174.64 O
ATOM 657 CB PRO A 95 -34.581 27.449 -17.217 1.00174.50 C
ATOM 658 CG PRO A 95 -35.288 28.330 -18.185 1.00174.24 C
ATOM 659 CD PRO A 95 -34.198 29.167 -18.805 1.00174.32 C
ATOM 660 N ILE A 96 -33.486 24.668 -18.251 1.00173.89 N
ATOM 661 CA ILE A 96 -33.717 23.432 -18.996 1.00173.48 C
ATOM 662 C ILE A 96 -35.022 23.470 -19.797 1.00173.94 C
ATOM 663 O ILE A 96 -35.070 23.006 -20.935 1.00174.24 O
ATOM 664 CB ILE A 96 -33.736 22.208 -18.058 1.00173.37 C
ATOM 665 CG1 ILE A 96 -32.425 22.120 -17.274 1.00173.69 C
ATOM 666 CG2 ILE A 96 -33.963 20.928 -18.845 1.00173.45 C
ATOM 667 CD1 ILE A 96 -32.351 20.935 -16.341 1.00174.68 C
ATOM 668 N TRP A 97 -36.073 24.039 -19.210 1.00174.02 N
ATOM 669 CA TRP A 97 -37.376 24.099 -19.873 1.00174.12 C
ATOM 670 C TRP A 97 -37.448 25.192 -20.945 1.00174.27 C
ATOM 671 O TRP A 97 -38.533 25.593 -21.363 1.00175.04 O
ATOM 672 CB TRP A 97 -38.494 24.306 -18.841 1.00174.06 C
ATOM 673 CG TRP A 97 -38.410 25.596 -18.072 1.00174.26 C
ATOM 674 CD1 TRP A 97 -38.797 26.832 -18.500 1.00174.53 C
ATOM 675 CD2 TRP A 97 -37.924 25.770 -16.735 1.00174.27 C
ATOM 676 NE1 TRP A 97 -38.574 27.766 -17.518 1.00174.24 N
ATOM 677 CE2 TRP A 97 -38.040 27.140 -16.423 1.00174.16 C
ATOM 678 CE3 TRP A 97 -37.399 24.901 -15.773 1.00174.54 C
ATOM 679 CZ2 TRP A 97 -37.649 27.661 -15.192 1.00174.14 C
ATOM 680 CZ3 TRP A 97 -37.012 25.422 -14.550 1.00174.96 C
ATOM 681 CH2 TRP A 97 -37.139 26.788 -14.270 1.00174.44 C
ATOM 682 N GLU A 98 -36.286 25.662 -21.388 1.00174.10 N
ATOM 683 CA GLU A 98 -36.202 26.678 -22.431 1.00174.17 C
ATOM 684 C GLU A 98 -35.566 26.069 -23.676 1.00174.28 C
ATOM 685 O GLU A 98 -35.352 26.743 -24.685 1.00174.42 O
ATOM 686 CB GLU A 98 -35.393 27.883 -21.940 1.00174.08 C
ATOM 687 CG GLU A 98 -35.479 29.138 -22.803 1.00174.00 C
ATOM 688 CD GLU A 98 -36.700 29.987 -22.507 1.00173.76 C
ATOM 689 OE1 GLU A 98 -36.690 31.178 -22.884 1.00173.89 O
ATOM 690 OE2 GLU A 98 -37.662 29.473 -21.900 1.00173.17 O
ATOM 691 N ALA A 99 -35.277 24.775 -23.598 1.00174.15 N
ATOM 692 CA ALA A 99 -34.614 24.071 -24.688 1.00173.83 C
ATOM 693 C ALA A 99 -35.503 22.969 -25.246 1.00173.63 C
ATOM 694 O ALA A 99 -36.263 22.340 -24.510 1.00173.36 O
ATOM 695 CB ALA A 99 -33.289 23.496 -24.215 1.00173.53 C
ATOM 696 N ALA A 100 -35.412 22.753 -26.555 1.00173.98 N
ATOM 697 CA ALA A 100 -36.155 21.685 -27.217 1.00174.04 C
ATOM 698 C ALA A 100 -35.750 20.312 -26.686 1.00174.07 C
ATOM 699 O ALA A 100 -36.548 19.373 -26.692 1.00173.99 O
ATOM 700 CB ALA A 100 -35.949 21.753 -28.721 1.00174.46 C
ATOM 701 N SER A 101 -34.507 20.202 -26.228 1.00174.23 N
ATOM 702 CA SER A 101 -33.993 18.952 -25.682 1.00174.28 C
ATOM 703 C SER A 101 -32.759 19.206 -24.825 1.00174.13 C
ATOM 704 O SER A 101 -32.199 20.304 -24.837 1.00173.69 O
ATOM 705 CB SER A 101 -33.657 17.967 -26.802 1.00173.78 C
ATOM 706 OG SER A 101 -32.849 18.580 -27.792 1.00174.11 O
ATOM 707 N LEU A 102 -32.337 18.183 -24.089 1.00174.58 N
ATOM 708 CA LEU A 102 -31.141 18.286 -23.260 1.00174.33 C
ATOM 709 C LEU A 102 -29.897 18.412 -24.129 1.00174.12 C
ATOM 710 O LEU A 102 -28.953 19.114 -23.772 1.00174.25 O
ATOM 711 CB LEU A 102 -31.018 17.077 -22.329 1.00173.35 C
ATOM 712 CG LEU A 102 -31.927 17.085 -21.099 1.00173.52 C
ATOM 713 CD1 LEU A 102 -31.952 15.716 -20.435 1.00174.18 C
ATOM 714 CD2 LEU A 102 -31.484 18.160 -20.113 1.00173.08 C
ATOM 715 N ASP A 103 -29.907 17.724 -25.268 1.00173.77 N
ATOM 716 CA ASP A 103 -28.808 17.787 -26.223 1.00173.23 C
ATOM 717 C ASP A 103 -28.522 19.233 -26.609 1.00172.58 C
ATOM 718 O ASP A 103 -27.368 19.658 -26.664 1.00172.17 O
ATOM 719 CB ASP A 103 -29.132 16.956 -27.468 1.00173.91 C
ATOM 720 CG ASP A 103 -28.784 15.489 -27.295 1.00173.99 C
ATOM 721 OD1 ASP A 103 -28.890 14.983 -26.157 1.00173.81 O
ATOM 722 OD2 ASP A 103 -28.405 14.841 -28.293 1.00173.81 O
ATOM 723 N GLU A 104 -29.587 19.985 -26.864 1.00172.72 N
ATOM 724 CA GLU A 104 -29.476 21.400 -27.188 1.00173.46 C
ATOM 725 C GLU A 104 -29.021 22.192 -25.969 1.00173.07 C
ATOM 726 O GLU A 104 -28.229 23.129 -26.078 1.00173.44 O
ATOM 727 CB GLU A 104 -30.814 21.937 -27.694 1.00174.00 C
ATOM 728 CG GLU A 104 -30.900 23.452 -27.736 1.00174.20 C
ATOM 729 CD GLU A 104 -32.321 23.946 -27.898 1.00174.01 C
ATOM 730 OE1 GLU A 104 -33.045 23.410 -28.763 1.00174.39 O
ATOM 731 OE2 GLU A 104 -32.715 24.871 -27.159 1.00173.59 O
ATOM 732 N TRP A 105 -29.522 21.793 -24.805 1.00172.74 N
ATOM 733 CA TRP A 105 -29.239 22.493 -23.560 1.00173.34 C
ATOM 734 C TRP A 105 -27.768 22.363 -23.187 1.00173.83 C
ATOM 735 O TRP A 105 -27.152 23.319 -22.716 1.00174.42 O
ATOM 736 CB TRP A 105 -30.132 21.954 -22.438 1.00173.92 C
ATOM 737 CG TRP A 105 -29.997 22.678 -21.130 1.00173.96 C
ATOM 738 CD1 TRP A 105 -30.416 23.944 -20.845 1.00174.33 C
ATOM 739 CD2 TRP A 105 -29.430 22.163 -19.920 1.00173.37 C
ATOM 740 NE1 TRP A 105 -30.132 24.256 -19.538 1.00173.85 N
ATOM 741 CE2 TRP A 105 -29.526 23.177 -18.946 1.00173.44 C
ATOM 742 CE3 TRP A 105 -28.842 20.945 -19.563 1.00173.30 C
ATOM 743 CZ2 TRP A 105 -29.059 23.014 -17.645 1.00173.90 C
ATOM 744 CZ3 TRP A 105 -28.378 20.783 -18.271 1.00173.79 C
ATOM 745 CH2 TRP A 105 -28.490 21.811 -17.328 1.00174.39 C
ATOM 746 N LEU A 106 -27.204 21.182 -23.413 1.00173.93 N
ATOM 747 CA LEU A 106 -25.797 20.941 -23.110 1.00174.24 C
ATOM 748 C LEU A 106 -24.878 21.599 -24.135 1.00173.80 C
ATOM 749 O LEU A 106 -23.718 21.889 -23.848 1.00174.42 O
ATOM 750 CB LEU A 106 -25.511 19.441 -23.044 1.00174.90 C
ATOM 751 CG LEU A 106 -26.315 18.606 -22.045 1.00175.54 C
ATOM 752 CD1 LEU A 106 -26.147 17.120 -22.332 1.00175.59 C
ATOM 753 CD2 LEU A 106 -25.894 18.929 -20.622 1.00175.06 C
ATOM 754 N TYR A 107 -25.403 21.829 -25.333 1.00172.95 N
ATOM 755 CA TYR A 107 -24.615 22.410 -26.412 1.00173.14 C
ATOM 756 C TYR A 107 -24.449 23.912 -26.220 1.00172.72 C
ATOM 757 O TYR A 107 -23.407 24.479 -26.548 1.00172.92 O
ATOM 758 CB TYR A 107 -25.272 22.113 -27.763 1.00173.77 C
ATOM 759 CG TYR A 107 -24.493 22.594 -28.970 1.00173.72 C
ATOM 760 CD1 TYR A 107 -23.540 21.783 -29.575 1.00173.77 C
ATOM 761 CD2 TYR A 107 -24.725 23.850 -29.518 1.00173.48 C
ATOM 762 CE1 TYR A 107 -22.830 22.211 -30.681 1.00173.54 C
ATOM 763 CE2 TYR A 107 -24.019 24.287 -30.628 1.00173.93 C
ATOM 764 CZ TYR A 107 -23.074 23.462 -31.203 1.00174.09 C
ATOM 765 OH TYR A 107 -22.366 23.886 -32.305 1.00174.24 O
ATOM 766 N ASN A 108 -25.477 24.550 -25.672 1.00172.35 N
ATOM 767 CA ASN A 108 -25.477 25.999 -25.508 1.00172.63 C
ATOM 768 C ASN A 108 -24.986 26.444 -24.134 1.00172.29 C
ATOM 769 O ASN A 108 -25.182 27.593 -23.744 1.00172.61 O
ATOM 770 CB ASN A 108 -26.879 26.557 -25.762 1.00173.18 C
ATOM 771 CG ASN A 108 -27.317 26.403 -27.208 1.00173.69 C
ATOM 772 OD1 ASN A 108 -27.419 27.386 -27.943 1.00173.86 O
ATOM 773 ND2 ASN A 108 -27.586 25.169 -27.618 1.00173.58 N
ATOM 774 N GLY A 109 -24.350 25.534 -23.404 1.00172.01 N
ATOM 775 CA GLY A 109 -23.799 25.859 -22.100 1.00173.23 C
ATOM 776 C GLY A 109 -24.860 26.040 -21.034 1.00174.64 C
ATOM 777 O GLY A 109 -24.722 26.871 -20.137 1.00175.07 O
ATOM 778 N GLY A 110 -25.925 25.254 -21.141 1.00175.10 N
ATOM 779 CA GLY A 110 -27.007 25.262 -20.172 1.00174.64 C
ATOM 780 C GLY A 110 -26.624 25.056 -18.714 1.00173.12 C
ATOM 781 O GLY A 110 -27.005 25.865 -17.868 1.00172.35 O
ATOM 782 N PRO A 111 -25.889 23.969 -18.408 1.00172.76 N
ATOM 783 CA PRO A 111 -25.453 23.679 -17.039 1.00172.99 C
ATOM 784 C PRO A 111 -24.815 24.862 -16.317 1.00173.07 C
ATOM 785 O PRO A 111 -25.067 25.037 -15.126 1.00173.17 O
ATOM 786 CB PRO A 111 -24.432 22.564 -17.242 1.00173.47 C
ATOM 787 CG PRO A 111 -24.969 21.816 -18.398 1.00173.51 C
ATOM 788 CD PRO A 111 -25.516 22.872 -19.323 1.00173.20 C
ATOM 789 N TYR A 112 -24.015 25.651 -17.030 1.00173.08 N
ATOM 790 CA TYR A 112 -23.299 26.776 -16.434 1.00173.72 C
ATOM 791 C TYR A 112 -24.216 27.711 -15.654 1.00173.52 C
ATOM 792 O TYR A 112 -23.932 28.046 -14.506 1.00173.99 O
ATOM 793 CB TYR A 112 -22.561 27.573 -17.510 1.00173.96 C
ATOM 794 CG TYR A 112 -21.736 28.716 -16.957 1.00173.68 C
ATOM 795 CD1 TYR A 112 -20.522 28.479 -16.326 1.00174.00 C
ATOM 796 CD2 TYR A 112 -22.169 30.031 -17.071 1.00173.09 C
ATOM 797 CE1 TYR A 112 -19.764 29.518 -15.823 1.00173.56 C
ATOM 798 CE2 TYR A 112 -21.417 31.076 -16.570 1.00172.97 C
ATOM 799 CZ TYR A 112 -20.216 30.814 -15.948 1.00173.32 C
ATOM 800 OH TYR A 112 -19.466 31.853 -15.449 1.00174.04 O
ATOM 801 N GLN A 113 -25.312 28.127 -16.280 1.00172.95 N
ATOM 802 CA GLN A 113 -26.265 29.017 -15.628 1.00173.26 C
ATOM 803 C GLN A 113 -26.888 28.361 -14.404 1.00174.10 C
ATOM 804 O GLN A 113 -26.999 28.985 -13.350 1.00175.01 O
ATOM 805 CB GLN A 113 -27.360 29.453 -16.601 1.00173.30 C
ATOM 806 CG GLN A 113 -26.933 30.547 -17.562 1.00174.62 C
ATOM 807 CD GLN A 113 -28.099 31.117 -18.345 1.00174.59 C
ATOM 808 OE1 GLN A 113 -29.181 31.336 -17.799 1.00173.71 O
ATOM 809 NE2 GLN A 113 -27.881 31.370 -19.630 1.00174.84 N
ATOM 810 N LEU A 114 -27.292 27.105 -14.552 1.00173.63 N
ATOM 811 CA LEU A 114 -27.907 26.359 -13.460 1.00173.27 C
ATOM 812 C LEU A 114 -26.987 26.304 -12.242 1.00172.90 C
ATOM 813 O LEU A 114 -27.451 26.352 -11.104 1.00172.96 O
ATOM 814 CB LEU A 114 -28.278 24.947 -13.926 1.00172.98 C
ATOM 815 CG LEU A 114 -29.153 24.065 -13.030 1.00172.60 C
ATOM 816 CD1 LEU A 114 -29.898 23.057 -13.887 1.00173.13 C
ATOM 817 CD2 LEU A 114 -28.341 23.335 -11.973 1.00173.64 C
ATOM 818 N ILE A 115 -25.684 26.208 -12.487 1.00172.89 N
ATOM 819 CA ILE A 115 -24.708 26.130 -11.406 1.00172.69 C
ATOM 820 C ILE A 115 -24.473 27.478 -10.731 1.00172.87 C
ATOM 821 O ILE A 115 -24.641 27.607 -9.518 1.00172.65 O
ATOM 822 CB ILE A 115 -23.356 25.595 -11.906 1.00172.48 C
ATOM 823 CG1 ILE A 115 -23.537 24.222 -12.551 1.00172.85 C
ATOM 824 CG2 ILE A 115 -22.361 25.511 -10.762 1.00172.76 C
ATOM 825 CD1 ILE A 115 -22.251 23.611 -13.043 1.00173.47 C
ATOM 826 N ILE A 116 -24.078 28.473 -11.520 1.00173.37 N
ATOM 827 CA ILE A 116 -23.727 29.784 -10.982 1.00173.98 C
ATOM 828 C ILE A 116 -24.894 30.455 -10.260 1.00174.02 C
ATOM 829 O ILE A 116 -24.703 31.090 -9.223 1.00173.96 O
ATOM 830 CB ILE A 116 -23.199 30.738 -12.090 1.00174.04 C
ATOM 831 CG1 ILE A 116 -24.219 30.912 -13.218 1.00173.91 C
ATOM 832 CG2 ILE A 116 -21.878 30.230 -12.645 1.00173.42 C
ATOM 833 CD1 ILE A 116 -23.965 32.127 -14.087 1.00172.96 C
ATOM 834 N PHE A 117 -26.102 30.302 -10.795 1.00174.17 N
ATOM 835 CA PHE A 117 -27.287 30.888 -10.178 1.00174.10 C
ATOM 836 C PHE A 117 -27.563 30.221 -8.834 1.00173.87 C
ATOM 837 O PHE A 117 -27.799 30.898 -7.835 1.00174.27 O
ATOM 838 CB PHE A 117 -28.503 30.775 -11.107 1.00174.91 C
ATOM 839 CG PHE A 117 -28.419 31.658 -12.326 1.00174.72 C
ATOM 840 CD1 PHE A 117 -27.736 32.864 -12.275 1.00174.58 C
ATOM 841 CD2 PHE A 117 -29.031 31.295 -13.516 1.00174.34 C
ATOM 842 CE1 PHE A 117 -27.657 33.681 -13.387 1.00173.61 C
ATOM 843 CE2 PHE A 117 -28.953 32.110 -14.633 1.00172.87 C
ATOM 844 CZ PHE A 117 -28.265 33.306 -14.567 1.00172.88 C
ATOM 845 N HIS A 118 -27.537 28.892 -8.817 1.00173.98 N
ATOM 846 CA HIS A 118 -27.751 28.130 -7.590 1.00174.79 C
ATOM 847 C HIS A 118 -26.675 28.392 -6.550 1.00174.34 C
ATOM 848 O HIS A 118 -26.951 28.479 -5.353 1.00173.97 O
ATOM 849 CB HIS A 118 -27.787 26.640 -7.897 1.00175.03 C
ATOM 850 CG HIS A 118 -29.104 26.168 -8.416 1.00174.84 C
ATOM 851 ND1 HIS A 118 -29.480 26.309 -9.733 1.00174.23 N
ATOM 852 CD2 HIS A 118 -30.137 25.557 -7.791 1.00174.34 C
ATOM 853 CE1 HIS A 118 -30.690 25.804 -9.899 1.00173.95 C
ATOM 854 NE2 HIS A 118 -31.108 25.339 -8.736 1.00173.97 N
ATOM 855 N PHE A 119 -25.443 28.502 -7.025 1.00173.71 N
ATOM 856 CA PHE A 119 -24.310 28.729 -6.151 1.00172.93 C
ATOM 857 C PHE A 119 -24.387 30.101 -5.491 1.00173.33 C
ATOM 858 O PHE A 119 -24.427 30.203 -4.266 1.00173.57 O
ATOM 859 CB PHE A 119 -23.009 28.587 -6.930 1.00172.21 C
ATOM 860 CG PHE A 119 -21.808 29.024 -6.167 1.00172.25 C
ATOM 861 CD1 PHE A 119 -21.289 28.227 -5.163 1.00172.78 C
ATOM 862 CD2 PHE A 119 -21.194 30.230 -6.448 1.00172.74 C
ATOM 863 CE1 PHE A 119 -20.184 28.627 -4.451 1.00173.27 C
ATOM 864 CE2 PHE A 119 -20.087 30.635 -5.740 1.00172.86 C
ATOM 865 CZ PHE A 119 -19.580 29.832 -4.740 1.00172.99 C
ATOM 866 N LEU A 120 -24.412 31.148 -6.313 1.00173.53 N
ATOM 867 CA LEU A 120 -24.482 32.525 -5.830 1.00174.20 C
ATOM 868 C LEU A 120 -25.649 32.740 -4.871 1.00174.32 C
ATOM 869 O LEU A 120 -25.529 33.478 -3.892 1.00174.30 O
ATOM 870 CB LEU A 120 -24.591 33.495 -7.011 1.00173.93 C
ATOM 871 CG LEU A 120 -23.316 33.726 -7.825 1.00173.96 C
ATOM 872 CD1 LEU A 120 -23.603 34.591 -9.046 1.00174.07 C
ATOM 873 CD2 LEU A 120 -22.216 34.347 -6.969 1.00174.13 C
ATOM 874 N LEU A 121 -26.771 32.088 -5.157 1.00174.39 N
ATOM 875 CA LEU A 121 -27.932 32.126 -4.276 1.00174.18 C
ATOM 876 C LEU A 121 -27.605 31.484 -2.930 1.00173.12 C
ATOM 877 O LEU A 121 -27.729 32.117 -1.882 1.00172.62 O
ATOM 878 CB LEU A 121 -29.123 31.422 -4.932 1.00174.92 C
ATOM 879 CG LEU A 121 -30.521 31.812 -4.449 1.00175.53 C
ATOM 880 CD1 LEU A 121 -30.782 33.292 -4.689 1.00175.05 C
ATOM 881 CD2 LEU A 121 -31.576 30.967 -5.143 1.00174.63 C
ATOM 882 N GLY A 122 -27.189 30.221 -2.973 1.00172.83 N
ATOM 883 CA GLY A 122 -26.796 29.494 -1.781 1.00173.11 C
ATOM 884 C GLY A 122 -25.656 30.148 -1.023 1.00173.45 C
ATOM 885 O GLY A 122 -25.705 30.265 0.203 1.00173.62 O
ATOM 886 N ALA A 123 -24.626 30.572 -1.752 1.00173.67 N
ATOM 887 CA ALA A 123 -23.463 31.216 -1.147 1.00173.50 C
ATOM 888 C ALA A 123 -23.841 32.522 -0.452 1.00173.11 C
ATOM 889 O ALA A 123 -23.149 32.970 0.461 1.00173.06 O
ATOM 890 CB ALA A 123 -22.390 31.469 -2.196 1.00173.36 C
ATOM 891 N SER A 124 -24.942 33.127 -0.886 1.00173.07 N
ATOM 892 CA SER A 124 -25.455 34.329 -0.242 1.00173.44 C
ATOM 893 C SER A 124 -26.154 33.944 1.052 1.00173.56 C
ATOM 894 O SER A 124 -25.945 34.563 2.095 1.00173.53 O
ATOM 895 CB SER A 124 -26.414 35.082 -1.167 1.00173.72 C
ATOM 896 OG SER A 124 -25.759 35.497 -2.352 1.00173.80 O
ATOM 897 N CYS A 125 -26.989 32.914 0.966 1.00173.80 N
ATOM 898 CA CYS A 125 -27.657 32.351 2.132 1.00175.01 C
ATOM 899 C CYS A 125 -26.653 31.803 3.144 1.00174.73 C
ATOM 900 O CYS A 125 -26.908 31.809 4.349 1.00174.66 O
ATOM 901 CB CYS A 125 -28.626 31.247 1.702 1.00174.65 C
ATOM 902 SG CYS A 125 -30.004 31.824 0.689 1.00171.12 S
ATOM 903 N TYR A 126 -25.516 31.327 2.644 1.00174.13 N
ATOM 904 CA TYR A 126 -24.441 30.846 3.501 1.00173.48 C
ATOM 905 C TYR A 126 -23.932 31.979 4.383 1.00173.48 C
ATOM 906 O TYR A 126 -23.592 31.771 5.548 1.00173.37 O
ATOM 907 CB TYR A 126 -23.304 30.260 2.660 1.00173.37 C
ATOM 908 CG TYR A 126 -22.193 29.638 3.473 1.00173.33 C
ATOM 909 CD1 TYR A 126 -22.240 28.300 3.838 1.00173.16 C
ATOM 910 CD2 TYR A 126 -21.094 30.387 3.869 1.00173.67 C
ATOM 911 CE1 TYR A 126 -21.228 27.727 4.582 1.00173.86 C
ATOM 912 CE2 TYR A 126 -20.074 29.823 4.612 1.00173.70 C
ATOM 913 CZ TYR A 126 -20.147 28.492 4.965 1.00173.92 C
ATOM 914 OH TYR A 126 -19.139 27.920 5.705 1.00174.30 O
ATOM 915 N MET A 127 -23.900 33.182 3.819 1.00173.55 N
ATOM 916 CA MET A 127 -23.522 34.375 4.561 1.00173.87 C
ATOM 917 C MET A 127 -24.606 34.722 5.571 1.00173.51 C
ATOM 918 O MET A 127 -24.318 35.038 6.725 1.00173.28 O
ATOM 919 CB MET A 127 -23.286 35.550 3.610 1.00174.63 C
ATOM 920 CG MET A 127 -22.932 36.854 4.303 1.00175.24 C
ATOM 921 SD MET A 127 -22.340 38.107 3.147 1.00173.37 S
ATOM 922 CE MET A 127 -23.836 38.455 2.230 1.00172.62 C
ATOM 923 N GLY A 128 -25.857 34.651 5.125 1.00173.58 N
ATOM 924 CA GLY A 128 -26.999 34.886 5.989 1.00173.98 C
ATOM 925 C GLY A 128 -27.049 33.941 7.172 1.00173.70 C
ATOM 926 O GLY A 128 -27.460 34.327 8.268 1.00173.88 O
ATOM 927 N ARG A 129 -26.633 32.699 6.951 1.00173.56 N
ATOM 928 CA ARG A 129 -26.608 31.706 8.015 1.00174.02 C
ATOM 929 C ARG A 129 -25.488 31.993 9.009 1.00174.05 C
ATOM 930 O ARG A 129 -25.638 31.758 10.209 1.00174.16 O
ATOM 931 CB ARG A 129 -26.460 30.296 7.442 1.00174.01 C
ATOM 932 CG ARG A 129 -27.169 29.236 8.271 1.00173.86 C
ATOM 933 CD ARG A 129 -27.057 27.855 7.650 1.00173.95 C
ATOM 934 NE ARG A 129 -25.675 27.395 7.550 1.00173.50 N
ATOM 935 CZ ARG A 129 -25.315 26.118 7.607 1.00173.50 C
ATOM 936 NH1 ARG A 129 -26.234 25.177 7.770 1.00173.77 N
ATOM 937 NH2 ARG A 129 -24.039 25.777 7.501 1.00173.28 N
ATOM 938 N GLN A 130 -24.365 32.503 8.510 1.00173.76 N
ATOM 939 CA GLN A 130 -23.253 32.890 9.375 1.00173.74 C
ATOM 940 C GLN A 130 -23.626 34.020 10.334 1.00173.85 C
ATOM 941 O GLN A 130 -22.888 34.312 11.274 1.00173.69 O
ATOM 942 CB GLN A 130 -22.043 33.302 8.536 1.00173.82 C
ATOM 943 CG GLN A 130 -21.419 32.157 7.767 1.00173.95 C
ATOM 944 CD GLN A 130 -19.968 32.410 7.430 1.00174.73 C
ATOM 945 OE1 GLN A 130 -19.596 33.508 7.021 1.00174.71 O
ATOM 946 NE2 GLN A 130 -19.135 31.390 7.603 1.00174.92 N
ATOM 947 N TRP A 131 -24.768 34.655 10.092 1.00173.83 N
ATOM 948 CA TRP A 131 -25.316 35.617 11.038 1.00173.71 C
ATOM 949 C TRP A 131 -26.236 34.901 12.015 1.00173.58 C
ATOM 950 O TRP A 131 -26.127 35.072 13.231 1.00173.85 O
ATOM 951 CB TRP A 131 -26.093 36.736 10.334 1.00173.85 C
ATOM 952 CG TRP A 131 -27.090 37.366 11.261 1.00174.25 C
ATOM 953 CD1 TRP A 131 -26.841 38.321 12.204 1.00175.03 C
ATOM 954 CD2 TRP A 131 -28.484 37.056 11.365 1.00174.55 C
ATOM 955 NE1 TRP A 131 -27.995 38.631 12.882 1.00175.53 N
ATOM 956 CE2 TRP A 131 -29.021 37.866 12.385 1.00175.43 C
ATOM 957 CE3 TRP A 131 -29.338 36.177 10.687 1.00174.23 C
ATOM 958 CZ2 TRP A 131 -30.365 37.824 12.746 1.00175.87 C
ATOM 959 CZ3 TRP A 131 -30.669 36.128 11.052 1.00175.07 C
ATOM 960 CH2 TRP A 131 -31.169 36.944 12.073 1.00175.81 C
ATOM 961 N GLU A 132 -27.149 34.111 11.460 1.00173.26 N
ATOM 962 CA GLU A 132 -28.189 33.430 12.223 1.00173.47 C
ATOM 963 C GLU A 132 -27.634 32.634 13.397 1.00173.66 C
ATOM 964 O GLU A 132 -28.055 32.830 14.533 1.00173.93 O
ATOM 965 CB GLU A 132 -28.990 32.510 11.301 1.00173.67 C
ATOM 966 CG GLU A 132 -30.334 32.099 11.867 1.00173.76 C
ATOM 967 CD GLU A 132 -31.183 31.342 10.867 1.00173.56 C
ATOM 968 OE1 GLU A 132 -31.215 31.744 9.684 1.00173.33 O
ATOM 969 OE2 GLU A 132 -31.838 30.358 11.269 1.00173.49 O
ATOM 970 N LEU A 133 -26.687 31.746 13.118 1.00173.61 N
ATOM 971 CA LEU A 133 -26.084 30.924 14.160 1.00173.39 C
ATOM 972 C LEU A 133 -25.423 31.784 15.230 1.00173.65 C
ATOM 973 O LEU A 133 -25.512 31.486 16.419 1.00173.38 O
ATOM 974 CB LEU A 133 -25.066 29.956 13.562 1.00173.01 C
ATOM 975 CG LEU A 133 -24.486 28.926 14.533 1.00172.31 C
ATOM 976 CD1 LEU A 133 -25.596 28.099 15.159 1.00172.36 C
ATOM 977 CD2 LEU A 133 -23.489 28.033 13.820 1.00172.61 C
ATOM 978 N SER A 134 -24.771 32.860 14.798 1.00174.11 N
ATOM 979 CA SER A 134 -24.140 33.796 15.720 1.00173.69 C
ATOM 980 C SER A 134 -25.186 34.464 16.604 1.00173.86 C
ATOM 981 O SER A 134 -24.924 34.773 17.766 1.00173.74 O
ATOM 982 CB SER A 134 -23.340 34.853 14.955 1.00173.41 C
ATOM 983 OG SER A 134 -24.166 35.936 14.564 1.00173.60 O
ATOM 984 N TYR A 135 -26.373 34.678 16.045 1.00174.39 N
ATOM 985 CA TYR A 135 -27.490 35.246 16.791 1.00174.45 C
ATOM 986 C TYR A 135 -28.029 34.235 17.800 1.00174.42 C
ATOM 987 O TYR A 135 -28.223 34.558 18.973 1.00174.54 O
ATOM 988 CB TYR A 135 -28.600 35.698 15.836 1.00174.61 C
ATOM 989 CG TYR A 135 -29.723 36.461 16.503 1.00175.43 C
ATOM 990 CD1 TYR A 135 -29.475 37.636 17.201 1.00175.28 C
ATOM 991 CD2 TYR A 135 -31.035 36.008 16.432 1.00175.58 C
ATOM 992 CE1 TYR A 135 -30.503 38.334 17.813 1.00175.46 C
ATOM 993 CE2 TYR A 135 -32.066 36.697 17.039 1.00175.13 C
ATOM 994 CZ TYR A 135 -31.795 37.860 17.727 1.00175.18 C
ATOM 995 OH TYR A 135 -32.827 38.543 18.330 1.00174.38 O
ATOM 996 N ARG A 136 -28.270 33.009 17.337 1.00174.04 N
ATOM 997 CA ARG A 136 -28.769 31.943 18.204 1.00173.95 C
ATOM 998 C ARG A 136 -27.792 31.581 19.326 1.00174.08 C
ATOM 999 O ARG A 136 -28.194 31.008 20.337 1.00174.80 O
ATOM 1000 CB ARG A 136 -29.083 30.687 17.384 1.00173.58 C
ATOM 1001 CG ARG A 136 -29.866 30.923 16.107 1.00173.62 C
ATOM 1002 CD ARG A 136 -31.235 31.529 16.373 1.00174.22 C
ATOM 1003 NE ARG A 136 -32.084 31.469 15.186 1.00174.63 N
ATOM 1004 CZ ARG A 136 -32.906 32.438 14.799 1.00174.33 C
ATOM 1005 NH1 ARG A 136 -33.001 33.556 15.506 1.00174.35 N
ATOM 1006 NH2 ARG A 136 -33.638 32.288 13.704 1.00173.94 N
ATOM 1007 N LEU A 137 -26.517 31.912 19.149 1.00173.58 N
ATOM 1008 CA LEU A 137 -25.499 31.550 20.132 1.00173.83 C
ATOM 1009 C LEU A 137 -25.099 32.735 21.005 1.00174.46 C
ATOM 1010 O LEU A 137 -24.223 32.617 21.864 1.00174.66 O
ATOM 1011 CB LEU A 137 -24.261 30.973 19.442 1.00173.82 C
ATOM 1012 CG LEU A 137 -24.436 29.631 18.729 1.00174.53 C
ATOM 1013 CD1 LEU A 137 -23.098 29.109 18.234 1.00174.63 C
ATOM 1014 CD2 LEU A 137 -25.096 28.624 19.652 1.00174.43 C
ATOM 1015 N GLY A 138 -25.736 33.877 20.773 1.00174.71 N
ATOM 1016 CA GLY A 138 -25.520 35.054 21.593 1.00174.81 C
ATOM 1017 C GLY A 138 -24.178 35.726 21.385 1.00174.34 C
ATOM 1018 O GLY A 138 -23.757 36.547 22.200 1.00173.74 O
ATOM 1019 N MET A 139 -23.499 35.379 20.297 1.00174.55 N
ATOM 1020 CA MET A 139 -22.228 36.010 19.970 1.00174.29 C
ATOM 1021 C MET A 139 -22.425 37.127 18.956 1.00174.30 C
ATOM 1022 O MET A 139 -23.440 37.178 18.260 1.00174.53 O
ATOM 1023 CB MET A 139 -21.235 34.985 19.431 1.00174.23 C
ATOM 1024 CG MET A 139 -21.814 34.057 18.389 1.00174.07 C
ATOM 1025 SD MET A 139 -20.591 32.893 17.774 1.00173.95 S
ATOM 1026 CE MET A 139 -19.919 33.817 16.397 1.00173.53 C
ATOM 1027 N ARG A 140 -21.444 38.017 18.880 1.00174.07 N
ATOM 1028 CA ARG A 140 -21.491 39.158 17.976 1.00173.56 C
ATOM 1029 C ARG A 140 -21.540 38.710 16.515 1.00173.67 C
ATOM 1030 O ARG A 140 -20.990 37.666 16.169 1.00174.15 O
ATOM 1031 CB ARG A 140 -20.281 40.059 18.226 1.00173.38 C
ATOM 1032 CG ARG A 140 -19.903 40.146 19.696 1.00173.87 C
ATOM 1033 CD ARG A 140 -18.708 41.047 19.919 1.00174.07 C
ATOM 1034 NE ARG A 140 -19.018 42.438 19.614 1.00174.03 N
ATOM 1035 CZ ARG A 140 -18.106 43.388 19.451 1.00174.31 C
ATOM 1036 NH1 ARG A 140 -16.815 43.101 19.559 1.00174.62 N
ATOM 1037 NH2 ARG A 140 -18.485 44.628 19.175 1.00174.16 N
ATOM 1038 N PRO A 141 -22.209 39.497 15.657 1.00173.81 N
ATOM 1039 CA PRO A 141 -22.354 39.184 14.231 1.00174.06 C
ATOM 1040 C PRO A 141 -21.066 39.418 13.444 1.00174.37 C
ATOM 1041 O PRO A 141 -20.015 38.914 13.827 1.00174.43 O
ATOM 1042 CB PRO A 141 -23.445 40.154 13.781 1.00173.90 C
ATOM 1043 CG PRO A 141 -23.237 41.336 14.663 1.00174.10 C
ATOM 1044 CD PRO A 141 -22.914 40.742 16.007 1.00173.69 C
ATOM 1045 N TRP A 142 -21.170 40.149 12.336 1.00174.42 N
ATOM 1046 CA TRP A 142 -20.013 40.648 11.584 1.00174.61 C
ATOM 1047 C TRP A 142 -19.020 39.595 11.073 1.00174.35 C
ATOM 1048 O TRP A 142 -18.127 39.923 10.293 1.00174.31 O
ATOM 1049 CB TRP A 142 -19.250 41.671 12.429 1.00174.32 C
ATOM 1050 CG TRP A 142 -20.086 42.838 12.841 1.00173.91 C
ATOM 1051 CD1 TRP A 142 -21.190 43.321 12.201 1.00173.29 C
ATOM 1052 CD2 TRP A 142 -19.887 43.676 13.985 1.00174.07 C
ATOM 1053 NE1 TRP A 142 -21.692 44.406 12.876 1.00173.39 N
ATOM 1054 CE2 TRP A 142 -20.910 44.645 13.975 1.00174.18 C
ATOM 1055 CE3 TRP A 142 -18.943 43.700 15.017 1.00173.74 C
ATOM 1056 CZ2 TRP A 142 -21.015 45.628 14.956 1.00174.36 C
ATOM 1057 CZ3 TRP A 142 -19.050 44.677 15.991 1.00173.86 C
ATOM 1058 CH2 TRP A 142 -20.078 45.627 15.953 1.00174.07 C
ATOM 1059 N ILE A 143 -19.149 38.349 11.516 1.00174.19 N
ATOM 1060 CA ILE A 143 -18.347 37.275 10.945 1.00174.47 C
ATOM 1061 C ILE A 143 -18.753 37.098 9.485 1.00174.54 C
ATOM 1062 O ILE A 143 -17.906 36.941 8.601 1.00174.01 O
ATOM 1063 CB ILE A 143 -18.514 35.953 11.726 1.00173.92 C
ATOM 1064 CG1 ILE A 143 -17.613 35.954 12.962 1.00173.05 C
ATOM 1065 CG2 ILE A 143 -18.184 34.757 10.848 1.00173.93 C
ATOM 1066 CD1 ILE A 143 -17.584 34.634 13.699 1.00173.03 C
ATOM 1067 N CYS A 144 -20.059 37.147 9.244 1.00174.66 N
ATOM 1068 CA CYS A 144 -20.609 37.113 7.895 1.00173.86 C
ATOM 1069 C CYS A 144 -20.131 38.297 7.060 1.00173.30 C
ATOM 1070 O CYS A 144 -20.070 38.218 5.835 1.00173.65 O
ATOM 1071 CB CYS A 144 -22.138 37.097 7.951 1.00174.58 C
ATOM 1072 SG CYS A 144 -22.874 38.655 8.499 1.00176.56 S
ATOM 1073 N VAL A 145 -19.789 39.392 7.733 1.00173.13 N
ATOM 1074 CA VAL A 145 -19.339 40.602 7.054 1.00173.44 C
ATOM 1075 C VAL A 145 -17.947 40.362 6.472 1.00173.94 C
ATOM 1076 O VAL A 145 -17.596 40.891 5.415 1.00174.75 O
ATOM 1077 CB VAL A 145 -19.328 41.816 8.018 1.00173.28 C
ATOM 1078 CG1 VAL A 145 -18.465 42.945 7.479 1.00173.02 C
ATOM 1079 CG2 VAL A 145 -20.746 42.305 8.262 1.00173.10 C
ATOM 1080 N ALA A 146 -17.169 39.525 7.150 1.00173.20 N
ATOM 1081 CA ALA A 146 -15.852 39.148 6.658 1.00173.38 C
ATOM 1082 C ALA A 146 -15.987 38.225 5.450 1.00173.57 C
ATOM 1083 O ALA A 146 -15.192 38.290 4.512 1.00173.81 O
ATOM 1084 CB ALA A 146 -15.044 38.478 7.755 1.00173.17 C
ATOM 1085 N TYR A 147 -17.001 37.365 5.485 1.00173.46 N
ATOM 1086 CA TYR A 147 -17.286 36.453 4.380 1.00173.77 C
ATOM 1087 C TYR A 147 -17.908 37.180 3.184 1.00174.22 C
ATOM 1088 O TYR A 147 -18.040 36.613 2.099 1.00174.21 O
ATOM 1089 CB TYR A 147 -18.207 35.328 4.858 1.00173.61 C
ATOM 1090 CG TYR A 147 -18.644 34.370 3.775 1.00173.29 C
ATOM 1091 CD1 TYR A 147 -17.749 33.472 3.212 1.00173.32 C
ATOM 1092 CD2 TYR A 147 -19.955 34.362 3.317 1.00173.34 C
ATOM 1093 CE1 TYR A 147 -18.145 32.595 2.223 1.00173.74 C
ATOM 1094 CE2 TYR A 147 -20.362 33.490 2.328 1.00173.49 C
ATOM 1095 CZ TYR A 147 -19.453 32.607 1.784 1.00174.05 C
ATOM 1096 OH TYR A 147 -19.856 31.735 0.799 1.00175.07 O
ATOM 1097 N SER A 148 -18.279 38.441 3.381 1.00173.93 N
ATOM 1098 CA SER A 148 -18.887 39.226 2.315 1.00172.98 C
ATOM 1099 C SER A 148 -17.871 39.571 1.233 1.00172.70 C
ATOM 1100 O SER A 148 -18.239 39.838 0.094 1.00172.52 O
ATOM 1101 CB SER A 148 -19.505 40.506 2.873 1.00173.16 C
ATOM 1102 OG SER A 148 -18.513 41.495 3.089 1.00173.38 O
ATOM 1103 N ALA A 149 -16.594 39.562 1.598 1.00172.82 N
ATOM 1104 CA ALA A 149 -15.529 39.885 0.654 1.00173.16 C
ATOM 1105 C ALA A 149 -15.263 38.756 -0.359 1.00173.99 C
ATOM 1106 O ALA A 149 -15.231 39.020 -1.560 1.00173.83 O
ATOM 1107 CB ALA A 149 -14.244 40.253 1.405 1.00173.31 C
ATOM 1108 N PRO A 150 -15.068 37.500 0.105 1.00174.74 N
ATOM 1109 CA PRO A 150 -14.905 36.452 -0.912 1.00174.50 C
ATOM 1110 C PRO A 150 -16.178 36.228 -1.728 1.00174.27 C
ATOM 1111 O PRO A 150 -16.101 35.842 -2.894 1.00174.39 O
ATOM 1112 CB PRO A 150 -14.559 35.207 -0.088 1.00174.32 C
ATOM 1113 CG PRO A 150 -15.115 35.479 1.260 1.00174.23 C
ATOM 1114 CD PRO A 150 -14.924 36.951 1.467 1.00174.70 C
ATOM 1115 N LEU A 151 -17.331 36.462 -1.109 1.00174.13 N
ATOM 1116 CA LEU A 151 -18.616 36.310 -1.782 1.00174.04 C
ATOM 1117 C LEU A 151 -18.802 37.366 -2.867 1.00174.15 C
ATOM 1118 O LEU A 151 -19.246 37.057 -3.976 1.00174.08 O
ATOM 1119 CB LEU A 151 -19.761 36.383 -0.773 1.00173.60 C
ATOM 1120 CG LEU A 151 -21.170 36.239 -1.348 1.00173.77 C
ATOM 1121 CD1 LEU A 151 -21.292 34.947 -2.137 1.00174.06 C
ATOM 1122 CD2 LEU A 151 -22.206 36.288 -0.240 1.00173.57 C
ATOM 1123 N ALA A 152 -18.465 38.611 -2.541 1.00174.23 N
ATOM 1124 CA ALA A 152 -18.575 39.715 -3.492 1.00173.89 C
ATOM 1125 C ALA A 152 -17.655 39.529 -4.694 1.00173.54 C
ATOM 1126 O ALA A 152 -17.857 40.145 -5.738 1.00173.03 O
ATOM 1127 CB ALA A 152 -18.268 41.028 -2.806 1.00173.65 C
ATOM 1128 N SER A 153 -16.652 38.672 -4.544 1.00173.82 N
ATOM 1129 CA SER A 153 -15.721 38.391 -5.626 1.00173.88 C
ATOM 1130 C SER A 153 -16.340 37.382 -6.582 1.00173.89 C
ATOM 1131 O SER A 153 -16.302 37.562 -7.800 1.00174.22 O
ATOM 1132 CB SER A 153 -14.393 37.870 -5.075 1.00174.18 C
ATOM 1133 OG SER A 153 -13.799 38.811 -4.196 1.00174.43 O
ATOM 1134 N ALA A 154 -16.908 36.321 -6.016 1.00173.68 N
ATOM 1135 CA ALA A 154 -17.667 35.346 -6.787 1.00173.98 C
ATOM 1136 C ALA A 154 -18.791 36.032 -7.556 1.00174.04 C
ATOM 1137 O ALA A 154 -19.031 35.729 -8.723 1.00174.47 O
ATOM 1138 CB ALA A 154 -18.225 34.266 -5.875 1.00174.01 C
ATOM 1139 N PHE A 155 -19.478 36.955 -6.891 1.00173.18 N
ATOM 1140 CA PHE A 155 -20.541 37.727 -7.521 1.00173.08 C
ATOM 1141 C PHE A 155 -20.009 38.551 -8.687 1.00173.68 C
ATOM 1142 O PHE A 155 -20.599 38.573 -9.767 1.00173.73 O
ATOM 1143 CB PHE A 155 -21.215 38.645 -6.502 1.00172.47 C
ATOM 1144 CG PHE A 155 -22.506 38.105 -5.968 1.00172.31 C
ATOM 1145 CD1 PHE A 155 -23.700 38.364 -6.618 1.00173.40 C
ATOM 1146 CD2 PHE A 155 -22.529 37.338 -4.816 1.00172.68 C
ATOM 1147 CE1 PHE A 155 -24.894 37.867 -6.132 1.00173.58 C
ATOM 1148 CE2 PHE A 155 -23.718 36.839 -4.325 1.00173.71 C
ATOM 1149 CZ PHE A 155 -24.902 37.103 -4.984 1.00173.81 C
ATOM 1150 N ALA A 156 -18.890 39.227 -8.453 1.00174.03 N
ATOM 1151 CA ALA A 156 -18.256 40.058 -9.469 1.00174.28 C
ATOM 1152 C ALA A 156 -17.801 39.230 -10.664 1.00173.52 C
ATOM 1153 O ALA A 156 -17.936 39.649 -11.813 1.00173.78 O
ATOM 1154 CB ALA A 156 -17.077 40.813 -8.873 1.00174.25 C
ATOM 1155 N VAL A 157 -17.260 38.052 -10.381 1.00172.64 N
ATOM 1156 CA VAL A 157 -16.694 37.196 -11.413 1.00172.17 C
ATOM 1157 C VAL A 157 -17.757 36.375 -12.154 1.00172.75 C
ATOM 1158 O VAL A 157 -17.600 36.078 -13.339 1.00173.66 O
ATOM 1159 CB VAL A 157 -15.613 36.264 -10.801 1.00172.58 C
ATOM 1160 CG1 VAL A 157 -15.831 34.809 -11.187 1.00172.83 C
ATOM 1161 CG2 VAL A 157 -14.222 36.738 -11.194 1.00172.93 C
ATOM 1162 N PHE A 158 -18.850 36.038 -11.473 1.00173.02 N
ATOM 1163 CA PHE A 158 -19.874 35.178 -12.069 1.00173.55 C
ATOM 1164 C PHE A 158 -21.125 35.913 -12.539 1.00173.13 C
ATOM 1165 O PHE A 158 -21.896 35.379 -13.335 1.00172.56 O
ATOM 1166 CB PHE A 158 -20.296 34.086 -11.083 1.00173.25 C
ATOM 1167 CG PHE A 158 -19.250 33.040 -10.851 1.00172.91 C
ATOM 1168 CD1 PHE A 158 -18.463 32.586 -11.896 1.00173.56 C
ATOM 1169 CD2 PHE A 158 -19.061 32.500 -9.592 1.00173.42 C
ATOM 1170 CE1 PHE A 158 -17.498 31.621 -11.685 1.00174.69 C
ATOM 1171 CE2 PHE A 158 -18.103 31.533 -9.375 1.00174.62 C
ATOM 1172 CZ PHE A 158 -17.318 31.092 -10.421 1.00175.50 C
ATOM 1173 N LEU A 159 -21.338 37.129 -12.051 1.00172.40 N
ATOM 1174 CA LEU A 159 -22.590 37.815 -12.341 1.00171.91 C
ATOM 1175 C LEU A 159 -22.406 39.255 -12.808 1.00172.87 C
ATOM 1176 O LEU A 159 -22.945 39.646 -13.839 1.00173.91 O
ATOM 1177 CB LEU A 159 -23.497 37.789 -11.110 1.00171.99 C
ATOM 1178 CG LEU A 159 -24.782 38.604 -11.246 1.00173.02 C
ATOM 1179 CD1 LEU A 159 -25.750 37.906 -12.186 1.00173.02 C
ATOM 1180 CD2 LEU A 159 -25.418 38.841 -9.888 1.00174.56 C
ATOM 1181 N ILE A 160 -21.638 40.035 -12.057 1.00172.69 N
ATOM 1182 CA ILE A 160 -21.470 41.453 -12.360 1.00173.18 C
ATOM 1183 C ILE A 160 -20.768 41.688 -13.698 1.00173.67 C
ATOM 1184 O ILE A 160 -21.253 42.452 -14.533 1.00173.80 O
ATOM 1185 CB ILE A 160 -20.692 42.168 -11.246 1.00172.93 C
ATOM 1186 CG1 ILE A 160 -21.373 41.935 -9.897 1.00172.80 C
ATOM 1187 CG2 ILE A 160 -20.581 43.655 -11.543 1.00173.06 C
ATOM 1188 CD1 ILE A 160 -22.835 42.326 -9.876 1.00172.70 C
ATOM 1189 N TYR A 161 -19.626 41.036 -13.900 1.00173.65 N
ATOM 1190 CA TYR A 161 -18.893 41.158 -15.160 1.00173.38 C
ATOM 1191 C TYR A 161 -19.705 40.689 -16.381 1.00173.06 C
ATOM 1192 O TYR A 161 -19.681 41.355 -17.415 1.00173.43 O
ATOM 1193 CB TYR A 161 -17.563 40.399 -15.083 1.00173.71 C
ATOM 1194 CG TYR A 161 -16.611 40.713 -16.218 1.00173.69 C
ATOM 1195 CD1 TYR A 161 -16.139 42.004 -16.415 1.00173.84 C
ATOM 1196 CD2 TYR A 161 -16.177 39.718 -17.084 1.00173.63 C
ATOM 1197 CE1 TYR A 161 -15.268 42.297 -17.450 1.00173.81 C
ATOM 1198 CE2 TYR A 161 -15.305 40.001 -18.120 1.00173.90 C
ATOM 1199 CZ TYR A 161 -14.854 41.291 -18.297 1.00173.64 C
ATOM 1200 OH TYR A 161 -13.987 41.573 -19.327 1.00173.21 O
ATOM 1201 N PRO A 162 -20.419 39.548 -16.278 1.00172.79 N
ATOM 1202 CA PRO A 162 -21.278 39.191 -17.412 1.00173.16 C
ATOM 1203 C PRO A 162 -22.374 40.215 -17.706 1.00173.07 C
ATOM 1204 O PRO A 162 -22.633 40.501 -18.876 1.00172.95 O
ATOM 1205 CB PRO A 162 -21.889 37.862 -16.971 1.00173.54 C
ATOM 1206 CG PRO A 162 -20.844 37.261 -16.120 1.00173.46 C
ATOM 1207 CD PRO A 162 -20.305 38.421 -15.332 1.00173.34 C
ATOM 1208 N ILE A 163 -23.015 40.742 -16.667 1.00173.03 N
ATOM 1209 CA ILE A 163 -24.031 41.776 -16.837 1.00172.84 C
ATOM 1210 C ILE A 163 -23.460 42.986 -17.570 1.00173.25 C
ATOM 1211 O ILE A 163 -24.032 43.456 -18.553 1.00173.22 O
ATOM 1212 CB ILE A 163 -24.608 42.235 -15.482 1.00173.00 C
ATOM 1213 CG1 ILE A 163 -25.482 41.140 -14.869 1.00173.45 C
ATOM 1214 CG2 ILE A 163 -25.425 43.505 -15.654 1.00173.28 C
ATOM 1215 CD1 ILE A 163 -25.900 41.432 -13.445 1.00173.97 C
ATOM 1216 N GLY A 164 -22.326 43.481 -17.083 1.00173.37 N
ATOM 1217 CA GLY A 164 -21.657 44.616 -17.691 1.00173.48 C
ATOM 1218 C GLY A 164 -21.252 44.373 -19.133 1.00172.90 C
ATOM 1219 O GLY A 164 -21.485 45.214 -20.002 1.00172.26 O
ATOM 1220 N GLN A 165 -20.642 43.221 -19.387 1.00173.31 N
ATOM 1221 CA GLN A 165 -20.163 42.896 -20.725 1.00173.69 C
ATOM 1222 C GLN A 165 -21.303 42.434 -21.629 1.00173.88 C
ATOM 1223 O GLN A 165 -21.133 42.316 -22.843 1.00174.11 O
ATOM 1224 CB GLN A 165 -19.075 41.824 -20.659 1.00174.05 C
ATOM 1225 CG GLN A 165 -17.802 42.280 -19.968 1.00173.68 C
ATOM 1226 CD GLN A 165 -17.142 43.447 -20.674 1.00173.12 C
ATOM 1227 OE1 GLN A 165 -17.160 44.575 -20.182 1.00173.14 O
ATOM 1228 NE2 GLN A 165 -16.558 43.181 -21.837 1.00172.71 N
ATOM 1229 N GLY A 166 -22.462 42.169 -21.036 1.00173.44 N
ATOM 1230 CA GLY A 166 -23.648 41.843 -21.807 1.00174.00 C
ATOM 1231 C GLY A 166 -23.842 40.378 -22.157 1.00173.73 C
ATOM 1232 O GLY A 166 -24.711 40.048 -22.964 1.00174.09 O
ATOM 1233 N SER A 167 -23.046 39.496 -21.559 1.00173.74 N
ATOM 1234 CA SER A 167 -23.170 38.065 -21.829 1.00174.18 C
ATOM 1235 C SER A 167 -22.535 37.208 -20.738 1.00174.09 C
ATOM 1236 O SER A 167 -21.492 37.557 -20.186 1.00174.28 O
ATOM 1237 CB SER A 167 -22.543 37.726 -23.185 1.00173.90 C
ATOM 1238 OG SER A 167 -22.317 36.332 -23.313 1.00174.22 O
ATOM 1239 N PHE A 168 -23.166 36.076 -20.440 1.00173.42 N
ATOM 1240 CA PHE A 168 -22.645 35.148 -19.442 1.00172.80 C
ATOM 1241 C PHE A 168 -21.481 34.340 -19.999 1.00172.77 C
ATOM 1242 O PHE A 168 -20.778 33.658 -19.259 1.00173.43 O
ATOM 1243 CB PHE A 168 -23.743 34.204 -18.950 1.00173.06 C
ATOM 1244 CG PHE A 168 -24.696 34.836 -17.977 1.00174.61 C
ATOM 1245 CD1 PHE A 168 -25.964 35.227 -18.377 1.00174.65 C
ATOM 1246 CD2 PHE A 168 -24.319 35.052 -16.661 1.00175.43 C
ATOM 1247 CE1 PHE A 168 -26.840 35.814 -17.481 1.00175.04 C
ATOM 1248 CE2 PHE A 168 -25.188 35.638 -15.761 1.00175.15 C
ATOM 1249 CZ PHE A 168 -26.449 36.021 -16.170 1.00174.98 C
ATOM 1250 N SER A 169 -21.281 34.421 -21.311 1.00172.92 N
ATOM 1251 CA SER A 169 -20.198 33.695 -21.960 1.00173.15 C
ATOM 1252 C SER A 169 -18.847 34.271 -21.555 1.00172.31 C
ATOM 1253 O SER A 169 -17.814 33.633 -21.718 1.00172.29 O
ATOM 1254 CB SER A 169 -20.352 33.735 -23.480 1.00174.37 C
ATOM 1255 OG SER A 169 -20.096 35.028 -23.997 1.00175.12 O
ATOM 1256 N ASP A 170 -18.865 35.488 -21.031 1.00171.62 N
ATOM 1257 CA ASP A 170 -17.651 36.171 -20.623 1.00171.82 C
ATOM 1258 C ASP A 170 -17.437 36.071 -19.120 1.00172.46 C
ATOM 1259 O ASP A 170 -16.520 36.679 -18.574 1.00172.97 O
ATOM 1260 CB ASP A 170 -17.711 37.633 -21.069 1.00173.93 C
ATOM 1261 CG ASP A 170 -16.941 37.875 -22.355 1.00174.33 C
ATOM 1262 OD1 ASP A 170 -17.503 38.505 -23.280 1.00175.48 O
ATOM 1263 OD2 ASP A 170 -15.795 37.382 -22.457 1.00173.48 O
ATOM 1264 N GLY A 171 -18.283 35.298 -18.453 1.00172.91 N
ATOM 1265 CA GLY A 171 -18.087 35.052 -17.042 1.00173.88 C
ATOM 1266 C GLY A 171 -16.989 34.012 -16.897 1.00173.88 C
ATOM 1267 O GLY A 171 -16.712 33.249 -17.830 1.00173.97 O
ATOM 1268 N MET A 172 -16.340 33.991 -15.738 1.00173.51 N
ATOM 1269 CA MET A 172 -15.231 33.073 -15.513 1.00172.90 C
ATOM 1270 C MET A 172 -15.712 31.633 -15.557 1.00172.46 C
ATOM 1271 O MET A 172 -16.672 31.276 -14.877 1.00173.42 O
ATOM 1272 CB MET A 172 -14.552 33.351 -14.172 1.00172.93 C
ATOM 1273 CG MET A 172 -13.402 32.408 -13.858 1.00172.33 C
ATOM 1274 SD MET A 172 -12.723 32.682 -12.212 1.00168.61 S
ATOM 1275 CE MET A 172 -13.687 31.532 -11.237 1.00173.60 C
ATOM 1276 N PRO A 173 -15.049 30.803 -16.371 1.00171.93 N
ATOM 1277 CA PRO A 173 -15.366 29.379 -16.486 1.00172.90 C
ATOM 1278 C PRO A 173 -15.163 28.649 -15.164 1.00172.84 C
ATOM 1279 O PRO A 173 -14.456 29.145 -14.287 1.00172.49 O
ATOM 1280 CB PRO A 173 -14.373 28.887 -17.543 1.00173.44 C
ATOM 1281 CG PRO A 173 -14.050 30.107 -18.341 1.00172.68 C
ATOM 1282 CD PRO A 173 -14.007 31.205 -17.329 1.00172.66 C
ATOM 1283 N LEU A 174 -15.771 27.477 -15.035 1.00172.55 N
ATOM 1284 CA LEU A 174 -15.663 26.696 -13.813 1.00172.28 C
ATOM 1285 C LEU A 174 -14.577 25.638 -13.946 1.00172.67 C
ATOM 1286 O LEU A 174 -14.869 24.451 -14.085 1.00172.43 O
ATOM 1287 CB LEU A 174 -17.003 26.042 -13.478 1.00172.99 C
ATOM 1288 CG LEU A 174 -18.202 26.984 -13.360 1.00173.21 C
ATOM 1289 CD1 LEU A 174 -19.435 26.230 -12.892 1.00174.45 C
ATOM 1290 CD2 LEU A 174 -17.886 28.132 -12.417 1.00173.61 C
ATOM 1291 N GLY A 175 -13.324 26.078 -13.909 1.00172.93 N
ATOM 1292 CA GLY A 175 -12.200 25.170 -14.036 1.00172.96 C
ATOM 1293 C GLY A 175 -10.860 25.853 -13.859 1.00173.36 C
ATOM 1294 O GLY A 175 -10.767 27.080 -13.891 1.00173.58 O
ATOM 1295 N ILE A 176 -9.824 25.047 -13.660 1.00173.32 N
ATOM 1296 CA ILE A 176 -8.470 25.550 -13.456 1.00174.03 C
ATOM 1297 C ILE A 176 -7.967 26.371 -14.644 1.00173.81 C
ATOM 1298 O ILE A 176 -7.796 27.585 -14.540 1.00173.70 O
ATOM 1299 CB ILE A 176 -7.486 24.396 -13.194 1.00174.04 C
ATOM 1300 CG1 ILE A 176 -8.055 23.437 -12.145 1.00172.72 C
ATOM 1301 CG2 ILE A 176 -6.138 24.935 -12.755 1.00174.80 C
ATOM 1302 CD1 ILE A 176 -8.213 24.057 -10.777 1.00172.93 C
ATOM 1303 N SER A 177 -7.725 25.698 -15.766 1.00173.19 N
ATOM 1304 CA SER A 177 -7.232 26.359 -16.970 1.00172.80 C
ATOM 1305 C SER A 177 -8.210 27.409 -17.487 1.00173.88 C
ATOM 1306 O SER A 177 -7.801 28.437 -18.026 1.00174.29 O
ATOM 1307 CB SER A 177 -6.945 25.330 -18.063 1.00172.62 C
ATOM 1308 OG SER A 177 -5.897 24.459 -17.678 1.00172.40 O
ATOM 1309 N GLY A 178 -9.503 27.141 -17.322 1.00174.28 N
ATOM 1310 CA GLY A 178 -10.535 28.083 -17.717 1.00174.25 C
ATOM 1311 C GLY A 178 -10.448 29.387 -16.945 1.00174.58 C
ATOM 1312 O GLY A 178 -10.805 30.448 -17.456 1.00175.15 O
ATOM 1313 N THR A 179 -9.967 29.301 -15.708 1.00174.15 N
ATOM 1314 CA THR A 179 -9.789 30.478 -14.868 1.00173.60 C
ATOM 1315 C THR A 179 -8.594 31.289 -15.361 1.00173.68 C
ATOM 1316 O THR A 179 -8.625 32.522 -15.366 1.00173.76 O
ATOM 1317 CB THR A 179 -9.588 30.094 -13.388 1.00172.91 C
ATOM 1318 OG1 THR A 179 -10.736 29.372 -12.923 1.00171.95 O
ATOM 1319 CG2 THR A 179 -9.395 31.331 -12.528 1.00173.67 C
ATOM 1320 N PHE A 180 -7.544 30.589 -15.780 1.00173.35 N
ATOM 1321 CA PHE A 180 -6.363 31.240 -16.335 1.00173.61 C
ATOM 1322 C PHE A 180 -6.716 32.026 -17.593 1.00173.32 C
ATOM 1323 O PHE A 180 -6.200 33.119 -17.818 1.00173.35 O
ATOM 1324 CB PHE A 180 -5.275 30.215 -16.656 1.00174.03 C
ATOM 1325 CG PHE A 180 -4.843 29.392 -15.478 1.00173.05 C
ATOM 1326 CD1 PHE A 180 -4.870 29.919 -14.199 1.00173.33 C
ATOM 1327 CD2 PHE A 180 -4.401 28.092 -15.653 1.00172.61 C
ATOM 1328 CE1 PHE A 180 -4.470 29.163 -13.115 1.00174.74 C
ATOM 1329 CE2 PHE A 180 -3.999 27.332 -14.574 1.00173.80 C
ATOM 1330 CZ PHE A 180 -4.034 27.868 -13.303 1.00175.01 C
ATOM 1331 N ASN A 181 -7.609 31.465 -18.403 1.00173.22 N
ATOM 1332 CA ASN A 181 -8.067 32.126 -19.618 1.00173.10 C
ATOM 1333 C ASN A 181 -8.781 33.428 -19.293 1.00172.89 C
ATOM 1334 O ASN A 181 -8.548 34.449 -19.936 1.00173.14 O
ATOM 1335 CB ASN A 181 -8.991 31.204 -20.418 1.00173.37 C
ATOM 1336 CG ASN A 181 -9.274 31.729 -21.814 1.00172.79 C
ATOM 1337 OD1 ASN A 181 -10.076 32.646 -21.992 1.00172.17 O
ATOM 1338 ND2 ASN A 181 -8.615 31.150 -22.813 1.00172.73 N
ATOM 1339 N PHE A 182 -9.657 33.378 -18.294 1.00172.66 N
ATOM 1340 CA PHE A 182 -10.372 34.561 -17.829 1.00172.61 C
ATOM 1341 C PHE A 182 -9.425 35.696 -17.446 1.00172.78 C
ATOM 1342 O PHE A 182 -9.686 36.856 -17.752 1.00173.12 O
ATOM 1343 CB PHE A 182 -11.267 34.206 -16.642 1.00173.54 C
ATOM 1344 CG PHE A 182 -12.083 35.360 -16.137 1.00174.14 C
ATOM 1345 CD1 PHE A 182 -13.196 35.795 -16.837 1.00173.85 C
ATOM 1346 CD2 PHE A 182 -11.735 36.012 -14.966 1.00175.45 C
ATOM 1347 CE1 PHE A 182 -13.949 36.859 -16.376 1.00174.33 C
ATOM 1348 CE2 PHE A 182 -12.485 37.077 -14.500 1.00175.95 C
ATOM 1349 CZ PHE A 182 -13.593 37.501 -15.207 1.00175.03 C
ATOM 1350 N MET A 183 -8.325 35.355 -16.780 1.00172.65 N
ATOM 1351 CA MET A 183 -7.354 36.352 -16.337 1.00173.39 C
ATOM 1352 C MET A 183 -6.578 36.972 -17.492 1.00173.70 C
ATOM 1353 O MET A 183 -6.567 38.193 -17.653 1.00173.52 O
ATOM 1354 CB MET A 183 -6.373 35.738 -15.338 1.00173.50 C
ATOM 1355 CG MET A 183 -7.000 35.366 -14.018 1.00173.29 C
ATOM 1356 SD MET A 183 -5.782 34.903 -12.778 1.00171.73 S
ATOM 1357 CE MET A 183 -5.717 33.138 -13.046 1.00173.45 C
ATOM 1358 N ILE A 184 -5.919 36.123 -18.277 1.00173.54 N
ATOM 1359 CA ILE A 184 -5.097 36.569 -19.397 1.00172.65 C
ATOM 1360 C ILE A 184 -5.865 37.498 -20.331 1.00172.50 C
ATOM 1361 O ILE A 184 -5.364 38.552 -20.721 1.00172.68 O
ATOM 1362 CB ILE A 184 -4.558 35.374 -20.207 1.00172.70 C
ATOM 1363 CG1 ILE A 184 -3.750 34.441 -19.305 1.00172.49 C
ATOM 1364 CG2 ILE A 184 -3.705 35.857 -21.366 1.00173.41 C
ATOM 1365 CD1 ILE A 184 -3.066 33.318 -20.051 1.00172.93 C
ATOM 1366 N VAL A 185 -7.088 37.109 -20.673 1.00172.50 N
ATOM 1367 CA VAL A 185 -7.933 37.916 -21.544 1.00173.55 C
ATOM 1368 C VAL A 185 -8.321 39.228 -20.868 1.00173.66 C
ATOM 1369 O VAL A 185 -8.269 40.292 -21.485 1.00174.24 O
ATOM 1370 CB VAL A 185 -9.207 37.151 -21.958 1.00174.20 C
ATOM 1371 CG1 VAL A 185 -10.130 38.045 -22.770 1.00174.88 C
ATOM 1372 CG2 VAL A 185 -8.844 35.893 -22.741 1.00174.22 C
ATOM 1373 N PHE A 186 -8.718 39.138 -19.600 1.00173.37 N
ATOM 1374 CA PHE A 186 -9.041 40.310 -18.789 1.00174.05 C
ATOM 1375 C PHE A 186 -7.922 41.347 -18.820 1.00173.89 C
ATOM 1376 O PHE A 186 -8.154 42.520 -19.116 1.00174.14 O
ATOM 1377 CB PHE A 186 -9.318 39.898 -17.343 1.00173.85 C
ATOM 1378 CG PHE A 186 -10.201 40.852 -16.598 1.00173.50 C
ATOM 1379 CD1 PHE A 186 -11.570 40.654 -16.558 1.00172.82 C
ATOM 1380 CD2 PHE A 186 -9.665 41.942 -15.932 1.00173.61 C
ATOM 1381 CE1 PHE A 186 -12.388 41.525 -15.870 1.00172.83 C
ATOM 1382 CE2 PHE A 186 -10.480 42.819 -15.244 1.00173.32 C
ATOM 1383 CZ PHE A 186 -11.844 42.610 -15.214 1.00173.38 C
ATOM 1384 N GLN A 187 -6.711 40.899 -18.500 1.00173.26 N
ATOM 1385 CA GLN A 187 -5.519 41.741 -18.544 1.00173.35 C
ATOM 1386 C GLN A 187 -5.351 42.459 -19.882 1.00173.35 C
ATOM 1387 O GLN A 187 -4.957 43.618 -19.926 1.00173.27 O
ATOM 1388 CB GLN A 187 -4.275 40.898 -18.247 1.00173.26 C
ATOM 1389 CG GLN A 187 -2.953 41.610 -18.494 1.00173.20 C
ATOM 1390 CD GLN A 187 -2.824 42.886 -17.692 1.00173.64 C
ATOM 1391 OE1 GLN A 187 -3.237 42.950 -16.537 1.00173.44 O
ATOM 1392 NE2 GLN A 187 -2.247 43.914 -18.304 1.00174.59 N
ATOM 1393 N ALA A 188 -5.656 41.765 -20.971 1.00173.60 N
ATOM 1394 CA ALA A 188 -5.507 42.335 -22.307 1.00173.26 C
ATOM 1395 C ALA A 188 -6.458 43.501 -22.533 1.00173.02 C
ATOM 1396 O ALA A 188 -6.081 44.536 -23.079 1.00173.95 O
ATOM 1397 CB ALA A 188 -5.739 41.267 -23.364 1.00173.38 C
ATOM 1398 N GLU A 189 -7.699 43.311 -22.113 1.00172.58 N
ATOM 1399 CA GLU A 189 -8.772 44.243 -22.415 1.00172.98 C
ATOM 1400 C GLU A 189 -8.984 45.320 -21.372 1.00173.06 C
ATOM 1401 O GLU A 189 -9.641 46.325 -21.634 1.00173.42 O
ATOM 1402 CB GLU A 189 -10.056 43.462 -22.599 1.00173.09 C
ATOM 1403 CG GLU A 189 -9.838 42.270 -23.467 1.00173.24 C
ATOM 1404 CD GLU A 189 -11.116 41.766 -24.039 1.00173.18 C
ATOM 1405 OE1 GLU A 189 -12.074 41.607 -23.260 1.00172.70 O
ATOM 1406 OE2 GLU A 189 -11.164 41.555 -25.267 1.00173.13 O
ATOM 1407 N HIS A 190 -8.436 45.104 -20.185 1.00172.93 N
ATOM 1408 CA HIS A 190 -8.690 46.016 -19.087 1.00173.39 C
ATOM 1409 C HIS A 190 -7.400 46.487 -18.422 1.00173.99 C
ATOM 1410 O HIS A 190 -7.408 47.467 -17.680 1.00174.59 O
ATOM 1411 CB HIS A 190 -9.605 45.348 -18.059 1.00173.86 C
ATOM 1412 CG HIS A 190 -10.963 45.004 -18.591 1.00174.08 C
ATOM 1413 ND1 HIS A 190 -11.858 45.962 -19.016 1.00173.90 N
ATOM 1414 CD2 HIS A 190 -11.585 43.811 -18.754 1.00174.62 C
ATOM 1415 CE1 HIS A 190 -12.969 45.374 -19.424 1.00174.53 C
ATOM 1416 NE2 HIS A 190 -12.830 44.069 -19.274 1.00174.73 N
ATOM 1417 N ASN A 191 -6.293 45.803 -18.713 1.00173.65 N
ATOM 1418 CA ASN A 191 -5.001 46.115 -18.104 1.00173.77 C
ATOM 1419 C ASN A 191 -5.132 46.177 -16.582 1.00174.36 C
ATOM 1420 O ASN A 191 -4.866 47.208 -15.962 1.00174.66 O
ATOM 1421 CB ASN A 191 -4.451 47.431 -18.662 1.00173.10 C
ATOM 1422 CG ASN A 191 -2.981 47.631 -18.350 1.00173.14 C
ATOM 1423 OD1 ASN A 191 -2.251 46.675 -18.090 1.00173.25 O
ATOM 1424 ND2 ASN A 191 -2.539 48.883 -18.376 1.00173.20 N
ATOM 1425 N ILE A 192 -5.553 45.060 -15.995 1.00174.15 N
ATOM 1426 CA ILE A 192 -5.927 44.999 -14.584 1.00173.83 C
ATOM 1427 C ILE A 192 -4.745 45.233 -13.640 1.00173.96 C
ATOM 1428 O ILE A 192 -4.917 45.779 -12.550 1.00174.43 O
ATOM 1429 CB ILE A 192 -6.604 43.640 -14.254 1.00174.01 C
ATOM 1430 CG1 ILE A 192 -7.190 43.643 -12.842 1.00174.40 C
ATOM 1431 CG2 ILE A 192 -5.641 42.475 -14.460 1.00174.33 C
ATOM 1432 CD1 ILE A 192 -8.044 42.436 -12.543 1.00174.25 C
ATOM 1433 N LEU A 193 -3.549 44.826 -14.057 1.00173.39 N
ATOM 1434 CA LEU A 193 -2.350 45.031 -13.251 1.00172.79 C
ATOM 1435 C LEU A 193 -2.075 46.511 -12.998 1.00172.90 C
ATOM 1436 O LEU A 193 -1.458 46.872 -12.000 1.00172.94 O
ATOM 1437 CB LEU A 193 -1.141 44.386 -13.923 1.00172.53 C
ATOM 1438 CG LEU A 193 -1.176 42.858 -13.974 1.00173.31 C
ATOM 1439 CD1 LEU A 193 0.028 42.310 -14.727 1.00174.16 C
ATOM 1440 CD2 LEU A 193 -1.245 42.282 -12.569 1.00173.79 C
ATOM 1441 N MET A 194 -2.540 47.366 -13.902 1.00173.18 N
ATOM 1442 CA MET A 194 -2.329 48.802 -13.773 1.00173.46 C
ATOM 1443 C MET A 194 -3.557 49.492 -13.188 1.00174.06 C
ATOM 1444 O MET A 194 -3.788 50.675 -13.436 1.00174.71 O
ATOM 1445 CB MET A 194 -1.984 49.420 -15.128 1.00173.54 C
ATOM 1446 CG MET A 194 -0.621 49.024 -15.664 1.00173.43 C
ATOM 1447 SD MET A 194 0.713 49.615 -14.609 1.00173.36 S
ATOM 1448 CE MET A 194 1.037 51.217 -15.335 1.00173.80 C
ATOM 1449 N HIS A 195 -4.338 48.750 -12.410 1.00173.84 N
ATOM 1450 CA HIS A 195 -5.532 49.296 -11.772 1.00173.71 C
ATOM 1451 C HIS A 195 -5.389 49.256 -10.253 1.00173.68 C
ATOM 1452 O HIS A 195 -5.043 48.218 -9.689 1.00174.12 O
ATOM 1453 CB HIS A 195 -6.779 48.523 -12.215 1.00173.23 C
ATOM 1454 CG HIS A 195 -8.070 49.202 -11.875 1.00172.96 C
ATOM 1455 ND1 HIS A 195 -8.496 49.389 -10.576 1.00173.05 N
ATOM 1456 CD2 HIS A 195 -9.029 49.741 -12.665 1.00172.73 C
ATOM 1457 CE1 HIS A 195 -9.661 50.011 -10.582 1.00173.01 C
ATOM 1458 NE2 HIS A 195 -10.007 50.237 -11.837 1.00172.75 N
ATOM 1459 N PRO A 196 -5.649 50.394 -9.589 1.00173.26 N
ATOM 1460 CA PRO A 196 -5.515 50.561 -8.137 1.00173.59 C
ATOM 1461 C PRO A 196 -6.225 49.495 -7.306 1.00173.66 C
ATOM 1462 O PRO A 196 -5.654 48.998 -6.334 1.00173.44 O
ATOM 1463 CB PRO A 196 -6.151 51.932 -7.895 1.00173.37 C
ATOM 1464 CG PRO A 196 -5.883 52.670 -9.149 1.00172.61 C
ATOM 1465 CD PRO A 196 -6.080 51.647 -10.234 1.00172.96 C
ATOM 1466 N PHE A 197 -7.449 49.150 -7.691 1.00173.88 N
ATOM 1467 CA PHE A 197 -8.268 48.227 -6.913 1.00173.96 C
ATOM 1468 C PHE A 197 -7.663 46.838 -6.870 1.00173.04 C
ATOM 1469 O PHE A 197 -7.707 46.158 -5.844 1.00172.86 O
ATOM 1470 CB PHE A 197 -9.684 48.152 -7.480 1.00174.28 C
ATOM 1471 CG PHE A 197 -10.563 49.289 -7.061 1.00174.09 C
ATOM 1472 CD1 PHE A 197 -10.035 50.372 -6.379 1.00174.28 C
ATOM 1473 CD2 PHE A 197 -11.919 49.272 -7.334 1.00173.25 C
ATOM 1474 CE1 PHE A 197 -10.838 51.418 -5.984 1.00173.40 C
ATOM 1475 CE2 PHE A 197 -12.729 50.316 -6.942 1.00172.81 C
ATOM 1476 CZ PHE A 197 -12.188 51.391 -6.266 1.00172.65 C
ATOM 1477 N HIS A 198 -7.105 46.417 -7.997 1.00172.56 N
ATOM 1478 CA HIS A 198 -6.424 45.139 -8.060 1.00172.63 C
ATOM 1479 C HIS A 198 -5.165 45.148 -7.207 1.00173.22 C
ATOM 1480 O HIS A 198 -4.889 44.191 -6.490 1.00174.31 O
ATOM 1481 CB HIS A 198 -6.071 44.796 -9.502 1.00172.85 C
ATOM 1482 CG HIS A 198 -5.422 43.460 -9.651 1.00172.81 C
ATOM 1483 ND1 HIS A 198 -4.060 43.280 -9.549 1.00172.73 N
ATOM 1484 CD2 HIS A 198 -5.949 42.235 -9.875 1.00172.86 C
ATOM 1485 CE1 HIS A 198 -3.774 42.002 -9.716 1.00173.10 C
ATOM 1486 NE2 HIS A 198 -4.903 41.348 -9.917 1.00172.79 N
ATOM 1487 N GLN A 199 -4.410 46.238 -7.294 1.00173.22 N
ATOM 1488 CA GLN A 199 -3.191 46.411 -6.514 1.00173.62 C
ATOM 1489 C GLN A 199 -3.484 46.358 -5.020 1.00173.67 C
ATOM 1490 O GLN A 199 -2.727 45.767 -4.248 1.00173.68 O
ATOM 1491 CB GLN A 199 -2.512 47.728 -6.880 1.00173.89 C
ATOM 1492 CG GLN A 199 -1.985 47.759 -8.304 1.00174.17 C
ATOM 1493 CD GLN A 199 -1.529 49.136 -8.726 1.00175.04 C
ATOM 1494 OE1 GLN A 199 -2.297 50.097 -8.681 1.00175.00 O
ATOM 1495 NE2 GLN A 199 -0.274 49.242 -9.142 1.00175.98 N
ATOM 1496 N LEU A 200 -4.583 46.990 -4.619 1.00173.58 N
ATOM 1497 CA LEU A 200 -5.055 46.916 -3.242 1.00173.88 C
ATOM 1498 C LEU A 200 -5.422 45.483 -2.881 1.00174.07 C
ATOM 1499 O LEU A 200 -5.305 45.072 -1.727 1.00173.39 O
ATOM 1500 CB LEU A 200 -6.261 47.834 -3.033 1.00173.49 C
ATOM 1501 CG LEU A 200 -5.985 49.331 -2.899 1.00172.57 C
ATOM 1502 CD1 LEU A 200 -7.290 50.104 -2.799 1.00172.43 C
ATOM 1503 CD2 LEU A 200 -5.100 49.605 -1.693 1.00172.80 C
ATOM 1504 N GLY A 201 -5.868 44.729 -3.881 1.00174.42 N
ATOM 1505 CA GLY A 201 -6.229 43.337 -3.697 1.00174.37 C
ATOM 1506 C GLY A 201 -5.055 42.465 -3.299 1.00173.89 C
ATOM 1507 O GLY A 201 -5.132 41.729 -2.316 1.00173.75 O
ATOM 1508 N VAL A 202 -3.970 42.542 -4.064 1.00173.72 N
ATOM 1509 CA VAL A 202 -2.782 41.758 -3.753 1.00173.88 C
ATOM 1510 C VAL A 202 -2.167 42.272 -2.457 1.00174.44 C
ATOM 1511 O VAL A 202 -1.556 41.511 -1.709 1.00174.95 O
ATOM 1512 CB VAL A 202 -1.737 41.788 -4.907 1.00174.00 C
ATOM 1513 CG1 VAL A 202 -2.309 42.471 -6.137 1.00174.21 C
ATOM 1514 CG2 VAL A 202 -0.430 42.447 -4.471 1.00174.32 C
ATOM 1515 N ALA A 203 -2.362 43.559 -2.183 1.00173.92 N
ATOM 1516 CA ALA A 203 -1.877 44.158 -0.947 1.00174.23 C
ATOM 1517 C ALA A 203 -2.526 43.482 0.256 1.00174.81 C
ATOM 1518 O ALA A 203 -1.851 43.134 1.225 1.00174.89 O
ATOM 1519 CB ALA A 203 -2.155 45.652 -0.935 1.00173.91 C
ATOM 1520 N GLY A 204 -3.840 43.301 0.180 1.00174.90 N
ATOM 1521 CA GLY A 204 -4.577 42.581 1.203 1.00175.31 C
ATOM 1522 C GLY A 204 -4.209 41.111 1.247 1.00174.57 C
ATOM 1523 O GLY A 204 -4.095 40.520 2.320 1.00173.89 O
ATOM 1524 N VAL A 205 -4.023 40.520 0.071 1.00174.39 N
ATOM 1525 CA VAL A 205 -3.710 39.100 -0.037 1.00173.40 C
ATOM 1526 C VAL A 205 -2.277 38.799 0.402 1.00173.10 C
ATOM 1527 O VAL A 205 -2.048 37.874 1.181 1.00172.97 O
ATOM 1528 CB VAL A 205 -3.939 38.596 -1.476 1.00173.26 C
ATOM 1529 CG1 VAL A 205 -3.316 37.234 -1.677 1.00172.91 C
ATOM 1530 CG2 VAL A 205 -5.427 38.550 -1.778 1.00173.43 C
ATOM 1531 N PHE A 206 -1.316 39.574 -0.093 1.00173.34 N
ATOM 1532 CA PHE A 206 0.067 39.442 0.360 1.00173.89 C
ATOM 1533 C PHE A 206 0.155 39.746 1.850 1.00173.98 C
ATOM 1534 O PHE A 206 0.669 38.940 2.629 1.00174.15 O
ATOM 1535 CB PHE A 206 1.000 40.370 -0.420 1.00173.44 C
ATOM 1536 CG PHE A 206 1.428 39.823 -1.750 1.00173.26 C
ATOM 1537 CD1 PHE A 206 2.081 40.631 -2.665 1.00174.18 C
ATOM 1538 CD2 PHE A 206 1.180 38.503 -2.087 1.00173.02 C
ATOM 1539 CE1 PHE A 206 2.476 40.135 -3.892 1.00174.50 C
ATOM 1540 CE2 PHE A 206 1.572 38.001 -3.313 1.00172.83 C
ATOM 1541 CZ PHE A 206 2.221 38.819 -4.216 1.00173.57 C
ATOM 1542 N GLY A 207 -0.345 40.919 2.229 1.00173.53 N
ATOM 1543 CA GLY A 207 -0.409 41.326 3.621 1.00173.61 C
ATOM 1544 C GLY A 207 -1.090 40.283 4.484 1.00173.99 C
ATOM 1545 O GLY A 207 -0.603 39.954 5.565 1.00174.15 O
ATOM 1546 N GLY A 208 -2.221 39.773 4.003 1.00174.03 N
ATOM 1547 CA GLY A 208 -2.936 38.694 4.665 1.00174.40 C
ATOM 1548 C GLY A 208 -2.037 37.521 5.001 1.00173.84 C
ATOM 1549 O GLY A 208 -1.862 37.185 6.172 1.00173.71 O
ATOM 1550 N ALA A 209 -1.470 36.902 3.969 1.00173.50 N
ATOM 1551 CA ALA A 209 -0.509 35.816 4.135 1.00173.35 C
ATOM 1552 C ALA A 209 0.655 36.231 5.027 1.00173.30 C
ATOM 1553 O ALA A 209 1.144 35.440 5.833 1.00174.07 O
ATOM 1554 CB ALA A 209 0.007 35.356 2.782 1.00173.37 C
ATOM 1555 N LEU A 210 1.097 37.476 4.871 1.00172.92 N
ATOM 1556 CA LEU A 210 2.166 38.033 5.690 1.00173.36 C
ATOM 1557 C LEU A 210 1.744 38.032 7.158 1.00173.85 C
ATOM 1558 O LEU A 210 2.367 37.375 7.991 1.00174.14 O
ATOM 1559 CB LEU A 210 2.511 39.453 5.223 1.00173.55 C
ATOM 1560 CG LEU A 210 3.857 40.131 5.516 1.00173.64 C
ATOM 1561 CD1 LEU A 210 3.822 41.575 5.030 1.00173.52 C
ATOM 1562 CD2 LEU A 210 4.265 40.077 6.980 1.00174.00 C
ATOM 1563 N PHE A 211 0.687 38.780 7.460 1.00173.81 N
ATOM 1564 CA PHE A 211 0.164 38.891 8.820 1.00173.82 C
ATOM 1565 C PHE A 211 -0.256 37.542 9.406 1.00173.86 C
ATOM 1566 O PHE A 211 -0.086 37.303 10.602 1.00174.21 O
ATOM 1567 CB PHE A 211 -1.010 39.871 8.851 1.00173.92 C
ATOM 1568 CG PHE A 211 -0.652 41.253 8.382 1.00174.11 C
ATOM 1569 CD1 PHE A 211 0.596 41.790 8.661 1.00173.59 C
ATOM 1570 CD2 PHE A 211 -1.556 42.014 7.660 1.00174.71 C
ATOM 1571 CE1 PHE A 211 0.933 43.056 8.230 1.00173.32 C
ATOM 1572 CE2 PHE A 211 -1.223 43.284 7.225 1.00174.43 C
ATOM 1573 CZ PHE A 211 0.024 43.804 7.512 1.00173.58 C
ATOM 1574 N CYS A 212 -0.825 36.674 8.572 1.00173.34 N
ATOM 1575 CA CYS A 212 -1.177 35.324 9.006 1.00173.22 C
ATOM 1576 C CYS A 212 0.048 34.571 9.514 1.00173.45 C
ATOM 1577 O CYS A 212 -0.021 33.854 10.512 1.00173.42 O
ATOM 1578 CB CYS A 212 -1.834 34.545 7.867 1.00173.26 C
ATOM 1579 SG CYS A 212 -2.305 32.853 8.297 1.00172.34 S
ATOM 1580 N ALA A 213 1.167 34.742 8.817 1.00173.71 N
ATOM 1581 CA ALA A 213 2.432 34.150 9.230 1.00174.03 C
ATOM 1582 C ALA A 213 2.996 34.904 10.430 1.00174.07 C
ATOM 1583 O ALA A 213 3.570 34.301 11.337 1.00173.48 O
ATOM 1584 CB ALA A 213 3.429 34.154 8.077 1.00174.54 C
ATOM 1585 N MET A 214 2.831 36.225 10.416 1.00174.36 N
ATOM 1586 CA MET A 214 3.249 37.087 11.518 1.00174.20 C
ATOM 1587 C MET A 214 2.645 36.641 12.835 1.00173.96 C
ATOM 1588 O MET A 214 3.356 36.190 13.735 1.00173.76 O
ATOM 1589 CB MET A 214 2.859 38.543 11.244 1.00173.85 C
ATOM 1590 CG MET A 214 3.875 39.357 10.445 1.00173.62 C
ATOM 1591 SD MET A 214 5.293 39.944 11.405 1.00172.94 S
ATOM 1592 CE MET A 214 6.356 38.502 11.444 1.00173.67 C
ATOM 1593 N HIS A 215 1.326 36.783 12.934 1.00174.06 N
ATOM 1594 CA HIS A 215 0.588 36.376 14.119 1.00174.23 C
ATOM 1595 C HIS A 215 0.865 34.927 14.490 1.00174.71 C
ATOM 1596 O HIS A 215 1.276 34.635 15.614 1.00174.75 O
ATOM 1597 CB HIS A 215 -0.913 36.575 13.927 1.00173.79 C
ATOM 1598 CG HIS A 215 -1.695 36.380 15.184 1.00173.88 C
ATOM 1599 ND1 HIS A 215 -1.815 37.364 16.140 1.00173.75 N
ATOM 1600 CD2 HIS A 215 -2.361 35.304 15.664 1.00173.75 C
ATOM 1601 CE1 HIS A 215 -2.540 36.910 17.147 1.00173.39 C
ATOM 1602 NE2 HIS A 215 -2.880 35.661 16.884 1.00173.21 N
ATOM 1603 N GLY A 216 0.595 34.028 13.547 1.00174.90 N
ATOM 1604 CA GLY A 216 0.894 32.615 13.691 1.00174.71 C
ATOM 1605 C GLY A 216 2.219 32.315 14.367 1.00174.96 C
ATOM 1606 O GLY A 216 2.268 31.558 15.335 1.00174.98 O
ATOM 1607 N SER A 217 3.291 32.912 13.855 1.00174.78 N
ATOM 1608 CA SER A 217 4.634 32.675 14.376 1.00174.62 C
ATOM 1609 C SER A 217 4.822 33.262 15.771 1.00174.27 C
ATOM 1610 O SER A 217 5.201 32.552 16.700 1.00173.91 O
ATOM 1611 CB SER A 217 5.683 33.251 13.425 1.00173.58 C
ATOM 1612 OG SER A 217 5.588 34.662 13.354 1.00172.46 O
ATOM 1613 N LEU A 218 4.566 34.561 15.902 1.00174.10 N
ATOM 1614 CA LEU A 218 4.680 35.268 17.179 1.00173.89 C
ATOM 1615 C LEU A 218 3.995 34.541 18.338 1.00174.20 C
ATOM 1616 O LEU A 218 4.599 34.321 19.388 1.00174.57 O
ATOM 1617 CB LEU A 218 4.108 36.682 17.052 1.00173.81 C
ATOM 1618 CG LEU A 218 5.122 37.806 16.819 1.00174.03 C
ATOM 1619 CD1 LEU A 218 6.156 37.411 15.767 1.00174.30 C
ATOM 1620 CD2 LEU A 218 4.422 39.102 16.434 1.00174.32 C
ATOM 1621 N VAL A 219 2.731 34.175 18.142 1.00173.89 N
ATOM 1622 CA VAL A 219 1.968 33.470 19.167 1.00173.50 C
ATOM 1623 C VAL A 219 2.586 32.116 19.513 1.00173.87 C
ATOM 1624 O VAL A 219 2.911 31.857 20.672 1.00174.57 O
ATOM 1625 CB VAL A 219 0.506 33.259 18.740 1.00172.92 C
ATOM 1626 CG1 VAL A 219 -0.205 32.354 19.729 1.00173.68 C
ATOM 1627 CG2 VAL A 219 -0.209 34.594 18.646 1.00172.71 C
ATOM 1628 N THR A 220 2.744 31.256 18.509 1.00173.38 N
ATOM 1629 CA THR A 220 3.270 29.906 18.723 1.00174.05 C
ATOM 1630 C THR A 220 4.704 29.918 19.266 1.00174.56 C
ATOM 1631 O THR A 220 5.159 28.933 19.849 1.00174.71 O
ATOM 1632 CB THR A 220 3.228 29.066 17.424 1.00173.47 C
ATOM 1633 OG1 THR A 220 3.380 27.676 17.740 1.00174.27 O
ATOM 1634 CG2 THR A 220 4.328 29.484 16.463 1.00173.01 C
ATOM 1635 N SER A 221 5.414 31.025 19.065 1.00174.51 N
ATOM 1636 CA SER A 221 6.774 31.166 19.579 1.00174.13 C
ATOM 1637 C SER A 221 6.779 31.630 21.034 1.00174.27 C
ATOM 1638 O SER A 221 7.762 31.441 21.750 1.00173.84 O
ATOM 1639 CB SER A 221 7.575 32.142 18.720 1.00173.41 C
ATOM 1640 OG SER A 221 7.030 33.447 18.785 1.00173.27 O
ATOM 1641 N SER A 222 5.679 32.235 21.470 1.00174.62 N
ATOM 1642 CA SER A 222 5.592 32.751 22.833 1.00174.43 C
ATOM 1643 C SER A 222 4.629 31.929 23.682 1.00174.82 C
ATOM 1644 O SER A 222 3.841 32.478 24.451 1.00174.97 O
ATOM 1645 CB SER A 222 5.158 34.219 22.823 1.00173.97 C
ATOM 1646 OG SER A 222 3.860 34.365 22.271 1.00173.36 O
ATOM 1647 N LEU A 223 4.712 30.609 23.548 1.00174.92 N
ATOM 1648 CA LEU A 223 3.852 29.703 24.299 1.00174.26 C
ATOM 1649 C LEU A 223 4.442 29.396 25.670 1.00173.69 C
ATOM 1650 O LEU A 223 5.651 29.217 25.809 1.00174.03 O
ATOM 1651 CB LEU A 223 3.631 28.400 23.523 1.00173.89 C
ATOM 1652 CG LEU A 223 2.897 28.472 22.184 1.00173.73 C
ATOM 1653 CD1 LEU A 223 2.739 27.083 21.593 1.00173.47 C
ATOM 1654 CD2 LEU A 223 1.542 29.129 22.360 1.00174.00 C
ATOM 1655 N ILE A 224 3.584 29.352 26.683 1.00173.14 N
ATOM 1656 CA ILE A 224 4.014 28.994 28.028 1.00174.01 C
ATOM 1657 C ILE A 224 4.350 27.507 28.083 1.00174.47 C
ATOM 1658 O ILE A 224 3.614 26.678 27.552 1.00174.55 O
ATOM 1659 CB ILE A 224 2.934 29.328 29.074 1.00174.80 C
ATOM 1660 CG1 ILE A 224 2.431 30.760 28.879 1.00174.20 C
ATOM 1661 CG2 ILE A 224 3.482 29.152 30.482 1.00174.86 C
ATOM 1662 CD1 ILE A 224 1.193 31.090 29.683 1.00174.56 C
ATOM 1663 N ARG A 225 5.470 27.175 28.716 1.00174.76 N
ATOM 1664 CA ARG A 225 5.917 25.789 28.798 1.00174.24 C
ATOM 1665 C ARG A 225 5.061 24.951 29.741 1.00174.50 C
ATOM 1666 O ARG A 225 4.919 25.273 30.921 1.00174.63 O
ATOM 1667 CB ARG A 225 7.379 25.734 29.244 1.00173.89 C
ATOM 1668 CG ARG A 225 7.885 24.342 29.565 1.00173.56 C
ATOM 1669 CD ARG A 225 9.230 24.410 30.270 1.00173.18 C
ATOM 1670 NE ARG A 225 10.020 25.559 29.832 1.00173.28 N
ATOM 1671 CZ ARG A 225 11.256 25.819 30.249 1.00173.74 C
ATOM 1672 NH1 ARG A 225 11.851 25.012 31.116 1.00174.28 N
ATOM 1673 NH2 ARG A 225 11.897 26.889 29.799 1.00173.63 N
ATOM 1674 N GLU A 226 4.502 23.868 29.209 1.00174.02 N
ATOM 1675 CA GLU A 226 3.745 22.905 30.003 1.00174.47 C
ATOM 1676 C GLU A 226 3.926 21.504 29.432 1.00175.08 C
ATOM 1677 O GLU A 226 3.230 20.566 29.826 1.00176.86 O
ATOM 1678 CB GLU A 226 2.257 23.266 30.047 1.00173.85 C
ATOM 1679 CG GLU A 226 1.901 24.371 31.031 1.00173.61 C
ATOM 1680 CD GLU A 226 1.368 25.615 30.350 1.00173.64 C
ATOM 1681 OE1 GLU A 226 0.892 26.525 31.060 1.00173.20 O
ATOM 1682 OE2 GLU A 226 1.432 25.688 29.104 1.00174.22 O
ATOM 1683 N THR A 227 4.860 21.367 28.494 1.00173.96 N
ATOM 1684 CA THR A 227 5.081 20.100 27.809 1.00173.31 C
ATOM 1685 C THR A 227 6.484 19.552 28.045 1.00173.14 C
ATOM 1686 O THR A 227 7.401 20.294 28.394 1.00173.20 O
ATOM 1687 CB THR A 227 4.860 20.245 26.296 1.00173.54 C
ATOM 1688 OG1 THR A 227 5.882 21.081 25.742 1.00173.73 O
ATOM 1689 CG2 THR A 227 3.503 20.865 26.018 1.00173.51 C
ATOM 1690 N THR A 228 6.640 18.246 27.851 1.00173.00 N
ATOM 1691 CA THR A 228 7.933 17.593 28.004 1.00173.50 C
ATOM 1692 C THR A 228 8.827 17.902 26.803 1.00173.78 C
ATOM 1693 O THR A 228 8.375 18.484 25.817 1.00172.73 O
ATOM 1694 CB THR A 228 7.780 16.065 28.159 1.00173.76 C
ATOM 1695 OG1 THR A 228 6.489 15.766 28.701 1.00174.42 O
ATOM 1696 CG2 THR A 228 8.858 15.502 29.078 1.00173.06 C
ATOM 1697 N GLU A 229 10.094 17.509 26.891 1.00174.93 N
ATOM 1698 CA GLU A 229 11.045 17.724 25.805 1.00174.87 C
ATOM 1699 C GLU A 229 10.737 16.802 24.629 1.00173.89 C
ATOM 1700 O GLU A 229 11.008 17.134 23.475 1.00172.76 O
ATOM 1701 CB GLU A 229 12.477 17.497 26.302 1.00175.26 C
ATOM 1702 CG GLU A 229 13.559 17.724 25.256 1.00174.52 C
ATOM 1703 CD GLU A 229 13.665 19.176 24.829 1.00174.78 C
ATOM 1704 OE1 GLU A 229 13.290 20.065 25.624 1.00174.10 O
ATOM 1705 OE2 GLU A 229 14.126 19.431 23.697 1.00174.80 O
ATOM 1706 N THR A 230 10.155 15.647 24.930 1.00174.48 N
ATOM 1707 CA THR A 230 9.795 14.682 23.901 1.00174.45 C
ATOM 1708 C THR A 230 8.286 14.487 23.875 1.00174.56 C
ATOM 1709 O THR A 230 7.787 13.362 23.824 1.00174.52 O
ATOM 1710 CB THR A 230 10.489 13.327 24.126 1.00174.95 C
ATOM 1711 OG1 THR A 230 10.318 12.918 25.490 1.00174.66 O
ATOM 1712 CG2 THR A 230 11.975 13.430 23.812 1.00174.51 C
ATOM 1713 N GLU A 231 7.565 15.601 23.916 1.00174.19 N
ATOM 1714 CA GLU A 231 6.111 15.586 23.895 1.00173.89 C
ATOM 1715 C GLU A 231 5.614 16.768 23.077 1.00174.50 C
ATOM 1716 O GLU A 231 6.164 17.866 23.171 1.00174.78 O
ATOM 1717 CB GLU A 231 5.550 15.632 25.320 1.00173.44 C
ATOM 1718 CG GLU A 231 4.075 15.991 25.411 1.00173.64 C
ATOM 1719 CD GLU A 231 3.604 16.176 26.842 1.00172.66 C
ATOM 1720 OE1 GLU A 231 3.563 15.176 27.588 1.00172.52 O
ATOM 1721 OE2 GLU A 231 3.271 17.319 27.219 1.00172.06 O
ATOM 1722 N SER A 232 4.596 16.528 22.256 1.00174.08 N
ATOM 1723 CA SER A 232 4.000 17.564 21.416 1.00174.39 C
ATOM 1724 C SER A 232 3.632 18.824 22.195 1.00174.32 C
ATOM 1725 O SER A 232 2.883 18.766 23.172 1.00174.90 O
ATOM 1726 CB SER A 232 2.761 17.013 20.711 1.00175.34 C
ATOM 1727 OG SER A 232 1.950 18.063 20.214 1.00176.52 O
ATOM 1728 N ALA A 233 4.162 19.960 21.752 1.00173.01 N
ATOM 1729 CA ALA A 233 3.909 21.244 22.398 1.00172.71 C
ATOM 1730 C ALA A 233 2.438 21.660 22.328 1.00173.01 C
ATOM 1731 O ALA A 233 2.019 22.588 23.017 1.00173.14 O
ATOM 1732 CB ALA A 233 4.784 22.321 21.779 1.00172.51 C
ATOM 1733 N ASN A 234 1.663 20.971 21.498 1.00173.75 N
ATOM 1734 CA ASN A 234 0.244 21.270 21.333 1.00174.31 C
ATOM 1735 C ASN A 234 -0.582 20.802 22.524 1.00173.27 C
ATOM 1736 O ASN A 234 -1.559 21.444 22.911 1.00173.36 O
ATOM 1737 CB ASN A 234 -0.289 20.629 20.051 1.00174.55 C
ATOM 1738 CG ASN A 234 -0.134 21.528 18.838 1.00173.38 C
ATOM 1739 OD1 ASN A 234 0.413 22.628 18.930 1.00173.61 O
ATOM 1740 ND2 ASN A 234 -0.617 21.063 17.692 1.00172.54 N
ATOM 1741 N TYR A 235 -0.183 19.671 23.097 1.00172.28 N
ATOM 1742 CA TYR A 235 -0.856 19.106 24.261 1.00172.99 C
ATOM 1743 C TYR A 235 -0.834 20.030 25.477 1.00173.86 C
ATOM 1744 O TYR A 235 -1.595 19.830 26.421 1.00175.14 O
ATOM 1745 CB TYR A 235 -0.236 17.754 24.621 1.00174.59 C
ATOM 1746 CG TYR A 235 -0.718 16.630 23.736 1.00174.25 C
ATOM 1747 CD1 TYR A 235 -0.094 16.356 22.529 1.00173.14 C
ATOM 1748 CD2 TYR A 235 -1.808 15.852 24.103 1.00175.58 C
ATOM 1749 CE1 TYR A 235 -0.537 15.334 21.712 1.00173.74 C
ATOM 1750 CE2 TYR A 235 -2.259 14.828 23.294 1.00176.24 C
ATOM 1751 CZ TYR A 235 -1.619 14.574 22.100 1.00175.29 C
ATOM 1752 OH TYR A 235 -2.067 13.555 21.294 1.00175.70 O
ATOM 1753 N GLY A 236 0.033 21.040 25.457 1.00173.55 N
ATOM 1754 CA GLY A 236 0.077 22.024 26.526 1.00173.68 C
ATOM 1755 C GLY A 236 -1.111 22.971 26.531 1.00172.96 C
ATOM 1756 O GLY A 236 -1.060 24.048 27.126 1.00172.50 O
ATOM 1757 N TYR A 237 -2.185 22.564 25.864 1.00172.74 N
ATOM 1758 CA TYR A 237 -3.422 23.326 25.836 1.00172.92 C
ATOM 1759 C TYR A 237 -4.612 22.380 25.898 1.00173.48 C
ATOM 1760 O TYR A 237 -4.632 21.345 25.232 1.00173.45 O
ATOM 1761 CB TYR A 237 -3.499 24.200 24.583 1.00173.49 C
ATOM 1762 CG TYR A 237 -4.804 24.951 24.449 1.00174.41 C
ATOM 1763 CD1 TYR A 237 -4.984 26.184 25.061 1.00174.48 C
ATOM 1764 CD2 TYR A 237 -5.859 24.426 23.713 1.00174.94 C
ATOM 1765 CE1 TYR A 237 -6.177 26.873 24.945 1.00174.94 C
ATOM 1766 CE2 TYR A 237 -7.056 25.107 23.592 1.00175.29 C
ATOM 1767 CZ TYR A 237 -7.209 26.329 24.209 1.00175.42 C
ATOM 1768 OH TYR A 237 -8.397 27.010 24.089 1.00176.23 O
ATOM 1769 N LYS A 238 -5.602 22.745 26.704 1.00173.82 N
ATOM 1770 CA LYS A 238 -6.811 21.947 26.842 1.00173.69 C
ATOM 1771 C LYS A 238 -8.014 22.735 26.340 1.00173.19 C
ATOM 1772 O LYS A 238 -8.156 23.920 26.639 1.00173.10 O
ATOM 1773 CB LYS A 238 -7.016 21.522 28.298 1.00174.73 C
ATOM 1774 CG LYS A 238 -5.988 20.521 28.808 1.00174.89 C
ATOM 1775 CD LYS A 238 -5.989 19.252 27.971 1.00174.76 C
ATOM 1776 CE LYS A 238 -4.750 18.416 28.242 1.00174.00 C
ATOM 1777 NZ LYS A 238 -4.634 17.273 27.294 1.00173.85 N
ATOM 1778 N PHE A 239 -8.868 22.081 25.561 1.00173.10 N
ATOM 1779 CA PHE A 239 -10.077 22.720 25.057 1.00174.31 C
ATOM 1780 C PHE A 239 -10.960 23.201 26.202 1.00174.46 C
ATOM 1781 O PHE A 239 -11.404 22.408 27.030 1.00175.07 O
ATOM 1782 CB PHE A 239 -10.859 21.760 24.160 1.00175.16 C
ATOM 1783 CG PHE A 239 -12.103 22.361 23.573 1.00174.88 C
ATOM 1784 CD1 PHE A 239 -12.028 23.472 22.750 1.00174.43 C
ATOM 1785 CD2 PHE A 239 -13.347 21.817 23.847 1.00174.77 C
ATOM 1786 CE1 PHE A 239 -13.172 24.028 22.209 1.00174.82 C
ATOM 1787 CE2 PHE A 239 -14.494 22.368 23.309 1.00174.29 C
ATOM 1788 CZ PHE A 239 -14.406 23.475 22.490 1.00174.42 C
ATOM 1789 N GLY A 240 -11.201 24.507 26.249 1.00173.65 N
ATOM 1790 CA GLY A 240 -12.007 25.090 27.305 1.00174.11 C
ATOM 1791 C GLY A 240 -11.167 25.560 28.474 1.00174.80 C
ATOM 1792 O GLY A 240 -11.447 25.223 29.625 1.00176.25 O
ATOM 1793 N GLN A 241 -10.134 26.343 28.179 1.00173.56 N
ATOM 1794 CA GLN A 241 -9.264 26.882 29.216 1.00173.44 C
ATOM 1795 C GLN A 241 -9.811 28.192 29.769 1.00173.69 C
ATOM 1796 O GLN A 241 -10.632 28.852 29.134 1.00173.23 O
ATOM 1797 CB GLN A 241 -7.849 27.100 28.674 1.00172.95 C
ATOM 1798 CG GLN A 241 -6.938 25.888 28.785 1.00173.00 C
ATOM 1799 CD GLN A 241 -5.500 26.211 28.434 1.00173.47 C
ATOM 1800 OE1 GLN A 241 -5.164 27.359 28.141 1.00173.83 O
ATOM 1801 NE2 GLN A 241 -4.641 25.198 28.459 1.00173.34 N
ATOM 1802 N GLU A 242 -9.358 28.555 30.964 1.00174.34 N
ATOM 1803 CA GLU A 242 -9.718 29.836 31.554 1.00174.34 C
ATOM 1804 C GLU A 242 -8.703 30.891 31.137 1.00174.36 C
ATOM 1805 O GLU A 242 -9.052 31.890 30.509 1.00173.88 O
ATOM 1806 CB GLU A 242 -9.790 29.747 33.083 1.00175.09 C
ATOM 1807 CG GLU A 242 -11.056 29.096 33.633 1.00174.93 C
ATOM 1808 CD GLU A 242 -11.077 27.590 33.452 1.00176.08 C
ATOM 1809 OE1 GLU A 242 -12.153 26.984 33.644 1.00176.11 O
ATOM 1810 OE2 GLU A 242 -10.020 27.011 33.123 1.00176.79 O
ATOM 1811 N GLU A 243 -7.441 30.650 31.480 1.00174.89 N
ATOM 1812 CA GLU A 243 -6.362 31.582 31.173 1.00174.88 C
ATOM 1813 C GLU A 243 -5.787 31.367 29.774 1.00174.65 C
ATOM 1814 O GLU A 243 -6.106 30.389 29.098 1.00174.48 O
ATOM 1815 CB GLU A 243 -5.248 31.472 32.220 1.00174.72 C
ATOM 1816 CG GLU A 243 -5.288 30.199 33.060 1.00175.02 C
ATOM 1817 CD GLU A 243 -4.966 28.952 32.260 1.00175.16 C
ATOM 1818 OE1 GLU A 243 -5.879 28.123 32.057 1.00175.00 O
ATOM 1819 OE2 GLU A 243 -3.800 28.799 31.836 1.00174.74 O
ATOM 1820 N GLU A 244 -4.937 32.298 29.351 1.00174.46 N
ATOM 1821 CA GLU A 244 -4.328 32.256 28.025 1.00174.59 C
ATOM 1822 C GLU A 244 -3.242 31.183 27.957 1.00174.47 C
ATOM 1823 O GLU A 244 -2.682 30.790 28.980 1.00174.64 O
ATOM 1824 CB GLU A 244 -3.755 33.631 27.666 1.00174.36 C
ATOM 1825 CG GLU A 244 -3.279 33.766 26.229 1.00174.04 C
ATOM 1826 CD GLU A 244 -4.302 33.255 25.234 1.00174.22 C
ATOM 1827 OE1 GLU A 244 -5.398 33.848 25.146 1.00174.05 O
ATOM 1828 OE2 GLU A 244 -4.017 32.251 24.547 1.00174.28 O
ATOM 1829 N THR A 245 -2.945 30.717 26.746 1.00174.06 N
ATOM 1830 CA THR A 245 -1.948 29.673 26.549 1.00173.68 C
ATOM 1831 C THR A 245 -0.623 30.224 26.028 1.00173.39 C
ATOM 1832 O THR A 245 0.327 29.470 25.815 1.00172.97 O
ATOM 1833 CB THR A 245 -2.458 28.598 25.571 1.00173.59 C
ATOM 1834 OG1 THR A 245 -1.578 27.468 25.597 1.00174.03 O
ATOM 1835 CG2 THR A 245 -2.526 29.151 24.157 1.00173.22 C
ATOM 1836 N TYR A 246 -0.554 31.536 25.829 1.00173.66 N
ATOM 1837 CA TYR A 246 0.687 32.156 25.377 1.00174.18 C
ATOM 1838 C TYR A 246 0.921 33.510 26.036 1.00174.73 C
ATOM 1839 O TYR A 246 -0.025 34.205 26.406 1.00174.51 O
ATOM 1840 CB TYR A 246 0.693 32.304 23.850 1.00174.21 C
ATOM 1841 CG TYR A 246 -0.106 33.472 23.310 1.00174.25 C
ATOM 1842 CD1 TYR A 246 0.522 34.658 22.943 1.00173.86 C
ATOM 1843 CD2 TYR A 246 -1.481 33.382 23.143 1.00174.50 C
ATOM 1844 CE1 TYR A 246 -0.201 35.725 22.440 1.00173.79 C
ATOM 1845 CE2 TYR A 246 -2.213 34.446 22.640 1.00174.57 C
ATOM 1846 CZ TYR A 246 -1.566 35.614 22.291 1.00174.11 C
ATOM 1847 OH TYR A 246 -2.286 36.676 21.789 1.00173.02 O
ATOM 1848 N ASN A 247 2.191 33.877 26.174 1.00174.73 N
ATOM 1849 CA ASN A 247 2.570 35.133 26.806 1.00174.36 C
ATOM 1850 C ASN A 247 2.540 36.290 25.816 1.00174.12 C
ATOM 1851 O ASN A 247 3.543 36.582 25.163 1.00174.13 O
ATOM 1852 CB ASN A 247 3.960 35.014 27.435 1.00173.73 C
ATOM 1853 CG ASN A 247 4.149 35.945 28.619 1.00173.85 C
ATOM 1854 OD1 ASN A 247 3.771 37.116 28.572 1.00173.83 O
ATOM 1855 ND2 ASN A 247 4.744 35.426 29.687 1.00173.92 N
ATOM 1856 N ILE A 248 1.384 36.938 25.704 1.00173.85 N
ATOM 1857 CA ILE A 248 1.210 38.054 24.777 1.00173.87 C
ATOM 1858 C ILE A 248 2.111 39.235 25.143 1.00174.36 C
ATOM 1859 O ILE A 248 2.414 40.086 24.303 1.00174.02 O
ATOM 1860 CB ILE A 248 -0.267 38.518 24.742 1.00174.31 C
ATOM 1861 CG1 ILE A 248 -0.496 39.527 23.613 1.00173.88 C
ATOM 1862 CG2 ILE A 248 -0.691 39.075 26.097 1.00174.38 C
ATOM 1863 CD1 ILE A 248 -1.948 39.732 23.266 1.00173.56 C
ATOM 1864 N VAL A 249 2.568 39.268 26.391 1.00174.69 N
ATOM 1865 CA VAL A 249 3.411 40.358 26.862 1.00174.33 C
ATOM 1866 C VAL A 249 4.859 40.100 26.460 1.00173.72 C
ATOM 1867 O VAL A 249 5.638 41.030 26.251 1.00173.25 O
ATOM 1868 CB VAL A 249 3.318 40.530 28.389 1.00174.40 C
ATOM 1869 CG1 VAL A 249 3.973 41.832 28.818 1.00174.75 C
ATOM 1870 CG2 VAL A 249 1.863 40.499 28.837 1.00173.95 C
ATOM 1871 N ALA A 250 5.206 38.823 26.344 1.00173.95 N
ATOM 1872 CA ALA A 250 6.528 38.429 25.878 1.00174.14 C
ATOM 1873 C ALA A 250 6.585 38.522 24.358 1.00174.08 C
ATOM 1874 O ALA A 250 7.632 38.818 23.782 1.00174.11 O
ATOM 1875 CB ALA A 250 6.863 37.023 26.347 1.00174.95 C
ATOM 1876 N ALA A 251 5.449 38.258 23.720 1.00173.96 N
ATOM 1877 CA ALA A 251 5.321 38.399 22.275 1.00174.26 C
ATOM 1878 C ALA A 251 5.543 39.850 21.854 1.00174.44 C
ATOM 1879 O ALA A 251 6.350 40.134 20.970 1.00174.80 O
ATOM 1880 CB ALA A 251 3.954 37.911 21.813 1.00174.19 C
ATOM 1881 N HIS A 252 4.812 40.761 22.491 1.00174.18 N
ATOM 1882 CA HIS A 252 4.953 42.190 22.230 1.00173.93 C
ATOM 1883 C HIS A 252 6.363 42.697 22.520 1.00173.81 C
ATOM 1884 O HIS A 252 6.869 43.582 21.830 1.00173.27 O
ATOM 1885 CB HIS A 252 3.939 42.981 23.058 1.00174.00 C
ATOM 1886 CG HIS A 252 4.153 44.461 23.015 1.00174.91 C
ATOM 1887 ND1 HIS A 252 4.233 45.167 21.835 1.00175.09 N
ATOM 1888 CD2 HIS A 252 4.312 45.367 24.008 1.00175.79 C
ATOM 1889 CE1 HIS A 252 4.427 46.446 22.102 1.00175.35 C
ATOM 1890 NE2 HIS A 252 4.480 46.595 23.413 1.00175.87 N
ATOM 1891 N GLY A 253 6.989 42.134 23.548 1.00174.36 N
ATOM 1892 CA GLY A 253 8.347 42.497 23.910 1.00174.39 C
ATOM 1893 C GLY A 253 9.338 42.199 22.802 1.00173.85 C
ATOM 1894 O GLY A 253 10.251 42.983 22.548 1.00173.31 O
ATOM 1895 N TYR A 254 9.155 41.062 22.140 1.00174.02 N
ATOM 1896 CA TYR A 254 10.025 40.666 21.039 1.00173.83 C
ATOM 1897 C TYR A 254 9.775 41.496 19.787 1.00173.62 C
ATOM 1898 O TYR A 254 10.687 42.138 19.267 1.00173.49 O
ATOM 1899 CB TYR A 254 9.839 39.182 20.715 1.00174.65 C
ATOM 1900 CG TYR A 254 10.385 38.781 19.362 1.00174.25 C
ATOM 1901 CD1 TYR A 254 11.748 38.603 19.167 1.00173.76 C
ATOM 1902 CD2 TYR A 254 9.537 38.578 18.280 1.00174.04 C
ATOM 1903 CE1 TYR A 254 12.252 38.239 17.936 1.00173.53 C
ATOM 1904 CE2 TYR A 254 10.033 38.215 17.044 1.00173.85 C
ATOM 1905 CZ TYR A 254 11.391 38.045 16.878 1.00174.07 C
ATOM 1906 OH TYR A 254 11.890 37.682 15.650 1.00175.12 O
ATOM 1907 N PHE A 255 8.535 41.469 19.306 1.00173.72 N
ATOM 1908 CA PHE A 255 8.164 42.183 18.089 1.00173.78 C
ATOM 1909 C PHE A 255 8.355 43.686 18.252 1.00173.42 C
ATOM 1910 O PHE A 255 8.616 44.399 17.283 1.00172.82 O
ATOM 1911 CB PHE A 255 6.716 41.878 17.706 1.00173.77 C
ATOM 1912 CG PHE A 255 6.292 42.508 16.413 1.00173.13 C
ATOM 1913 CD1 PHE A 255 6.958 42.218 15.235 1.00172.90 C
ATOM 1914 CD2 PHE A 255 5.232 43.399 16.376 1.00173.77 C
ATOM 1915 CE1 PHE A 255 6.571 42.800 14.043 1.00173.84 C
ATOM 1916 CE2 PHE A 255 4.842 43.985 15.189 1.00174.03 C
ATOM 1917 CZ PHE A 255 5.512 43.685 14.019 1.00174.23 C
ATOM 1918 N GLY A 256 8.213 44.161 19.485 1.00173.60 N
ATOM 1919 CA GLY A 256 8.414 45.564 19.790 1.00174.05 C
ATOM 1920 C GLY A 256 9.864 45.963 19.612 1.00174.93 C
ATOM 1921 O GLY A 256 10.174 47.128 19.380 1.00175.27 O
ATOM 1922 N ARG A 257 10.760 44.988 19.737 1.00175.38 N
ATOM 1923 CA ARG A 257 12.186 45.236 19.570 1.00175.25 C
ATOM 1924 C ARG A 257 12.661 44.942 18.150 1.00175.32 C
ATOM 1925 O ARG A 257 13.717 45.419 17.733 1.00175.61 O
ATOM 1926 CB ARG A 257 12.983 44.417 20.583 1.00174.08 C
ATOM 1927 CG ARG A 257 12.774 44.896 22.006 1.00174.31 C
ATOM 1928 CD ARG A 257 13.559 44.085 23.015 1.00175.00 C
ATOM 1929 NE ARG A 257 13.740 44.805 24.273 1.00175.23 N
ATOM 1930 CZ ARG A 257 12.758 45.133 25.109 1.00174.96 C
ATOM 1931 NH1 ARG A 257 11.504 44.786 24.852 1.00174.26 N
ATOM 1932 NH2 ARG A 257 13.038 45.797 26.219 1.00175.00 N
ATOM 1933 N LEU A 258 11.878 44.159 17.414 1.00175.43 N
ATOM 1934 CA LEU A 258 12.188 43.847 16.022 1.00175.17 C
ATOM 1935 C LEU A 258 12.179 45.115 15.177 1.00174.35 C
ATOM 1936 O LEU A 258 13.114 45.377 14.421 1.00173.66 O
ATOM 1937 CB LEU A 258 11.194 42.826 15.462 1.00175.05 C
ATOM 1938 CG LEU A 258 11.554 42.185 14.119 1.00174.04 C
ATOM 1939 CD1 LEU A 258 12.884 41.457 14.208 1.00173.43 C
ATOM 1940 CD2 LEU A 258 10.455 41.235 13.671 1.00174.76 C
ATOM 1941 N ILE A 259 11.109 45.892 15.310 1.00174.71 N
ATOM 1942 CA ILE A 259 11.011 47.187 14.647 1.00175.14 C
ATOM 1943 C ILE A 259 11.247 48.301 15.667 1.00175.30 C
ATOM 1944 O ILE A 259 12.365 48.793 15.813 1.00175.30 O
ATOM 1945 CB ILE A 259 9.636 47.379 13.971 1.00175.14 C
ATOM 1946 CG1 ILE A 259 9.202 46.097 13.254 1.00174.50 C
ATOM 1947 CG2 ILE A 259 9.670 48.559 13.008 1.00174.18 C
ATOM 1948 CD1 ILE A 259 10.147 45.658 12.156 1.00174.18 C
ATOM 1949 N PHE A 260 10.182 48.676 16.372 1.00175.02 N
ATOM 1950 CA PHE A 260 10.247 49.616 17.488 1.00174.11 C
ATOM 1951 C PHE A 260 8.900 49.619 18.208 1.00174.25 C
ATOM 1952 O PHE A 260 7.850 49.544 17.568 1.00174.69 O
ATOM 1953 CB PHE A 260 10.649 51.027 17.021 1.00174.08 C
ATOM 1954 CG PHE A 260 9.599 51.745 16.213 1.00174.54 C
ATOM 1955 CD1 PHE A 260 8.615 52.500 16.834 1.00174.67 C
ATOM 1956 CD2 PHE A 260 9.613 51.682 14.828 1.00174.54 C
ATOM 1957 CE1 PHE A 260 7.659 53.169 16.089 1.00174.76 C
ATOM 1958 CE2 PHE A 260 8.658 52.350 14.078 1.00174.94 C
ATOM 1959 CZ PHE A 260 7.681 53.094 14.711 1.00175.33 C
ATOM 1960 N GLN A 261 8.961 49.680 19.539 1.00174.17 N
ATOM 1961 CA GLN A 261 7.819 49.500 20.449 1.00174.78 C
ATOM 1962 C GLN A 261 6.444 49.931 19.934 1.00175.17 C
ATOM 1963 O GLN A 261 5.535 49.110 19.818 1.00175.35 O
ATOM 1964 CB GLN A 261 8.096 50.239 21.763 1.00174.23 C
ATOM 1965 CG GLN A 261 7.201 49.801 22.915 1.00173.58 C
ATOM 1966 CD GLN A 261 7.400 50.638 24.162 1.00173.91 C
ATOM 1967 OE1 GLN A 261 8.297 51.480 24.224 1.00174.18 O
ATOM 1968 NE2 GLN A 261 6.557 50.417 25.164 1.00173.97 N
ATOM 1969 N TYR A 262 6.298 51.216 19.631 1.00175.50 N
ATOM 1970 CA TYR A 262 5.000 51.772 19.254 1.00174.78 C
ATOM 1971 C TYR A 262 4.480 51.243 17.916 1.00174.02 C
ATOM 1972 O TYR A 262 3.318 51.456 17.569 1.00173.13 O
ATOM 1973 CB TYR A 262 5.081 53.300 19.225 1.00174.33 C
ATOM 1974 CG TYR A 262 5.586 53.896 20.521 1.00174.48 C
ATOM 1975 CD1 TYR A 262 6.932 54.189 20.698 1.00174.60 C
ATOM 1976 CD2 TYR A 262 4.716 54.153 21.574 1.00174.46 C
ATOM 1977 CE1 TYR A 262 7.398 54.728 21.885 1.00174.58 C
ATOM 1978 CE2 TYR A 262 5.172 54.692 22.763 1.00174.70 C
ATOM 1979 CZ TYR A 262 6.513 54.977 22.913 1.00174.52 C
ATOM 1980 OH TYR A 262 6.970 55.514 24.095 1.00174.36 O
ATOM 1981 N ALA A 263 5.332 50.539 17.179 1.00174.38 N
ATOM 1982 CA ALA A 263 4.916 49.899 15.937 1.00174.58 C
ATOM 1983 C ALA A 263 4.600 48.432 16.190 1.00174.17 C
ATOM 1984 O ALA A 263 4.723 47.591 15.298 1.00174.26 O
ATOM 1985 CB ALA A 263 5.990 50.036 14.874 1.00174.58 C
ATOM 1986 N SER A 264 4.194 48.133 17.418 1.00173.75 N
ATOM 1987 CA SER A 264 3.881 46.769 17.809 1.00174.22 C
ATOM 1988 C SER A 264 2.595 46.735 18.624 1.00174.43 C
ATOM 1989 O SER A 264 2.328 47.636 19.420 1.00173.94 O
ATOM 1990 CB SER A 264 5.036 46.162 18.607 1.00174.61 C
ATOM 1991 OG SER A 264 4.707 44.868 19.083 1.00175.21 O
ATOM 1992 N PHE A 265 1.799 45.695 18.413 1.00175.11 N
ATOM 1993 CA PHE A 265 0.535 45.543 19.120 1.00175.02 C
ATOM 1994 C PHE A 265 0.724 44.963 20.517 1.00174.82 C
ATOM 1995 O PHE A 265 1.586 44.114 20.743 1.00174.56 O
ATOM 1996 CB PHE A 265 -0.420 44.660 18.318 1.00174.98 C
ATOM 1997 CG PHE A 265 -1.152 45.393 17.233 1.00174.51 C
ATOM 1998 CD1 PHE A 265 -1.514 44.747 16.063 1.00174.37 C
ATOM 1999 CD2 PHE A 265 -1.488 46.729 17.387 1.00174.45 C
ATOM 2000 CE1 PHE A 265 -2.190 45.419 15.064 1.00175.10 C
ATOM 2001 CE2 PHE A 265 -2.164 47.407 16.391 1.00174.39 C
ATOM 2002 CZ PHE A 265 -2.516 46.751 15.230 1.00175.05 C
ATOM 2003 N ASN A 266 -0.092 45.439 21.450 1.00174.68 N
ATOM 2004 CA ASN A 266 -0.102 44.922 22.810 1.00174.76 C
ATOM 2005 C ASN A 266 -1.532 44.586 23.213 1.00174.23 C
ATOM 2006 O ASN A 266 -1.776 43.928 24.225 1.00174.15 O
ATOM 2007 CB ASN A 266 0.517 45.935 23.776 1.00174.93 C
ATOM 2008 CG ASN A 266 -0.261 47.235 23.837 1.00174.66 C
ATOM 2009 OD1 ASN A 266 -1.293 47.323 24.503 1.00175.19 O
ATOM 2010 ND2 ASN A 266 0.228 48.253 23.137 1.00174.24 N
ATOM 2011 N ASN A 267 -2.472 45.046 22.394 1.00173.48 N
ATOM 2012 CA ASN A 267 -3.885 44.769 22.596 1.00172.73 C
ATOM 2013 C ASN A 267 -4.344 43.676 21.638 1.00173.02 C
ATOM 2014 O ASN A 267 -4.437 43.898 20.431 1.00173.54 O
ATOM 2015 CB ASN A 267 -4.711 46.043 22.398 1.00172.68 C
ATOM 2016 CG ASN A 267 -6.133 45.906 22.906 1.00173.27 C
ATOM 2017 OD1 ASN A 267 -6.768 44.863 22.753 1.00173.16 O
ATOM 2018 ND2 ASN A 267 -6.643 46.968 23.519 1.00174.11 N
ATOM 2019 N SER A 268 -4.617 42.495 22.186 1.00172.98 N
ATOM 2020 CA SER A 268 -5.059 41.346 21.398 1.00173.12 C
ATOM 2021 C SER A 268 -6.286 41.657 20.541 1.00173.12 C
ATOM 2022 O SER A 268 -6.431 41.133 19.437 1.00173.69 O
ATOM 2023 CB SER A 268 -5.358 40.162 22.320 1.00173.49 C
ATOM 2024 OG SER A 268 -5.733 39.014 21.583 1.00173.62 O
ATOM 2025 N ARG A 269 -7.168 42.510 21.053 1.00172.81 N
ATOM 2026 CA ARG A 269 -8.386 42.873 20.339 1.00173.37 C
ATOM 2027 C ARG A 269 -8.090 43.825 19.183 1.00174.54 C
ATOM 2028 O ARG A 269 -8.698 43.730 18.118 1.00175.25 O
ATOM 2029 CB ARG A 269 -9.398 43.499 21.300 1.00173.66 C
ATOM 2030 CG ARG A 269 -9.775 42.579 22.450 1.00173.85 C
ATOM 2031 CD ARG A 269 -11.002 43.068 23.196 1.00173.72 C
ATOM 2032 NE ARG A 269 -11.466 42.075 24.161 1.00173.79 N
ATOM 2033 CZ ARG A 269 -12.595 42.176 24.855 1.00174.13 C
ATOM 2034 NH1 ARG A 269 -13.381 43.231 24.691 1.00174.74 N
ATOM 2035 NH2 ARG A 269 -12.938 41.225 25.712 1.00174.39 N
ATOM 2036 N SER A 270 -7.153 44.742 19.395 1.00174.74 N
ATOM 2037 CA SER A 270 -6.726 45.650 18.336 1.00174.87 C
ATOM 2038 C SER A 270 -5.934 44.881 17.289 1.00174.63 C
ATOM 2039 O SER A 270 -5.909 45.245 16.112 1.00174.40 O
ATOM 2040 CB SER A 270 -5.884 46.788 18.910 1.00175.08 C
ATOM 2041 OG SER A 270 -6.633 47.555 19.834 1.00175.26 O
ATOM 2042 N LEU A 271 -5.293 43.808 17.739 1.00174.76 N
ATOM 2043 CA LEU A 271 -4.528 42.918 16.878 1.00174.31 C
ATOM 2044 C LEU A 271 -5.438 42.181 15.900 1.00173.88 C
ATOM 2045 O LEU A 271 -5.286 42.295 14.683 1.00173.73 O
ATOM 2046 CB LEU A 271 -3.753 41.910 17.730 1.00174.47 C
ATOM 2047 CG LEU A 271 -2.429 41.299 17.265 1.00174.47 C
ATOM 2048 CD1 LEU A 271 -2.066 40.168 18.211 1.00175.10 C
ATOM 2049 CD2 LEU A 271 -2.465 40.803 15.823 1.00174.03 C
ATOM 2050 N HIS A 272 -6.379 41.421 16.451 1.00173.85 N
ATOM 2051 CA HIS A 272 -7.239 40.552 15.658 1.00173.98 C
ATOM 2052 C HIS A 272 -8.182 41.339 14.757 1.00174.42 C
ATOM 2053 O HIS A 272 -8.631 40.836 13.726 1.00174.72 O
ATOM 2054 CB HIS A 272 -8.040 39.635 16.579 1.00173.83 C
ATOM 2055 CG HIS A 272 -7.192 38.668 17.342 1.00173.43 C
ATOM 2056 ND1 HIS A 272 -6.263 39.072 18.278 1.00173.79 N
ATOM 2057 CD2 HIS A 272 -7.125 37.317 17.306 1.00172.86 C
ATOM 2058 CE1 HIS A 272 -5.665 38.012 18.788 1.00173.40 C
ATOM 2059 NE2 HIS A 272 -6.173 36.934 18.218 1.00172.91 N
ATOM 2060 N PHE A 273 -8.474 42.577 15.139 1.00174.57 N
ATOM 2061 CA PHE A 273 -9.281 43.442 14.293 1.00174.06 C
ATOM 2062 C PHE A 273 -8.504 43.783 13.032 1.00173.97 C
ATOM 2063 O PHE A 273 -9.018 43.651 11.922 1.00173.80 O
ATOM 2064 CB PHE A 273 -9.687 44.716 15.032 1.00173.06 C
ATOM 2065 CG PHE A 273 -10.222 45.784 14.127 1.00173.31 C
ATOM 2066 CD1 PHE A 273 -11.397 45.587 13.424 1.00174.02 C
ATOM 2067 CD2 PHE A 273 -9.543 46.980 13.968 1.00173.94 C
ATOM 2068 CE1 PHE A 273 -11.889 46.564 12.580 1.00174.82 C
ATOM 2069 CE2 PHE A 273 -10.031 47.963 13.128 1.00174.30 C
ATOM 2070 CZ PHE A 273 -11.205 47.755 12.433 1.00174.13 C
ATOM 2071 N PHE A 274 -7.263 44.218 13.218 1.00174.22 N
ATOM 2072 CA PHE A 274 -6.352 44.477 12.110 1.00173.91 C
ATOM 2073 C PHE A 274 -6.147 43.215 11.278 1.00173.19 C
ATOM 2074 O PHE A 274 -6.116 43.268 10.049 1.00173.43 O
ATOM 2075 CB PHE A 274 -5.011 44.996 12.636 1.00174.50 C
ATOM 2076 CG PHE A 274 -3.998 45.268 11.560 1.00174.36 C
ATOM 2077 CD1 PHE A 274 -4.118 46.379 10.742 1.00173.64 C
ATOM 2078 CD2 PHE A 274 -2.921 44.416 11.373 1.00175.04 C
ATOM 2079 CE1 PHE A 274 -3.186 46.634 9.754 1.00173.94 C
ATOM 2080 CE2 PHE A 274 -1.986 44.665 10.385 1.00174.79 C
ATOM 2081 CZ PHE A 274 -2.118 45.775 9.575 1.00174.31 C
ATOM 2082 N LEU A 275 -6.005 42.083 11.961 1.00172.49 N
ATOM 2083 CA LEU A 275 -5.857 40.787 11.307 1.00171.82 C
ATOM 2084 C LEU A 275 -7.038 40.482 10.392 1.00171.40 C
ATOM 2085 O LEU A 275 -6.888 39.821 9.366 1.00170.81 O
ATOM 2086 CB LEU A 275 -5.706 39.679 12.351 1.00173.28 C
ATOM 2087 CG LEU A 275 -4.489 38.764 12.206 1.00174.42 C
ATOM 2088 CD1 LEU A 275 -3.206 39.582 12.194 1.00174.33 C
ATOM 2089 CD2 LEU A 275 -4.460 37.729 13.321 1.00174.43 C
ATOM 2090 N ALA A 276 -8.216 40.962 10.775 1.00172.18 N
ATOM 2091 CA ALA A 276 -9.428 40.732 9.999 1.00173.31 C
ATOM 2092 C ALA A 276 -9.679 41.852 8.991 1.00174.28 C
ATOM 2093 O ALA A 276 -10.027 41.592 7.840 1.00174.60 O
ATOM 2094 CB ALA A 276 -10.624 40.582 10.927 1.00173.79 C
ATOM 2095 N ALA A 277 -9.504 43.093 9.435 1.00174.30 N
ATOM 2096 CA ALA A 277 -9.775 44.269 8.606 1.00174.27 C
ATOM 2097 C ALA A 277 -8.972 44.295 7.304 1.00174.55 C
ATOM 2098 O ALA A 277 -9.542 44.444 6.224 1.00174.56 O
ATOM 2099 CB ALA A 277 -9.506 45.540 9.403 1.00173.68 C
ATOM 2100 N TRP A 278 -7.653 44.152 7.418 1.00174.37 N
ATOM 2101 CA TRP A 278 -6.746 44.280 6.276 1.00173.37 C
ATOM 2102 C TRP A 278 -7.124 43.408 5.067 1.00172.81 C
ATOM 2103 O TRP A 278 -7.353 43.947 3.984 1.00173.26 O
ATOM 2104 CB TRP A 278 -5.302 43.987 6.713 1.00173.64 C
ATOM 2105 CG TRP A 278 -4.287 44.183 5.633 1.00173.24 C
ATOM 2106 CD1 TRP A 278 -3.862 43.254 4.730 1.00173.36 C
ATOM 2107 CD2 TRP A 278 -3.556 45.382 5.349 1.00173.33 C
ATOM 2108 NE1 TRP A 278 -2.918 43.801 3.896 1.00173.62 N
ATOM 2109 CE2 TRP A 278 -2.711 45.105 4.255 1.00173.41 C
ATOM 2110 CE3 TRP A 278 -3.536 46.661 5.912 1.00173.72 C
ATOM 2111 CZ2 TRP A 278 -1.856 46.064 3.713 1.00173.37 C
ATOM 2112 CZ3 TRP A 278 -2.687 47.609 5.373 1.00173.73 C
ATOM 2113 CH2 TRP A 278 -1.859 47.306 4.285 1.00173.27 C
ATOM 2114 N PRO A 279 -7.186 42.071 5.229 1.00171.91 N
ATOM 2115 CA PRO A 279 -7.510 41.273 4.042 1.00171.74 C
ATOM 2116 C PRO A 279 -8.921 41.521 3.503 1.00172.42 C
ATOM 2117 O PRO A 279 -9.092 41.619 2.290 1.00173.49 O
ATOM 2118 CB PRO A 279 -7.369 39.836 4.544 1.00172.74 C
ATOM 2119 CG PRO A 279 -7.697 39.927 5.984 1.00173.74 C
ATOM 2120 CD PRO A 279 -7.085 41.218 6.430 1.00173.42 C
ATOM 2121 N VAL A 280 -9.909 41.612 4.391 1.00172.42 N
ATOM 2122 CA VAL A 280 -11.299 41.828 3.995 1.00173.54 C
ATOM 2123 C VAL A 280 -11.476 43.113 3.188 1.00173.87 C
ATOM 2124 O VAL A 280 -12.128 43.116 2.144 1.00173.76 O
ATOM 2125 CB VAL A 280 -12.235 41.866 5.224 1.00173.88 C
ATOM 2126 CG1 VAL A 280 -13.626 42.340 4.831 1.00174.34 C
ATOM 2127 CG2 VAL A 280 -12.301 40.494 5.882 1.00173.28 C
ATOM 2128 N VAL A 281 -10.887 44.201 3.676 1.00173.87 N
ATOM 2129 CA VAL A 281 -10.955 45.488 2.989 1.00173.51 C
ATOM 2130 C VAL A 281 -10.234 45.439 1.644 1.00173.90 C
ATOM 2131 O VAL A 281 -10.733 45.958 0.644 1.00174.24 O
ATOM 2132 CB VAL A 281 -10.354 46.615 3.858 1.00173.62 C
ATOM 2133 CG1 VAL A 281 -10.147 47.880 3.038 1.00173.91 C
ATOM 2134 CG2 VAL A 281 -11.248 46.892 5.056 1.00174.61 C
ATOM 2135 N GLY A 282 -9.067 44.806 1.623 1.00174.15 N
ATOM 2136 CA GLY A 282 -8.291 44.673 0.403 1.00174.44 C
ATOM 2137 C GLY A 282 -9.003 43.864 -0.665 1.00174.52 C
ATOM 2138 O GLY A 282 -9.016 44.240 -1.839 1.00174.28 O
ATOM 2139 N VAL A 283 -9.598 42.748 -0.256 1.00174.52 N
ATOM 2140 CA VAL A 283 -10.341 41.893 -1.173 1.00173.71 C
ATOM 2141 C VAL A 283 -11.630 42.591 -1.602 1.00173.96 C
ATOM 2142 O VAL A 283 -12.100 42.417 -2.727 1.00174.20 O
ATOM 2143 CB VAL A 283 -10.652 40.522 -0.531 1.00173.11 C
ATOM 2144 CG1 VAL A 283 -11.654 39.738 -1.364 1.00173.39 C
ATOM 2145 CG2 VAL A 283 -9.371 39.724 -0.362 1.00172.92 C
ATOM 2146 N TRP A 284 -12.185 43.401 -0.705 1.00174.13 N
ATOM 2147 CA TRP A 284 -13.363 44.202 -1.027 1.00174.07 C
ATOM 2148 C TRP A 284 -13.090 45.091 -2.234 1.00173.51 C
ATOM 2149 O TRP A 284 -13.923 45.209 -3.130 1.00173.76 O
ATOM 2150 CB TRP A 284 -13.786 45.059 0.166 1.00173.99 C
ATOM 2151 CG TRP A 284 -14.880 44.460 0.996 1.00173.64 C
ATOM 2152 CD1 TRP A 284 -15.768 43.497 0.613 1.00173.47 C
ATOM 2153 CD2 TRP A 284 -15.209 44.796 2.347 1.00172.79 C
ATOM 2154 NE1 TRP A 284 -16.626 43.208 1.647 1.00173.01 N
ATOM 2155 CE2 TRP A 284 -16.303 43.994 2.723 1.00172.97 C
ATOM 2156 CE3 TRP A 284 -14.682 45.697 3.278 1.00172.00 C
ATOM 2157 CZ2 TRP A 284 -16.881 44.064 3.988 1.00173.05 C
ATOM 2158 CZ3 TRP A 284 -15.255 45.766 4.532 1.00172.08 C
ATOM 2159 CH2 TRP A 284 -16.343 44.954 4.877 1.00172.89 C
ATOM 2160 N PHE A 285 -11.914 45.709 -2.252 1.00173.15 N
ATOM 2161 CA PHE A 285 -11.525 46.572 -3.359 1.00173.35 C
ATOM 2162 C PHE A 285 -11.265 45.776 -4.630 1.00173.03 C
ATOM 2163 O PHE A 285 -11.635 46.206 -5.723 1.00173.44 O
ATOM 2164 CB PHE A 285 -10.290 47.390 -2.991 1.00173.62 C
ATOM 2165 CG PHE A 285 -10.605 48.632 -2.215 1.00173.55 C
ATOM 2166 CD1 PHE A 285 -11.348 49.648 -2.790 1.00174.04 C
ATOM 2167 CD2 PHE A 285 -10.164 48.784 -0.912 1.00173.58 C
ATOM 2168 CE1 PHE A 285 -11.647 50.792 -2.084 1.00174.19 C
ATOM 2169 CE2 PHE A 285 -10.459 49.928 -0.199 1.00173.87 C
ATOM 2170 CZ PHE A 285 -11.202 50.933 -0.786 1.00173.94 C
ATOM 2171 N THR A 286 -10.629 44.617 -4.490 1.00172.29 N
ATOM 2172 CA THR A 286 -10.342 43.776 -5.645 1.00172.89 C
ATOM 2173 C THR A 286 -11.647 43.241 -6.230 1.00173.53 C
ATOM 2174 O THR A 286 -11.736 42.988 -7.432 1.00174.51 O
ATOM 2175 CB THR A 286 -9.380 42.610 -5.289 1.00173.34 C
ATOM 2176 OG1 THR A 286 -8.513 42.349 -6.398 1.00174.39 O
ATOM 2177 CG2 THR A 286 -10.134 41.337 -4.929 1.00173.61 C
ATOM 2178 N ALA A 287 -12.659 43.078 -5.379 1.00173.44 N
ATOM 2179 CA ALA A 287 -13.981 42.677 -5.838 1.00173.74 C
ATOM 2180 C ALA A 287 -14.650 43.838 -6.562 1.00173.59 C
ATOM 2181 O ALA A 287 -15.353 43.646 -7.553 1.00173.60 O
ATOM 2182 CB ALA A 287 -14.837 42.209 -4.671 1.00173.98 C
ATOM 2183 N LEU A 288 -14.416 45.047 -6.060 1.00173.43 N
ATOM 2184 CA LEU A 288 -14.950 46.251 -6.685 1.00173.21 C
ATOM 2185 C LEU A 288 -14.197 46.563 -7.967 1.00173.06 C
ATOM 2186 O LEU A 288 -14.708 47.258 -8.842 1.00173.65 O
ATOM 2187 CB LEU A 288 -14.876 47.445 -5.730 1.00173.59 C
ATOM 2188 CG LEU A 288 -15.800 47.415 -4.512 1.00174.44 C
ATOM 2189 CD1 LEU A 288 -15.333 48.408 -3.460 1.00174.60 C
ATOM 2190 CD2 LEU A 288 -17.237 47.698 -4.919 1.00174.47 C
ATOM 2191 N GLY A 289 -12.978 46.048 -8.070 1.00172.63 N
ATOM 2192 CA GLY A 289 -12.171 46.245 -9.259 1.00172.94 C
ATOM 2193 C GLY A 289 -12.782 45.544 -10.452 1.00173.35 C
ATOM 2194 O GLY A 289 -12.990 46.150 -11.500 1.00174.05 O
ATOM 2195 N ILE A 290 -13.078 44.260 -10.287 1.00172.91 N
ATOM 2196 CA ILE A 290 -13.711 43.471 -11.337 1.00173.17 C
ATOM 2197 C ILE A 290 -15.095 44.021 -11.666 1.00173.91 C
ATOM 2198 O ILE A 290 -15.528 44.003 -12.819 1.00174.59 O
ATOM 2199 CB ILE A 290 -13.819 41.991 -10.926 1.00172.75 C
ATOM 2200 CG1 ILE A 290 -12.428 41.428 -10.640 1.00173.68 C
ATOM 2201 CG2 ILE A 290 -14.516 41.172 -12.003 1.00172.72 C
ATOM 2202 CD1 ILE A 290 -11.474 41.562 -11.805 1.00174.01 C
ATOM 2203 N SER A 291 -15.779 44.528 -10.646 1.00173.95 N
ATOM 2204 CA SER A 291 -17.113 45.084 -10.821 1.00174.44 C
ATOM 2205 C SER A 291 -17.087 46.451 -11.501 1.00174.35 C
ATOM 2206 O SER A 291 -18.058 46.852 -12.143 1.00173.92 O
ATOM 2207 CB SER A 291 -17.817 45.190 -9.470 1.00174.24 C
ATOM 2208 OG SER A 291 -18.118 43.906 -8.950 1.00173.85 O
ATOM 2209 N THR A 292 -15.971 47.160 -11.365 1.00174.29 N
ATOM 2210 CA THR A 292 -15.822 48.477 -11.978 1.00174.07 C
ATOM 2211 C THR A 292 -15.371 48.314 -13.421 1.00174.34 C
ATOM 2212 O THR A 292 -15.877 48.981 -14.325 1.00174.63 O
ATOM 2213 CB THR A 292 -14.810 49.355 -11.207 1.00174.46 C
ATOM 2214 OG1 THR A 292 -15.469 49.992 -10.106 1.00175.55 O
ATOM 2215 CG2 THR A 292 -14.200 50.417 -12.111 1.00174.40 C
ATOM 2216 N MET A 293 -14.434 47.397 -13.635 1.00174.48 N
ATOM 2217 CA MET A 293 -13.916 47.128 -14.970 1.00174.11 C
ATOM 2218 C MET A 293 -14.902 46.268 -15.755 1.00173.96 C
ATOM 2219 O MET A 293 -14.617 45.839 -16.873 1.00173.83 O
ATOM 2220 CB MET A 293 -12.549 46.447 -14.880 1.00173.78 C
ATOM 2221 CG MET A 293 -11.550 47.231 -14.041 1.00173.50 C
ATOM 2222 SD MET A 293 -10.046 46.332 -13.627 1.00172.13 S
ATOM 2223 CE MET A 293 -8.952 46.924 -14.909 1.00173.61 C
ATOM 2224 N ALA A 294 -16.065 46.023 -15.156 1.00173.71 N
ATOM 2225 CA ALA A 294 -17.162 45.347 -15.834 1.00173.49 C
ATOM 2226 C ALA A 294 -17.933 46.361 -16.664 1.00173.78 C
ATOM 2227 O ALA A 294 -18.780 46.004 -17.481 1.00173.82 O
ATOM 2228 CB ALA A 294 -18.074 44.668 -14.833 1.00173.39 C
ATOM 2229 N PHE A 295 -17.623 47.635 -16.440 1.00174.22 N
ATOM 2230 CA PHE A 295 -18.235 48.725 -17.181 1.00174.58 C
ATOM 2231 C PHE A 295 -17.146 49.496 -17.913 1.00173.90 C
ATOM 2232 O PHE A 295 -17.313 50.668 -18.261 1.00173.30 O
ATOM 2233 CB PHE A 295 -19.018 49.642 -16.243 1.00174.72 C
ATOM 2234 CG PHE A 295 -20.096 48.937 -15.474 1.00173.89 C
ATOM 2235 CD1 PHE A 295 -19.886 48.545 -14.163 1.00172.97 C
ATOM 2236 CD2 PHE A 295 -21.314 48.650 -16.067 1.00173.90 C
ATOM 2237 CE1 PHE A 295 -20.874 47.892 -13.454 1.00172.93 C
ATOM 2238 CE2 PHE A 295 -22.306 47.998 -15.363 1.00173.90 C
ATOM 2239 CZ PHE A 295 -22.085 47.617 -14.054 1.00173.33 C
ATOM 2240 N ASN A 296 -16.025 48.812 -18.126 1.00173.63 N
ATOM 2241 CA ASN A 296 -14.912 49.309 -18.925 1.00173.43 C
ATOM 2242 C ASN A 296 -14.277 50.586 -18.385 1.00173.62 C
ATOM 2243 O ASN A 296 -13.872 51.460 -19.153 1.00174.47 O
ATOM 2244 CB ASN A 296 -15.365 49.529 -20.367 1.00173.23 C
ATOM 2245 CG ASN A 296 -15.972 48.284 -20.979 1.00173.14 C
ATOM 2246 OD1 ASN A 296 -15.567 47.165 -20.669 1.00173.06 O
ATOM 2247 ND2 ASN A 296 -16.951 48.473 -21.857 1.00173.73 N
ATOM 2248 N LEU A 297 -14.194 50.691 -17.063 1.00173.26 N
ATOM 2249 CA LEU A 297 -13.376 51.720 -16.438 1.00173.45 C
ATOM 2250 C LEU A 297 -12.064 51.063 -16.033 1.00173.68 C
ATOM 2251 O LEU A 297 -11.905 50.602 -14.903 1.00173.59 O
ATOM 2252 CB LEU A 297 -14.080 52.345 -15.233 1.00173.36 C
ATOM 2253 CG LEU A 297 -13.321 53.454 -14.500 1.00172.98 C
ATOM 2254 CD1 LEU A 297 -12.951 54.578 -15.454 1.00172.74 C
ATOM 2255 CD2 LEU A 297 -14.136 53.986 -13.332 1.00173.92 C
ATOM 2256 N ASN A 298 -11.126 51.023 -16.973 1.00173.93 N
ATOM 2257 CA ASN A 298 -9.940 50.191 -16.832 1.00173.91 C
ATOM 2258 C ASN A 298 -8.789 50.862 -16.095 1.00174.14 C
ATOM 2259 O ASN A 298 -8.912 51.985 -15.606 1.00173.92 O
ATOM 2260 CB ASN A 298 -9.462 49.741 -18.215 1.00173.58 C
ATOM 2261 CG ASN A 298 -10.609 49.412 -19.150 1.00173.62 C
ATOM 2262 OD1 ASN A 298 -11.339 48.444 -18.940 1.00173.43 O
ATOM 2263 ND2 ASN A 298 -10.779 50.228 -20.185 1.00173.86 N
ATOM 2264 N GLY A 299 -7.667 50.151 -16.030 1.00174.59 N
ATOM 2265 CA GLY A 299 -6.483 50.627 -15.341 1.00174.55 C
ATOM 2266 C GLY A 299 -5.806 51.747 -16.099 1.00173.68 C
ATOM 2267 O GLY A 299 -6.190 52.062 -17.224 1.00172.68 O
ATOM 2268 N PHE A 300 -4.793 52.343 -15.478 1.00174.01 N
ATOM 2269 CA PHE A 300 -4.091 53.483 -16.056 1.00174.26 C
ATOM 2270 C PHE A 300 -3.483 53.166 -17.419 1.00174.74 C
ATOM 2271 O PHE A 300 -2.914 52.095 -17.628 1.00174.78 O
ATOM 2272 CB PHE A 300 -2.994 53.966 -15.106 1.00174.45 C
ATOM 2273 CG PHE A 300 -3.513 54.512 -13.809 1.00173.62 C
ATOM 2274 CD1 PHE A 300 -3.392 53.784 -12.639 1.00173.24 C
ATOM 2275 CD2 PHE A 300 -4.114 55.757 -13.759 1.00174.06 C
ATOM 2276 CE1 PHE A 300 -3.864 54.287 -11.443 1.00173.04 C
ATOM 2277 CE2 PHE A 300 -4.593 56.262 -12.567 1.00174.35 C
ATOM 2278 CZ PHE A 300 -4.466 55.527 -11.407 1.00173.49 C
ATOM 2279 N ASN A 301 -3.614 54.111 -18.343 1.00174.26 N
ATOM 2280 CA ASN A 301 -3.076 53.956 -19.686 1.00173.13 C
ATOM 2281 C ASN A 301 -1.924 54.929 -19.923 1.00172.86 C
ATOM 2282 O ASN A 301 -2.139 56.058 -20.365 1.00172.40 O
ATOM 2283 CB ASN A 301 -4.184 54.168 -20.722 1.00173.36 C
ATOM 2284 CG ASN A 301 -3.783 53.726 -22.118 1.00174.23 C
ATOM 2285 OD1 ASN A 301 -2.607 53.746 -22.480 1.00174.61 O
ATOM 2286 ND2 ASN A 301 -4.768 53.328 -22.915 1.00174.73 N
ATOM 2287 N PHE A 302 -0.705 54.492 -19.621 1.00173.15 N
ATOM 2288 CA PHE A 302 0.474 55.330 -19.821 1.00174.21 C
ATOM 2289 C PHE A 302 1.202 55.006 -21.123 1.00175.06 C
ATOM 2290 O PHE A 302 2.425 55.119 -21.201 1.00175.06 O
ATOM 2291 CB PHE A 302 1.447 55.190 -18.646 1.00173.82 C
ATOM 2292 CG PHE A 302 0.873 55.611 -17.324 1.00174.13 C
ATOM 2293 CD1 PHE A 302 0.811 54.722 -16.266 1.00175.01 C
ATOM 2294 CD2 PHE A 302 0.398 56.900 -17.140 1.00174.06 C
ATOM 2295 CE1 PHE A 302 0.288 55.110 -15.046 1.00175.66 C
ATOM 2296 CE2 PHE A 302 -0.129 57.294 -15.924 1.00174.35 C
ATOM 2297 CZ PHE A 302 -0.185 56.395 -14.875 1.00175.31 C
ATOM 2298 N ASN A 303 0.450 54.597 -22.139 1.00175.24 N
ATOM 2299 CA ASN A 303 1.039 54.276 -23.433 1.00174.64 C
ATOM 2300 C ASN A 303 1.468 55.530 -24.187 1.00173.86 C
ATOM 2301 O ASN A 303 0.663 56.436 -24.413 1.00173.20 O
ATOM 2302 CB ASN A 303 0.066 53.455 -24.280 1.00175.14 C
ATOM 2303 CG ASN A 303 -0.222 52.091 -23.678 1.00174.33 C
ATOM 2304 OD1 ASN A 303 0.691 51.379 -23.260 1.00172.68 O
ATOM 2305 ND2 ASN A 303 -1.496 51.721 -23.634 1.00174.61 N
ATOM 2306 N HIS A 304 2.747 55.572 -24.555 1.00173.85 N
ATOM 2307 CA HIS A 304 3.330 56.695 -25.286 1.00174.44 C
ATOM 2308 C HIS A 304 3.221 57.989 -24.488 1.00174.32 C
ATOM 2309 O HIS A 304 2.928 59.048 -25.042 1.00175.23 O
ATOM 2310 CB HIS A 304 2.665 56.861 -26.658 1.00174.44 C
ATOM 2311 CG HIS A 304 2.949 55.739 -27.609 1.00173.92 C
ATOM 2312 ND1 HIS A 304 2.764 55.854 -28.970 1.00173.47 N
ATOM 2313 CD2 HIS A 304 3.406 54.482 -27.397 1.00173.78 C
ATOM 2314 CE1 HIS A 304 3.095 54.717 -29.555 1.00173.47 C
ATOM 2315 NE2 HIS A 304 3.487 53.868 -28.623 1.00172.83 N
ATOM 2316 N SER A 305 3.459 57.898 -23.183 1.00173.30 N
ATOM 2317 CA SER A 305 3.391 59.068 -22.317 1.00173.67 C
ATOM 2318 C SER A 305 4.635 59.939 -22.440 1.00173.97 C
ATOM 2319 O SER A 305 4.576 61.048 -22.971 1.00175.07 O
ATOM 2320 CB SER A 305 3.193 58.646 -20.862 1.00174.40 C
ATOM 2321 OG SER A 305 1.923 58.047 -20.682 1.00175.64 O
ATOM 2322 N VAL A 306 5.759 59.436 -21.944 1.00173.79 N
ATOM 2323 CA VAL A 306 7.013 60.176 -22.016 1.00174.81 C
ATOM 2324 C VAL A 306 7.578 60.172 -23.438 1.00174.59 C
ATOM 2325 O VAL A 306 7.900 59.120 -23.996 1.00173.93 O
ATOM 2326 CB VAL A 306 8.059 59.607 -21.031 1.00175.07 C
ATOM 2327 CG1 VAL A 306 8.036 58.089 -21.039 1.00175.06 C
ATOM 2328 CG2 VAL A 306 9.450 60.140 -21.352 1.00174.99 C
ATOM 2329 N ILE A 307 7.670 61.362 -24.024 1.00174.71 N
ATOM 2330 CA ILE A 307 8.240 61.537 -25.355 1.00174.22 C
ATOM 2331 C ILE A 307 9.354 62.580 -25.308 1.00174.86 C
ATOM 2332 O ILE A 307 9.353 63.457 -24.444 1.00175.33 O
ATOM 2333 CB ILE A 307 7.168 61.952 -26.385 1.00173.51 C
ATOM 2334 CG1 ILE A 307 6.588 63.325 -26.041 1.00173.48 C
ATOM 2335 CG2 ILE A 307 6.051 60.924 -26.433 1.00173.37 C
ATOM 2336 CD1 ILE A 307 5.536 63.799 -27.020 1.00173.47 C
ATOM 2337 N ASP A 308 10.308 62.480 -26.229 1.00174.96 N
ATOM 2338 CA ASP A 308 11.482 63.347 -26.197 1.00174.85 C
ATOM 2339 C ASP A 308 11.203 64.710 -26.835 1.00174.48 C
ATOM 2340 O ASP A 308 10.080 64.987 -27.258 1.00174.32 O
ATOM 2341 CB ASP A 308 12.671 62.661 -26.882 1.00174.58 C
ATOM 2342 CG ASP A 308 12.603 62.732 -28.395 1.00174.21 C
ATOM 2343 OD1 ASP A 308 11.484 62.726 -28.949 1.00174.35 O
ATOM 2344 OD2 ASP A 308 13.677 62.790 -29.034 1.00173.59 O
ATOM 2345 N ALA A 309 12.232 65.551 -26.900 1.00174.57 N
ATOM 2346 CA ALA A 309 12.087 66.933 -27.358 1.00174.43 C
ATOM 2347 C ALA A 309 11.611 67.051 -28.805 1.00174.57 C
ATOM 2348 O ALA A 309 11.045 68.074 -29.191 1.00174.61 O
ATOM 2349 CB ALA A 309 13.404 67.674 -27.186 1.00174.71 C
ATOM 2350 N LYS A 310 11.839 66.013 -29.603 1.00174.66 N
ATOM 2351 CA LYS A 310 11.466 66.055 -31.013 1.00174.48 C
ATOM 2352 C LYS A 310 10.052 65.521 -31.206 1.00174.14 C
ATOM 2353 O LYS A 310 9.327 65.957 -32.103 1.00174.06 O
ATOM 2354 CB LYS A 310 12.460 65.257 -31.863 1.00174.66 C
ATOM 2355 CG LYS A 310 12.129 65.230 -33.352 1.00174.75 C
ATOM 2356 CD LYS A 310 13.135 64.407 -34.146 1.00174.92 C
ATOM 2357 CE LYS A 310 12.789 64.395 -35.629 1.00173.58 C
ATOM 2358 NZ LYS A 310 13.728 63.554 -36.423 1.00172.83 N
ATOM 2359 N GLY A 311 9.656 64.588 -30.347 1.00174.00 N
ATOM 2360 CA GLY A 311 8.350 63.964 -30.449 1.00173.97 C
ATOM 2361 C GLY A 311 8.421 62.451 -30.510 1.00174.35 C
ATOM 2362 O GLY A 311 7.391 61.779 -30.475 1.00174.05 O
ATOM 2363 N ASN A 312 9.636 61.916 -30.613 1.00174.84 N
ATOM 2364 CA ASN A 312 9.842 60.470 -30.604 1.00174.50 C
ATOM 2365 C ASN A 312 9.283 59.853 -29.332 1.00173.43 C
ATOM 2366 O ASN A 312 9.331 60.463 -28.265 1.00173.61 O
ATOM 2367 CB ASN A 312 11.327 60.127 -30.735 1.00174.31 C
ATOM 2368 CG ASN A 312 11.926 60.610 -32.039 1.00174.88 C
ATOM 2369 OD1 ASN A 312 11.382 60.361 -33.116 1.00175.11 O
ATOM 2370 ND2 ASN A 312 13.058 61.299 -31.952 1.00174.80 N
ATOM 2371 N VAL A 313 8.762 58.638 -29.442 1.00172.62 N
ATOM 2372 CA VAL A 313 8.173 57.971 -28.292 1.00172.72 C
ATOM 2373 C VAL A 313 9.232 57.218 -27.504 1.00173.34 C
ATOM 2374 O VAL A 313 9.847 56.279 -28.009 1.00173.89 O
ATOM 2375 CB VAL A 313 7.066 56.993 -28.713 1.00172.85 C
ATOM 2376 CG1 VAL A 313 6.454 56.328 -27.490 1.00173.94 C
ATOM 2377 CG2 VAL A 313 6.003 57.718 -29.523 1.00173.17 C
ATOM 2378 N ILE A 314 9.442 57.638 -26.261 1.00173.13 N
ATOM 2379 CA ILE A 314 10.387 56.969 -25.380 1.00173.28 C
ATOM 2380 C ILE A 314 9.641 55.954 -24.528 1.00174.01 C
ATOM 2381 O ILE A 314 8.839 56.317 -23.669 1.00174.46 O
ATOM 2382 CB ILE A 314 11.131 57.965 -24.473 1.00173.77 C
ATOM 2383 CG1 ILE A 314 11.858 59.014 -25.314 1.00173.98 C
ATOM 2384 CG2 ILE A 314 12.115 57.232 -23.574 1.00174.55 C
ATOM 2385 CD1 ILE A 314 12.847 58.428 -26.299 1.00174.54 C
ATOM 2386 N ASN A 315 9.910 54.677 -24.777 1.00174.27 N
ATOM 2387 CA ASN A 315 9.189 53.597 -24.118 1.00174.55 C
ATOM 2388 C ASN A 315 9.478 53.480 -22.625 1.00173.68 C
ATOM 2389 O ASN A 315 10.560 53.830 -22.153 1.00173.10 O
ATOM 2390 CB ASN A 315 9.508 52.267 -24.802 1.00174.43 C
ATOM 2391 CG ASN A 315 8.806 52.113 -26.135 1.00174.17 C
ATOM 2392 OD1 ASN A 315 7.816 52.792 -26.411 1.00174.26 O
ATOM 2393 ND2 ASN A 315 9.313 51.215 -26.971 1.00173.83 N
ATOM 2394 N THR A 316 8.491 52.978 -21.891 1.00173.30 N
ATOM 2395 CA THR A 316 8.653 52.640 -20.484 1.00173.16 C
ATOM 2396 C THR A 316 8.257 51.186 -20.289 1.00173.57 C
ATOM 2397 O THR A 316 7.953 50.487 -21.256 1.00173.63 O
ATOM 2398 CB THR A 316 7.799 53.535 -19.568 1.00173.40 C
ATOM 2399 OG1 THR A 316 6.469 53.629 -20.089 1.00172.96 O
ATOM 2400 CG2 THR A 316 8.397 54.922 -19.479 1.00172.89 C
ATOM 2401 N TRP A 317 8.268 50.725 -19.046 1.00173.35 N
ATOM 2402 CA TRP A 317 7.805 49.376 -18.750 1.00172.64 C
ATOM 2403 C TRP A 317 6.317 49.242 -19.047 1.00173.09 C
ATOM 2404 O TRP A 317 5.835 48.153 -19.348 1.00173.00 O
ATOM 2405 CB TRP A 317 8.092 49.016 -17.295 1.00172.36 C
ATOM 2406 CG TRP A 317 9.541 48.811 -17.023 1.00171.97 C
ATOM 2407 CD1 TRP A 317 10.351 49.596 -16.258 1.00172.37 C
ATOM 2408 CD2 TRP A 317 10.365 47.756 -17.532 1.00171.71 C
ATOM 2409 NE1 TRP A 317 11.627 49.089 -16.249 1.00173.02 N
ATOM 2410 CE2 TRP A 317 11.662 47.961 -17.024 1.00172.25 C
ATOM 2411 CE3 TRP A 317 10.131 46.657 -18.361 1.00171.63 C
ATOM 2412 CZ2 TRP A 317 12.721 47.107 -17.321 1.00172.44 C
ATOM 2413 CZ3 TRP A 317 11.183 45.814 -18.655 1.00171.81 C
ATOM 2414 CH2 TRP A 317 12.459 46.040 -18.134 1.00172.24 C
ATOM 2415 N ALA A 318 5.602 50.360 -18.978 1.00173.90 N
ATOM 2416 CA ALA A 318 4.175 50.386 -19.282 1.00174.63 C
ATOM 2417 C ALA A 318 3.924 50.044 -20.746 1.00174.46 C
ATOM 2418 O ALA A 318 2.895 49.464 -21.094 1.00175.02 O
ATOM 2419 CB ALA A 318 3.586 51.749 -18.947 1.00174.75 C
ATOM 2420 N ASP A 319 4.874 50.410 -21.600 1.00173.84 N
ATOM 2421 CA ASP A 319 4.780 50.112 -23.022 1.00173.61 C
ATOM 2422 C ASP A 319 5.083 48.639 -23.284 1.00173.49 C
ATOM 2423 O ASP A 319 4.434 48.004 -24.115 1.00173.46 O
ATOM 2424 CB ASP A 319 5.730 51.007 -23.818 1.00174.18 C
ATOM 2425 CG ASP A 319 5.295 52.459 -23.816 1.00173.89 C
ATOM 2426 OD1 ASP A 319 5.895 53.260 -23.068 1.00174.14 O
ATOM 2427 OD2 ASP A 319 4.344 52.798 -24.552 1.00173.46 O
ATOM 2428 N ILE A 320 6.072 48.105 -22.572 1.00172.98 N
ATOM 2429 CA ILE A 320 6.420 46.691 -22.672 1.00172.57 C
ATOM 2430 C ILE A 320 5.237 45.828 -22.245 1.00172.36 C
ATOM 2431 O ILE A 320 5.024 44.735 -22.770 1.00172.41 O
ATOM 2432 CB ILE A 320 7.655 46.351 -21.807 1.00172.50 C
ATOM 2433 CG1 ILE A 320 8.844 47.225 -22.210 1.00174.02 C
ATOM 2434 CG2 ILE A 320 8.012 44.873 -21.919 1.00171.90 C
ATOM 2435 CD1 ILE A 320 9.152 47.194 -23.693 1.00175.19 C
ATOM 2436 N ILE A 321 4.459 46.342 -21.298 1.00172.24 N
ATOM 2437 CA ILE A 321 3.255 45.664 -20.840 1.00172.16 C
ATOM 2438 C ILE A 321 2.207 45.663 -21.945 1.00172.84 C
ATOM 2439 O ILE A 321 1.495 44.678 -22.147 1.00172.78 O
ATOM 2440 CB ILE A 321 2.675 46.341 -19.580 1.00172.14 C
ATOM 2441 CG1 ILE A 321 3.626 46.174 -18.398 1.00173.68 C
ATOM 2442 CG2 ILE A 321 1.305 45.778 -19.237 1.00172.15 C
ATOM 2443 CD1 ILE A 321 3.145 46.844 -17.131 1.00174.19 C
ATOM 2444 N ASN A 322 2.143 46.771 -22.677 1.00173.81 N
ATOM 2445 CA ASN A 322 1.155 46.940 -23.733 1.00174.03 C
ATOM 2446 C ASN A 322 1.370 45.968 -24.886 1.00173.96 C
ATOM 2447 O ASN A 322 0.410 45.483 -25.485 1.00173.84 O
ATOM 2448 CB ASN A 322 1.176 48.374 -24.256 1.00173.06 C
ATOM 2449 CG ASN A 322 -0.152 48.792 -24.846 1.00172.14 C
ATOM 2450 OD1 ASN A 322 -1.204 48.546 -24.261 1.00171.24 O
ATOM 2451 ND2 ASN A 322 -0.111 49.422 -26.014 1.00173.28 N
ATOM 2452 N ARG A 323 2.634 45.695 -25.195 1.00174.00 N
ATOM 2453 CA ARG A 323 2.982 44.738 -26.239 1.00174.53 C
ATOM 2454 C ARG A 323 2.482 43.345 -25.877 1.00174.21 C
ATOM 2455 O ARG A 323 1.887 42.655 -26.705 1.00174.96 O
ATOM 2456 CB ARG A 323 4.493 44.718 -26.471 1.00174.52 C
ATOM 2457 CG ARG A 323 5.054 46.033 -26.980 1.00174.37 C
ATOM 2458 CD ARG A 323 4.418 46.422 -28.305 1.00174.38 C
ATOM 2459 NE ARG A 323 4.621 45.402 -29.329 1.00174.31 N
ATOM 2460 CZ ARG A 323 4.256 45.537 -30.599 1.00174.44 C
ATOM 2461 NH1 ARG A 323 3.666 46.654 -31.006 1.00173.95 N
ATOM 2462 NH2 ARG A 323 4.481 44.558 -31.464 1.00174.87 N
ATOM 2463 N ALA A 324 2.733 42.937 -24.637 1.00173.27 N
ATOM 2464 CA ALA A 324 2.232 41.665 -24.132 1.00173.34 C
ATOM 2465 C ALA A 324 0.709 41.630 -24.189 1.00173.65 C
ATOM 2466 O ALA A 324 0.115 40.603 -24.515 1.00173.99 O
ATOM 2467 CB ALA A 324 2.716 41.429 -22.711 1.00173.46 C
ATOM 2468 N ASN A 325 0.087 42.762 -23.878 1.00173.40 N
ATOM 2469 CA ASN A 325 -1.368 42.870 -23.884 1.00173.62 C
ATOM 2470 C ASN A 325 -1.939 42.730 -25.288 1.00173.14 C
ATOM 2471 O ASN A 325 -2.976 42.097 -25.488 1.00172.73 O
ATOM 2472 CB ASN A 325 -1.808 44.202 -23.277 1.00174.29 C
ATOM 2473 CG ASN A 325 -1.672 44.230 -21.767 1.00174.97 C
ATOM 2474 OD1 ASN A 325 -1.874 43.218 -21.095 1.00175.90 O
ATOM 2475 ND2 ASN A 325 -1.336 45.395 -21.224 1.00174.32 N
ATOM 2476 N LEU A 326 -1.258 43.337 -26.253 1.00173.21 N
ATOM 2477 CA LEU A 326 -1.656 43.251 -27.652 1.00173.23 C
ATOM 2478 C LEU A 326 -1.692 41.804 -28.125 1.00172.99 C
ATOM 2479 O LEU A 326 -2.658 41.374 -28.750 1.00172.79 O
ATOM 2480 CB LEU A 326 -0.703 44.067 -28.524 1.00173.49 C
ATOM 2481 CG LEU A 326 -0.936 45.576 -28.548 1.00173.50 C
ATOM 2482 CD1 LEU A 326 0.193 46.277 -29.285 1.00173.98 C
ATOM 2483 CD2 LEU A 326 -2.269 45.876 -29.206 1.00174.19 C
ATOM 2484 N GLY A 327 -0.637 41.060 -27.807 1.00173.24 N
ATOM 2485 CA GLY A 327 -0.545 39.657 -28.166 1.00173.56 C
ATOM 2486 C GLY A 327 -1.722 38.845 -27.665 1.00173.32 C
ATOM 2487 O GLY A 327 -2.234 37.976 -28.369 1.00173.16 O
ATOM 2488 N MET A 328 -2.153 39.136 -26.443 1.00173.52 N
ATOM 2489 CA MET A 328 -3.307 38.467 -25.862 1.00174.03 C
ATOM 2490 C MET A 328 -4.569 38.863 -26.621 1.00173.47 C
ATOM 2491 O MET A 328 -5.349 38.009 -27.043 1.00174.11 O
ATOM 2492 CB MET A 328 -3.448 38.814 -24.381 1.00174.02 C
ATOM 2493 CG MET A 328 -2.231 38.495 -23.529 1.00173.52 C
ATOM 2494 SD MET A 328 -2.382 39.133 -21.847 1.00173.40 S
ATOM 2495 CE MET A 328 -0.730 39.762 -21.568 1.00173.28 C
ATOM 2496 N GLU A 329 -4.755 40.169 -26.788 1.00172.59 N
ATOM 2497 CA GLU A 329 -5.895 40.716 -27.515 1.00173.11 C
ATOM 2498 C GLU A 329 -5.972 40.181 -28.939 1.00172.82 C
ATOM 2499 O GLU A 329 -6.984 39.624 -29.359 1.00172.92 O
ATOM 2500 CB GLU A 329 -5.818 42.243 -27.539 1.00173.76 C
ATOM 2501 CG GLU A 329 -6.848 42.903 -28.438 1.00173.17 C
ATOM 2502 CD GLU A 329 -6.722 44.412 -28.454 1.00171.98 C
ATOM 2503 OE1 GLU A 329 -6.801 45.032 -27.373 1.00171.64 O
ATOM 2504 OE2 GLU A 329 -6.538 44.977 -29.552 1.00171.51 O
ATOM 2505 N VAL A 330 -4.885 40.358 -29.677 1.00172.84 N
ATOM 2506 CA VAL A 330 -4.818 39.957 -31.076 1.00173.59 C
ATOM 2507 C VAL A 330 -5.112 38.464 -31.294 1.00173.07 C
ATOM 2508 O VAL A 330 -5.666 38.082 -32.325 1.00174.00 O
ATOM 2509 CB VAL A 330 -3.426 40.317 -31.657 1.00174.49 C
ATOM 2510 CG1 VAL A 330 -3.161 39.594 -32.950 1.00173.75 C
ATOM 2511 CG2 VAL A 330 -3.317 41.820 -31.866 1.00174.66 C
ATOM 2512 N MET A 331 -4.802 37.631 -30.305 1.00172.01 N
ATOM 2513 CA MET A 331 -4.903 36.184 -30.485 1.00172.15 C
ATOM 2514 C MET A 331 -6.127 35.531 -29.838 1.00172.74 C
ATOM 2515 O MET A 331 -6.515 34.425 -30.220 1.00172.04 O
ATOM 2516 CB MET A 331 -3.643 35.505 -29.950 1.00172.38 C
ATOM 2517 CG MET A 331 -2.445 35.632 -30.870 1.00172.56 C
ATOM 2518 SD MET A 331 -2.752 34.867 -32.471 1.00172.96 S
ATOM 2519 CE MET A 331 -3.063 33.177 -31.978 1.00173.65 C
ATOM 2520 N HIS A 332 -6.738 36.205 -28.869 1.00173.33 N
ATOM 2521 CA HIS A 332 -7.867 35.618 -28.154 1.00173.32 C
ATOM 2522 C HIS A 332 -9.114 35.570 -29.030 1.00172.61 C
ATOM 2523 O HIS A 332 -9.400 36.512 -29.770 1.00173.16 O
ATOM 2524 CB HIS A 332 -8.164 36.394 -26.869 1.00173.79 C
ATOM 2525 CG HIS A 332 -8.974 37.634 -27.082 1.00173.78 C
ATOM 2526 ND1 HIS A 332 -8.551 38.673 -27.883 1.00174.06 N
ATOM 2527 CD2 HIS A 332 -10.188 37.998 -26.604 1.00173.30 C
ATOM 2528 CE1 HIS A 332 -9.465 39.625 -27.884 1.00174.09 C
ATOM 2529 NE2 HIS A 332 -10.469 39.240 -27.118 1.00173.10 N
ATOM 2530 N GLU A 333 -9.844 34.461 -28.933 1.00172.28 N
ATOM 2531 CA GLU A 333 -11.082 34.254 -29.681 1.00172.97 C
ATOM 2532 C GLU A 333 -10.879 34.502 -31.166 1.00173.37 C
ATOM 2533 O GLU A 333 -11.526 35.372 -31.753 1.00173.41 O
ATOM 2534 CB GLU A 333 -12.203 35.147 -29.156 1.00173.17 C
ATOM 2535 CG GLU A 333 -12.277 35.258 -27.651 1.00172.85 C
ATOM 2536 CD GLU A 333 -13.704 35.366 -27.162 1.00172.94 C
ATOM 2537 OE1 GLU A 333 -14.480 36.141 -27.757 1.00173.54 O
ATOM 2538 OE2 GLU A 333 -14.048 34.685 -26.173 1.00172.16 O
ATOM 2539 N ARG A 334 -9.946 33.745 -31.732 1.00173.20 N
ATOM 2540 CA ARG A 334 -9.586 33.759 -33.148 1.00172.74 C
ATOM 2541 C ARG A 334 -10.691 34.183 -34.107 1.00171.99 C
ATOM 2542 O ARG A 334 -10.648 35.268 -34.686 1.00172.03 O
ATOM 2543 CB ARG A 334 -9.117 32.365 -33.550 1.00172.84 C
ATOM 2544 CG ARG A 334 -7.849 31.897 -32.874 1.00172.65 C
ATOM 2545 CD ARG A 334 -7.811 30.388 -32.890 1.00173.38 C
ATOM 2546 NE ARG A 334 -8.819 29.837 -31.991 1.00173.43 N
ATOM 2547 CZ ARG A 334 -9.427 28.671 -32.177 1.00173.33 C
ATOM 2548 NH1 ARG A 334 -9.146 27.940 -33.243 1.00172.85 N
ATOM 2549 NH2 ARG A 334 -10.331 28.246 -31.304 1.00173.22 N
ATOM 2550 N ASN A 335 -11.680 33.311 -34.262 1.00171.30 N
ATOM 2551 CA ASN A 335 -12.693 33.453 -35.299 1.00172.31 C
ATOM 2552 C ASN A 335 -13.960 34.162 -34.827 1.00172.78 C
ATOM 2553 O ASN A 335 -14.985 34.141 -35.512 1.00174.06 O
ATOM 2554 CB ASN A 335 -13.039 32.076 -35.858 1.00172.31 C
ATOM 2555 CG ASN A 335 -11.814 31.196 -36.019 1.00172.46 C
ATOM 2556 OD1 ASN A 335 -11.026 31.373 -36.947 1.00172.69 O
ATOM 2557 ND2 ASN A 335 -11.644 30.244 -35.110 1.00173.25 N
ATOM 2558 N ALA A 336 -13.894 34.784 -33.656 1.00171.85 N
ATOM 2559 CA ALA A 336 -15.068 35.426 -33.076 1.00171.88 C
ATOM 2560 C ALA A 336 -15.269 36.857 -33.570 1.00172.81 C
ATOM 2561 O ALA A 336 -16.373 37.395 -33.493 1.00173.39 O
ATOM 2562 CB ALA A 336 -14.974 35.407 -31.560 1.00172.82 C
ATOM 2563 N HIS A 337 -14.203 37.475 -34.071 1.00172.53 N
ATOM 2564 CA HIS A 337 -14.260 38.878 -34.477 1.00172.31 C
ATOM 2565 C HIS A 337 -14.339 39.073 -35.991 1.00172.86 C
ATOM 2566 O HIS A 337 -13.660 38.388 -36.755 1.00172.60 O
ATOM 2567 CB HIS A 337 -13.052 39.631 -33.925 1.00171.75 C
ATOM 2568 CG HIS A 337 -12.916 39.539 -32.439 1.00172.54 C
ATOM 2569 ND1 HIS A 337 -12.492 38.394 -31.801 1.00173.65 N
ATOM 2570 CD2 HIS A 337 -13.163 40.445 -31.463 1.00173.31 C
ATOM 2571 CE1 HIS A 337 -12.473 38.600 -30.497 1.00174.11 C
ATOM 2572 NE2 HIS A 337 -12.878 39.836 -30.265 1.00173.93 N
ATOM 2573 N ASN A 338 -15.172 40.022 -36.406 1.00173.42 N
ATOM 2574 CA ASN A 338 -15.323 40.372 -37.813 1.00173.03 C
ATOM 2575 C ASN A 338 -14.991 41.837 -38.061 1.00172.48 C
ATOM 2576 O ASN A 338 -14.812 42.260 -39.201 1.00171.97 O
ATOM 2577 CB ASN A 338 -16.747 40.079 -38.290 1.00172.94 C
ATOM 2578 CG ASN A 338 -17.045 38.596 -38.362 1.00173.96 C
ATOM 2579 OD1 ASN A 338 -16.139 37.766 -38.293 1.00174.35 O
ATOM 2580 ND2 ASN A 338 -18.322 38.254 -38.499 1.00174.16 N
ATOM 2581 N PHE A 339 -14.905 42.603 -36.980 1.00172.55 N
ATOM 2582 CA PHE A 339 -14.748 44.050 -37.067 1.00173.10 C
ATOM 2583 C PHE A 339 -13.557 44.532 -36.232 1.00173.55 C
ATOM 2584 O PHE A 339 -13.184 43.882 -35.257 1.00174.17 O
ATOM 2585 CB PHE A 339 -16.048 44.728 -36.623 1.00173.16 C
ATOM 2586 CG PHE A 339 -17.250 44.295 -37.414 1.00173.52 C
ATOM 2587 CD1 PHE A 339 -18.419 43.919 -36.776 1.00173.13 C
ATOM 2588 CD2 PHE A 339 -17.211 44.268 -38.800 1.00174.17 C
ATOM 2589 CE1 PHE A 339 -19.525 43.518 -37.503 1.00173.25 C
ATOM 2590 CE2 PHE A 339 -18.313 43.868 -39.532 1.00174.14 C
ATOM 2591 CZ PHE A 339 -19.471 43.494 -38.884 1.00173.67 C
ATOM 2592 N PRO A 340 -12.954 45.671 -36.622 1.00173.85 N
ATOM 2593 CA PRO A 340 -11.725 46.202 -36.016 1.00174.03 C
ATOM 2594 C PRO A 340 -11.750 46.351 -34.497 1.00173.44 C
ATOM 2595 O PRO A 340 -10.836 45.865 -33.832 1.00172.95 O
ATOM 2596 CB PRO A 340 -11.592 47.573 -36.678 1.00174.57 C
ATOM 2597 CG PRO A 340 -12.170 47.368 -38.019 1.00174.38 C
ATOM 2598 CD PRO A 340 -13.366 46.488 -37.779 1.00174.24 C
ATOM 2599 N LEU A 341 -12.770 47.012 -33.959 1.00173.04 N
ATOM 2600 CA LEU A 341 -12.799 47.285 -32.525 1.00172.23 C
ATOM 2601 C LEU A 341 -13.523 46.198 -31.748 1.00172.01 C
ATOM 2602 O LEU A 341 -14.600 45.749 -32.137 1.00171.86 O
ATOM 2603 CB LEU A 341 -13.458 48.635 -32.240 1.00172.60 C
ATOM 2604 CG LEU A 341 -12.944 49.832 -33.037 1.00173.15 C
ATOM 2605 CD1 LEU A 341 -13.739 51.074 -32.689 1.00173.81 C
ATOM 2606 CD2 LEU A 341 -11.466 50.046 -32.763 1.00173.32 C
ATOM 2607 N ASP A 342 -12.922 45.783 -30.641 1.00172.09 N
ATOM 2608 CA ASP A 342 -13.544 44.808 -29.759 1.00173.21 C
ATOM 2609 C ASP A 342 -14.401 45.522 -28.720 1.00173.58 C
ATOM 2610 O ASP A 342 -13.925 45.852 -27.633 1.00173.69 O
ATOM 2611 CB ASP A 342 -12.485 43.946 -29.073 1.00173.82 C
ATOM 2612 CG ASP A 342 -13.071 42.700 -28.448 1.00173.06 C
ATOM 2613 OD1 ASP A 342 -14.306 42.543 -28.511 1.00172.68 O
ATOM 2614 OD2 ASP A 342 -12.307 41.881 -27.895 1.00172.51 O
ATOM 2615 N LEU A 343 -15.666 45.756 -29.055 1.00173.59 N
ATOM 2616 CA LEU A 343 -16.556 46.493 -28.164 1.00173.68 C
ATOM 2617 C LEU A 343 -17.674 45.639 -27.593 1.00173.96 C
ATOM 2618 O LEU A 343 -18.813 46.099 -27.512 1.00175.36 O
ATOM 2619 CB LEU A 343 -17.179 47.671 -28.905 1.00174.27 C
ATOM 2620 CG LEU A 343 -16.240 48.563 -29.708 1.00174.77 C
ATOM 2621 CD1 LEU A 343 -17.054 49.518 -30.569 1.00175.44 C
ATOM 2622 CD2 LEU A 343 -15.311 49.322 -28.786 1.00174.37 C
ATOM 2623 N ALA A 344 -17.350 44.422 -27.169 1.00173.29 N
ATOM 2624 CA ALA A 344 -18.365 43.482 -26.713 1.00174.06 C
ATOM 2625 C ALA A 344 -17.735 42.204 -26.200 1.00173.63 C
ATOM 2626 O ALA A 344 -17.263 42.142 -25.069 1.00172.48 O
ATOM 2627 CB ALA A 344 -19.335 43.160 -27.848 1.00175.76 C
ATOM 2628 OXT ALA A 344 -17.659 41.220 -26.934 1.00174.37 O
HETATM41093 FE FE2 A 401 -5.134 34.724 17.528 1.00170.40 F
HETATM41094 MG CLA A 402 -4.700 38.450 -9.847 1.00174.24 M
HETATM41095 CHA CLA A 402 -8.084 38.336 -9.084 1.00174.27 C
HETATM41096 CHB CLA A 402 -3.959 38.278 -6.529 1.00174.24 C
HETATM41097 CHC CLA A 402 -1.370 38.490 -10.661 1.00173.97 C
HETATM41098 CHD CLA A 402 -5.542 38.762 -13.275 1.00172.81 C
HETATM41099 NA CLA A 402 -5.855 38.318 -8.113 1.00175.53 N
HETATM41100 C1A CLA A 402 -7.251 38.276 -8.004 1.00175.06 C
HETATM41101 C2A CLA A 402 -7.689 38.186 -6.547 1.00174.66 C
HETATM41102 C3A CLA A 402 -6.363 38.328 -5.766 1.00174.34 C
HETATM41103 C4A CLA A 402 -5.300 38.287 -6.862 1.00174.83 C
HETATM41104 CMA CLA A 402 -6.311 39.646 -5.039 1.00174.07 C
HETATM41105 CAA CLA A 402 -8.330 36.836 -6.287 1.00173.78 C
HETATM41106 CBA CLA A 402 -8.135 36.397 -4.853 1.00173.49 C
HETATM41107 CGA CLA A 402 -9.415 36.585 -4.103 1.00173.59 C
HETATM41108 O1A CLA A 402 -9.685 37.414 -3.232 1.00174.26 O
HETATM41109 O2A CLA A 402 -10.377 35.692 -4.479 1.00172.62 O
HETATM41110 NB CLA A 402 -2.984 38.386 -8.797 1.00174.30 N
HETATM41111 C1B CLA A 402 -2.892 38.282 -7.445 1.00174.44 C
HETATM41112 C2B CLA A 402 -1.463 38.208 -7.039 1.00174.55 C
HETATM41113 C3B CLA A 402 -0.710 38.266 -8.189 1.00174.49 C
HETATM41114 C4B CLA A 402 -1.672 38.386 -9.334 1.00174.34 C
HETATM41115 CMB CLA A 402 -1.039 38.105 -5.646 1.00174.32 C
HETATM41116 CAB CLA A 402 0.729 38.242 -8.299 1.00174.18 C
HETATM41117 CBB CLA A 402 1.464 37.922 -9.365 1.00174.34 C
HETATM41118 NC CLA A 402 -3.656 38.596 -11.645 1.00173.18 N
HETATM41119 C1C CLA A 402 -2.291 38.595 -11.744 1.00173.73 C
HETATM41120 C2C CLA A 402 -1.894 38.718 -13.143 1.00174.22 C
HETATM41121 C3C CLA A 402 -3.075 38.800 -13.881 1.00174.26 C
HETATM41122 C4C CLA A 402 -4.179 38.724 -12.934 1.00173.29 C
HETATM41123 CMC CLA A 402 -0.513 38.750 -13.628 1.00173.95 C
HETATM41124 CAC CLA A 402 -3.203 38.945 -15.335 1.00174.77 C
HETATM41125 CBC CLA A 402 -3.359 37.609 -16.016 1.00175.17 C
HETATM41126 ND CLA A 402 -6.374 38.523 -10.979 1.00173.21 N
HETATM41127 C1D CLA A 402 -6.583 38.669 -12.376 1.00172.67 C
HETATM41128 C2D CLA A 402 -8.039 38.690 -12.644 1.00173.03 C
HETATM41129 C3D CLA A 402 -8.663 38.544 -11.419 1.00172.97 C
HETATM41130 C4D CLA A 402 -7.582 38.459 -10.417 1.00173.40 C
HETATM41131 CMD CLA A 402 -8.638 38.825 -13.968 1.00174.01 C
HETATM41132 CAD CLA A 402 -9.928 38.464 -10.707 1.00173.40 C
HETATM41133 OBD CLA A 402 -11.072 38.475 -11.149 1.00174.28 O
HETATM41134 CBD CLA A 402 -9.593 38.340 -9.188 1.00173.66 C
HETATM41135 CGD CLA A 402 -10.224 39.418 -8.346 1.00174.25 C
HETATM41136 O1D CLA A 402 -9.968 40.626 -8.327 1.00174.65 O
HETATM41137 O2D CLA A 402 -11.191 38.952 -7.507 1.00174.60 O
HETATM41138 CED CLA A 402 -12.537 38.955 -7.985 1.00175.44 C
HETATM41139 C1 CLA A 402 -11.674 35.878 -3.879 1.00173.11 C
HETATM41140 C2 CLA A 402 -12.138 34.541 -3.434 1.00173.30 C
HETATM41141 C3 CLA A 402 -13.025 33.811 -4.127 1.00173.67 C
HETATM41142 C4 CLA A 402 -13.612 34.284 -5.403 1.00173.78 C
HETATM41143 C5 CLA A 402 -13.457 32.473 -3.636 1.00173.62 C
HETATM41144 C6 CLA A 402 -14.676 32.536 -2.736 1.00173.24 C
HETATM41145 C7 CLA A 402 -15.921 32.134 -3.499 1.00173.53 C
HETATM41146 C8 CLA A 402 -17.013 31.614 -2.574 1.00173.19 C
HETATM41147 C9 CLA A 402 -17.449 32.697 -1.609 1.00173.79 C
HETATM41148 C10 CLA A 402 -16.536 30.387 -1.807 1.00173.93 C
HETATM41149 C11 CLA A 402 -16.381 29.185 -2.713 1.00174.21 C
HETATM41150 C12 CLA A 402 -16.346 27.892 -1.921 1.00174.71 C
HETATM41151 C13 CLA A 402 -16.327 26.656 -2.815 1.00174.62 C
HETATM41152 C14 CLA A 402 -17.095 26.879 -4.102 1.00174.97 C
HETATM41153 C15 CLA A 402 -16.897 25.443 -2.091 1.00173.58 C
HETATM41154 C16 CLA A 402 -15.943 24.909 -1.045 1.00172.84 C
HETATM41155 C17 CLA A 402 -16.205 23.445 -0.766 1.00173.32 C
HETATM41156 C18 CLA A 402 -15.500 22.966 0.496 1.00173.61 C
HETATM41157 C19 CLA A 402 -15.866 21.530 0.805 1.00174.03 C
HETATM41158 C20 CLA A 402 -13.999 23.093 0.349 1.00173.00 C
HETATM41159 MG CLA A 403 -9.287 29.811 -7.923 1.00172.19 M
HETATM41160 CHA CLA A 403 -6.389 27.903 -7.799 1.00173.73 C
HETATM41161 CHB CLA A 403 -11.017 27.295 -6.426 1.00173.19 C
HETATM41162 CHC CLA A 403 -12.095 31.784 -7.974 1.00173.46 C
HETATM41163 CHD CLA A 403 -7.454 32.386 -9.532 1.00173.37 C
HETATM41164 NA CLA A 403 -8.760 27.915 -7.228 1.00173.66 N
HETATM41165 C1A CLA A 403 -7.497 27.300 -7.256 1.00174.01 C
HETATM41166 C2A CLA A 403 -7.564 25.905 -6.628 1.00173.89 C
HETATM41167 C3A CLA A 403 -9.070 25.704 -6.342 1.00174.03 C
HETATM41168 C4A CLA A 403 -9.676 27.068 -6.664 1.00173.74 C
HETATM41169 CMA CLA A 403 -9.673 24.616 -7.194 1.00174.24 C
HETATM41170 CAA CLA A 403 -6.798 25.786 -5.311 1.00173.55 C
HETATM41171 CBA CLA A 403 -6.239 27.067 -4.713 1.00173.89 C
HETATM41172 CGA CLA A 403 -7.229 27.786 -3.849 1.00173.62 C
HETATM41173 O1A CLA A 403 -8.382 28.131 -4.112 1.00174.10 O
HETATM41174 O2A CLA A 403 -6.725 28.084 -2.613 1.00172.66 O
HETATM41175 NB CLA A 403 -11.207 29.562 -7.369 1.00171.89 N
HETATM41176 C1B CLA A 403 -11.699 28.492 -6.694 1.00172.54 C
HETATM41177 C2B CLA A 403 -13.102 28.752 -6.273 1.00172.86 C
HETATM41178 C3B CLA A 403 -13.421 30.017 -6.706 1.00172.93 C
HETATM41179 C4B CLA A 403 -12.214 30.554 -7.404 1.00172.69 C
HETATM41180 CMB CLA A 403 -13.905 27.786 -5.527 1.00173.49 C
HETATM41181 CAB CLA A 403 -14.646 30.752 -6.533 1.00173.71 C
HETATM41182 CBB CLA A 403 -15.318 31.388 -7.493 1.00174.07 C
HETATM41183 NC CLA A 403 -9.692 31.729 -8.636 1.00173.69 N
HETATM41184 C1C CLA A 403 -10.915 32.337 -8.551 1.00173.98 C
HETATM41185 C2C CLA A 403 -10.853 33.668 -9.139 1.00174.04 C
HETATM41186 C3C CLA A 403 -9.540 33.842 -9.585 1.00173.60 C
HETATM41187 C4C CLA A 403 -8.817 32.617 -9.266 1.00173.78 C
HETATM41188 CMC CLA A 403 -11.987 34.592 -9.206 1.00174.23 C
HETATM41189 CAC CLA A 403 -8.977 35.021 -10.257 1.00172.93 C
HETATM41190 CBC CLA A 403 -9.531 35.184 -11.653 1.00173.33 C
HETATM41191 ND CLA A 403 -7.377 30.162 -8.494 1.00173.56 N
HETATM41192 C1D CLA A 403 -6.761 31.249 -9.173 1.00173.55 C
HETATM41193 C2D CLA A 403 -5.331 30.930 -9.398 1.00173.75 C
HETATM41194 C3D CLA A 403 -5.133 29.662 -8.882 1.00173.28 C
HETATM41195 C4D CLA A 403 -6.439 29.224 -8.351 1.00173.46 C
HETATM41196 CMD CLA A 403 -4.361 31.820 -10.034 1.00174.14 C
HETATM41197 CAD CLA A 403 -4.179 28.594 -8.645 1.00172.51 C
HETATM41198 OBD CLA A 403 -2.979 28.548 -8.891 1.00171.67 O
HETATM41199 CBD CLA A 403 -4.966 27.420 -7.991 1.00173.00 C
HETATM41200 CGD CLA A 403 -4.901 26.199 -8.863 1.00172.43 C
HETATM41201 O1D CLA A 403 -4.799 26.159 -10.092 1.00171.50 O
HETATM41202 O2D CLA A 403 -4.960 25.020 -8.186 1.00173.38 O
HETATM41203 CED CLA A 403 -4.943 23.819 -8.959 1.00173.78 C
HETATM41204 C1 CLA A 403 -7.640 28.663 -1.662 1.00173.03 C
HETATM41205 C2 CLA A 403 -7.442 27.919 -0.394 1.00173.14 C
HETATM41206 C3 CLA A 403 -8.417 27.213 0.203 1.00173.32 C
HETATM41207 C4 CLA A 403 -8.182 26.479 1.469 1.00172.93 C
HETATM41208 C5 CLA A 403 -9.786 27.135 -0.381 1.00174.27 C
HETATM41209 C6 CLA A 403 -10.410 25.755 -0.270 1.00174.12 C
HETATM41210 C7 CLA A 403 -10.164 24.925 -1.516 1.00174.77 C
HETATM41211 C8 CLA A 403 -11.202 25.149 -2.615 1.00175.36 C
HETATM41212 C9 CLA A 403 -12.565 25.473 -2.035 1.00174.36 C
HETATM41213 C10 CLA A 403 -11.288 23.926 -3.525 1.00175.11 C
HETATM41214 C11 CLA A 403 -12.536 23.921 -4.383 1.00173.74 C
HETATM41215 C12 CLA A 403 -12.461 22.867 -5.468 1.00173.32 C
HETATM41216 C13 CLA A 403 -13.848 22.452 -5.939 1.00172.43 C
HETATM41217 C14 CLA A 403 -14.579 23.619 -6.569 1.00172.67 C
HETATM41218 C15 CLA A 403 -14.670 21.872 -4.794 1.00172.98 C
HETATM41219 C16 CLA A 403 -15.334 20.576 -5.207 1.00173.19 C
HETATM41220 C17 CLA A 403 -16.203 20.019 -4.099 1.00174.06 C
HETATM41221 C18 CLA A 403 -17.603 19.666 -4.585 1.00173.86 C
HETATM41222 C19 CLA A 403 -18.524 19.384 -3.417 1.00174.64 C
HETATM41223 C20 CLA A 403 -18.176 20.780 -5.438 1.00173.27 C
HETATM41224 MG CLA A 404 5.844 43.395 -5.302 1.00170.01 M
HETATM41225 CHA CLA A 404 2.874 45.183 -5.420 1.00172.99 C
HETATM41226 CHB CLA A 404 7.130 45.686 -3.130 1.00172.77 C
HETATM41227 CHC CLA A 404 8.731 41.543 -5.151 1.00172.99 C
HETATM41228 CHD CLA A 404 4.457 41.031 -7.548 1.00171.34 C
HETATM41229 NA CLA A 404 5.099 45.142 -4.431 1.00171.41 N
HETATM41230 C1A CLA A 404 3.831 45.717 -4.597 1.00172.39 C
HETATM41231 C2A CLA A 404 3.683 46.982 -3.756 1.00172.21 C
HETATM41232 C3A CLA A 404 5.088 47.173 -3.142 1.00172.48 C
HETATM41233 C4A CLA A 404 5.841 45.911 -3.574 1.00172.28 C
HETATM41234 CMA CLA A 404 5.752 48.435 -3.633 1.00173.16 C
HETATM41235 CAA CLA A 404 2.689 46.714 -2.635 1.00173.18 C
HETATM41236 CBA CLA A 404 2.985 45.380 -1.967 1.00174.20 C
HETATM41237 CGA CLA A 404 2.096 45.085 -0.797 1.00174.11 C
HETATM41238 O1A CLA A 404 1.189 45.769 -0.319 1.00174.54 O
HETATM41239 O2A CLA A 404 2.378 43.873 -0.222 1.00173.11 O
HETATM41240 NB CLA A 404 7.603 43.593 -4.347 1.00171.88 N
HETATM41241 C1B CLA A 404 7.926 44.579 -3.472 1.00172.48 C
HETATM41242 C2B CLA A 404 9.288 44.336 -2.916 1.00173.41 C
HETATM41243 C3B CLA A 404 9.745 43.169 -3.483 1.00173.67 C
HETATM41244 C4B CLA A 404 8.679 42.678 -4.401 1.00172.83 C
HETATM41245 CMB CLA A 404 9.923 45.220 -1.943 1.00174.15 C
HETATM41246 CAB CLA A 404 10.990 42.471 -3.296 1.00174.54 C
HETATM41247 CBB CLA A 404 12.162 42.862 -3.804 1.00173.73 C
HETATM41248 NC CLA A 404 6.471 41.616 -6.198 1.00170.64 N
HETATM41249 C1C CLA A 404 7.695 41.040 -5.991 1.00172.03 C
HETATM41250 C2C CLA A 404 7.807 39.810 -6.762 1.00172.11 C
HETATM41251 C3C CLA A 404 6.599 39.655 -7.445 1.00171.16 C
HETATM41252 C4C CLA A 404 5.762 40.796 -7.080 1.00170.88 C
HETATM41253 CMC CLA A 404 8.988 38.943 -6.771 1.00173.37 C
HETATM41254 CAC CLA A 404 6.227 38.559 -8.354 1.00171.93 C
HETATM41255 CBC CLA A 404 6.982 38.605 -9.663 1.00172.64 C
HETATM41256 ND CLA A 404 4.097 43.101 -6.271 1.00171.58 N
HETATM41257 C1D CLA A 404 3.663 42.100 -7.184 1.00171.93 C
HETATM41258 C2D CLA A 404 2.290 42.426 -7.633 1.00173.13 C
HETATM41259 C3D CLA A 404 1.941 43.603 -6.996 1.00172.81 C
HETATM41260 C4D CLA A 404 3.099 43.978 -6.160 1.00172.58 C
HETATM41261 CMD CLA A 404 1.512 41.627 -8.578 1.00173.95 C
HETATM41262 CAD CLA A 404 0.916 44.614 -6.807 1.00172.44 C
HETATM41263 OBD CLA A 404 -0.199 44.696 -7.311 1.00171.69 O
HETATM41264 CBD CLA A 404 1.490 45.662 -5.802 1.00173.16 C
HETATM41265 CGD CLA A 404 1.542 47.032 -6.421 1.00173.36 C
HETATM41266 O1D CLA A 404 1.963 47.334 -7.542 1.00173.35 O
HETATM41267 O2D CLA A 404 1.061 48.027 -5.623 1.00173.83 O
HETATM41268 CED CLA A 404 1.377 49.376 -5.974 1.00173.95 C
HETATM41269 C1 CLA A 404 1.982 43.686 1.155 1.00173.23 C
HETATM41270 C2 CLA A 404 3.067 44.241 2.003 1.00173.51 C
HETATM41271 C3 CLA A 404 2.862 44.667 3.262 1.00173.34 C
HETATM41272 C4 CLA A 404 1.528 44.614 3.905 1.00173.41 C
HETATM41273 C5 CLA A 404 3.984 45.217 4.075 1.00173.30 C
HETATM41274 C6 CLA A 404 4.104 46.725 3.957 1.00173.82 C
HETATM41275 C7 CLA A 404 5.541 47.133 3.700 1.00174.00 C
HETATM41276 C8 CLA A 404 5.642 48.355 2.792 1.00174.25 C
HETATM41277 C9 CLA A 404 6.660 48.117 1.695 1.00173.83 C
HETATM41278 C10 CLA A 404 5.999 49.608 3.586 1.00175.02 C
HETATM41279 C11 CLA A 404 7.384 49.529 4.194 1.00175.00 C
HETATM41280 C12 CLA A 404 7.691 50.730 5.068 1.00174.43 C
HETATM41281 C13 CLA A 404 8.832 51.566 4.501 1.00173.23 C
HETATM41282 C14 CLA A 404 10.150 50.831 4.619 1.00172.78 C
HETATM41283 C15 CLA A 404 8.930 52.921 5.194 1.00173.63 C
HETATM41284 C16 CLA A 404 9.299 52.754 6.653 1.00174.18 C
HETATM41285 C17 CLA A 404 10.029 53.966 7.192 1.00175.07 C
HETATM41286 C18 CLA A 404 9.416 54.465 8.494 1.00174.97 C
HETATM41287 C19 CLA A 404 9.744 53.533 9.642 1.00173.83 C
HETATM41288 C20 CLA A 404 9.903 55.865 8.806 1.00175.03 C
HETATM41289 MG CLA A 405 -33.985 25.323 -8.650 1.00172.98 M
HETATM41290 CHA CLA A 405 -33.663 26.604 -11.863 1.00174.60 C
HETATM41291 CHB CLA A 405 -33.806 28.468 -7.374 1.00173.94 C
HETATM41292 CHC CLA A 405 -34.288 23.998 -5.492 1.00172.75 C
HETATM41293 CHD CLA A 405 -34.036 22.056 -10.011 1.00174.42 C
HETATM41294 NA CLA A 405 -33.786 27.217 -9.508 1.00174.28 N
HETATM41295 C1A CLA A 405 -33.662 27.547 -10.866 1.00174.36 C
HETATM41296 C2A CLA A 405 -33.523 29.059 -11.051 1.00174.16 C
HETATM41297 C3A CLA A 405 -33.454 29.600 -9.605 1.00173.75 C
HETATM41298 C4A CLA A 405 -33.714 28.357 -8.750 1.00174.26 C
HETATM41299 CMA CLA A 405 -32.111 30.215 -9.306 1.00173.48 C
HETATM41300 CAA CLA A 405 -34.740 29.632 -11.753 1.00174.12 C
HETATM41301 CBA CLA A 405 -36.021 29.073 -11.172 1.00174.00 C
HETATM41302 CGA CLA A 405 -37.182 29.941 -11.544 1.00174.51 C
HETATM41303 O1A CLA A 405 -37.498 30.365 -12.659 1.00174.37 O
HETATM41304 O2A CLA A 405 -37.960 30.271 -10.468 1.00175.01 O
HETATM41305 NB CLA A 405 -33.955 26.081 -6.786 1.00172.53 N
HETATM41306 C1B CLA A 405 -34.020 27.402 -6.483 1.00173.41 C
HETATM41307 C2B CLA A 405 -34.342 27.584 -5.038 1.00174.22 C
HETATM41308 C3B CLA A 405 -34.478 26.323 -4.502 1.00174.45 C
HETATM41309 C4B CLA A 405 -34.238 25.352 -5.607 1.00173.00 C
HETATM41310 CMB CLA A 405 -34.482 28.899 -4.415 1.00174.03 C
HETATM41311 CAB CLA A 405 -34.793 25.892 -3.164 1.00174.71 C
HETATM41312 CBB CLA A 405 -34.252 26.379 -2.044 1.00173.94 C
HETATM41313 NC CLA A 405 -34.145 23.382 -7.898 1.00173.10 N
HETATM41314 C1C CLA A 405 -34.246 23.069 -6.569 1.00172.87 C
HETATM41315 C2C CLA A 405 -34.305 21.623 -6.397 1.00173.68 C
HETATM41316 C3C CLA A 405 -34.248 21.072 -7.676 1.00173.85 C
HETATM41317 C4C CLA A 405 -34.141 22.183 -8.615 1.00173.95 C
HETATM41318 CMC CLA A 405 -34.412 20.933 -5.109 1.00174.37 C
HETATM41319 CAC CLA A 405 -34.266 19.648 -8.031 1.00173.78 C
HETATM41320 CBC CLA A 405 -35.649 19.193 -8.428 1.00174.06 C
HETATM41321 ND CLA A 405 -34.009 24.469 -10.484 1.00174.05 N
HETATM41322 C1D CLA A 405 -33.972 23.110 -10.900 1.00174.30 C
HETATM41323 C2D CLA A 405 -33.859 23.060 -12.376 1.00174.17 C
HETATM41324 C3D CLA A 405 -33.772 24.373 -12.800 1.00174.50 C
HETATM41325 C4D CLA A 405 -33.825 25.207 -11.580 1.00174.30 C
HETATM41326 CMD CLA A 405 -33.851 21.830 -13.163 1.00174.25 C
HETATM41327 CAD CLA A 405 -33.640 25.267 -13.937 1.00175.31 C
HETATM41328 OBD CLA A 405 -33.637 25.006 -15.137 1.00175.70 O
HETATM41329 CBD CLA A 405 -33.478 26.711 -13.362 1.00175.21 C
HETATM41330 CGD CLA A 405 -32.140 27.298 -13.726 1.00175.11 C
HETATM41331 O1D CLA A 405 -31.040 27.036 -13.232 1.00174.39 O
HETATM41332 O2D CLA A 405 -32.199 28.222 -14.729 1.00175.57 O
HETATM41333 CED CLA A 405 -30.976 28.663 -15.323 1.00174.56 C
HETATM41334 C1 CLA A 405 -39.003 31.242 -10.698 1.00174.69 C
HETATM41335 C2 CLA A 405 -39.906 31.196 -9.520 1.00174.44 C
HETATM41336 C3 CLA A 405 -40.957 32.019 -9.364 1.00174.04 C
HETATM41337 C4 CLA A 405 -41.309 33.052 -10.368 1.00173.91 C
HETATM41338 C5 CLA A 405 -41.828 31.923 -8.159 1.00174.27 C
HETATM41339 C6 CLA A 405 -41.229 32.607 -6.943 1.00174.68 C
HETATM41340 C7 CLA A 405 -42.100 32.402 -5.719 1.00174.73 C
HETATM41341 C8 CLA A 405 -43.070 33.558 -5.501 1.00175.35 C
HETATM41342 C9 CLA A 405 -42.404 34.663 -4.706 1.00174.39 C
HETATM41343 C10 CLA A 405 -44.331 33.084 -4.786 1.00176.08 C
HETATM41344 C11 CLA A 405 -45.563 33.824 -5.264 1.00175.21 C
HETATM41345 C12 CLA A 405 -46.720 33.676 -4.297 1.00175.23 C
HETATM41346 C13 CLA A 405 -47.669 32.558 -4.710 1.00174.89 C
HETATM41347 C14 CLA A 405 -48.666 33.062 -5.733 1.00173.20 C
HETATM41348 C15 CLA A 405 -48.390 31.968 -3.500 1.00174.78 C
HETATM41349 C16 CLA A 405 -49.509 31.032 -3.912 1.00173.86 C
HETATM41350 C17 CLA A 405 -50.707 31.152 -2.992 1.00173.77 C
HETATM41351 C18 CLA A 405 -50.377 30.751 -1.560 1.00173.50 C
HETATM41352 C19 CLA A 405 -51.214 31.537 -0.572 1.00173.36 C
HETATM41353 C20 CLA A 405 -50.600 29.267 -1.363 1.00172.74 C
HETATM41354 C2 PL9 A 406 1.807 41.721 16.552 1.00174.63 C
HETATM41355 C3 PL9 A 406 1.254 40.578 16.044 1.00175.02 C
HETATM41356 C4 PL9 A 406 0.983 39.453 16.917 1.00174.91 C
HETATM41357 C5 PL9 A 406 1.310 39.575 18.327 1.00174.88 C
HETATM41358 C6 PL9 A 406 1.865 40.733 18.825 1.00174.26 C
HETATM41359 C1 PL9 A 406 2.132 41.846 17.944 1.00174.11 C
HETATM41360 C7 PL9 A 406 0.945 40.520 14.600 1.00174.99 C
HETATM41361 C8 PL9 A 406 1.834 41.329 13.718 1.00174.79 C
HETATM41362 C9 PL9 A 406 1.376 42.309 12.935 1.00173.82 C
HETATM41363 C10 PL9 A 406 0.050 42.269 12.291 1.00173.42 C
HETATM41364 C11 PL9 A 406 2.023 43.643 13.047 1.00173.48 C
HETATM41365 C12 PL9 A 406 2.375 44.170 11.650 1.00172.90 C
HETATM41366 C13 PL9 A 406 3.198 45.383 11.868 1.00173.03 C
HETATM41367 C14 PL9 A 406 3.272 46.374 10.986 1.00173.81 C
HETATM41368 C15 PL9 A 406 2.152 47.328 10.788 1.00174.42 C
HETATM41369 C16 PL9 A 406 4.347 46.457 9.963 1.00174.30 C
HETATM41370 C17 PL9 A 406 5.541 47.333 10.360 1.00174.26 C
HETATM41371 C18 PL9 A 406 6.360 47.644 9.134 1.00174.51 C
HETATM41372 C19 PL9 A 406 7.353 48.539 9.036 1.00174.73 C
HETATM41373 C20 PL9 A 406 7.090 49.990 8.985 1.00173.93 C
HETATM41374 C21 PL9 A 406 8.759 48.061 9.162 1.00175.72 C
HETATM41375 C22 PL9 A 406 9.509 48.049 7.813 1.00175.15 C
HETATM41376 C23 PL9 A 406 10.972 47.926 8.097 1.00175.39 C
HETATM41377 C24 PL9 A 406 11.797 48.960 7.928 1.00174.94 C
HETATM41378 C25 PL9 A 406 11.467 50.335 8.347 1.00174.10 C
HETATM41379 C26 PL9 A 406 12.878 48.813 6.927 1.00174.42 C
HETATM41380 C27 PL9 A 406 14.222 49.244 7.526 1.00174.03 C
HETATM41381 C28 PL9 A 406 14.639 50.509 6.876 1.00173.62 C
HETATM41382 C29 PL9 A 406 15.918 50.851 6.750 1.00173.62 C
HETATM41383 C30 PL9 A 406 16.388 51.554 5.529 1.00173.69 C
HETATM41384 C31 PL9 A 406 16.834 50.966 7.918 1.00174.73 C
HETATM41385 C32 PL9 A 406 17.753 52.200 7.878 1.00174.48 C
HETATM41386 C33 PL9 A 406 18.366 52.296 9.237 1.00174.68 C
HETATM41387 C34 PL9 A 406 19.349 53.145 9.534 1.00174.35 C
HETATM41388 C35 PL9 A 406 20.075 53.954 8.541 1.00174.85 C
HETATM41389 C36 PL9 A 406 19.667 53.345 10.971 1.00173.59 C
HETATM41390 C37 PL9 A 406 21.162 53.602 11.127 1.00173.18 C
HETATM41391 C38 PL9 A 406 21.427 53.691 12.597 1.00173.63 C
HETATM41392 C39 PL9 A 406 22.153 52.793 13.243 1.00173.68 C
HETATM41393 C40 PL9 A 406 23.600 52.661 12.978 1.00172.52 C
HETATM41394 C41 PL9 A 406 21.444 51.748 14.027 1.00174.47 C
HETATM41395 C52 PL9 A 406 1.023 38.417 19.195 1.00175.23 C
HETATM41396 C53 PL9 A 406 2.215 40.915 20.228 1.00174.35 C
HETATM41397 O1 PL9 A 406 0.482 38.439 16.429 1.00174.81 O
HETATM41398 O2 PL9 A 406 2.633 42.926 18.313 1.00174.39 O
HETATM41399 C1 BCR A 407 -36.412 20.029 3.639 1.00174.32 C
HETATM41400 C2 BCR A 407 -37.159 21.015 4.523 1.00174.75 C
HETATM41401 C3 BCR A 407 -36.519 22.373 4.582 1.00173.94 C
HETATM41402 C4 BCR A 407 -35.063 22.279 4.953 1.00173.18 C
HETATM41403 C5 BCR A 407 -34.364 21.313 4.082 1.00172.68 C
HETATM41404 C6 BCR A 407 -34.955 20.301 3.460 1.00173.59 C
HETATM41405 C7 BCR A 407 -34.203 19.379 2.611 1.00173.71 C
HETATM41406 C8 BCR A 407 -33.948 19.652 1.330 1.00174.08 C
HETATM41407 C9 BCR A 407 -33.121 18.823 0.473 1.00174.60 C
HETATM41408 C10 BCR A 407 -33.045 19.107 -0.833 1.00174.28 C
HETATM41409 C11 BCR A 407 -32.277 18.355 -1.792 1.00173.47 C
HETATM41410 C33 BCR A 407 -32.924 21.586 3.924 1.00171.74 C
HETATM41411 C31 BCR A 407 -37.140 19.988 2.312 1.00173.64 C
HETATM41412 C32 BCR A 407 -36.566 18.677 4.301 1.00174.45 C
HETATM41413 C34 BCR A 407 -32.276 17.788 1.099 1.00174.57 C
HETATM41414 C12 BCR A 407 -32.213 18.806 -3.047 1.00172.81 C
HETATM41415 C13 BCR A 407 -31.524 18.135 -4.121 1.00173.40 C
HETATM41416 C14 BCR A 407 -31.493 18.708 -5.331 1.00174.31 C
HETATM41417 C15 BCR A 407 -30.764 18.184 -6.456 1.00174.70 C
HETATM41418 C16 BCR A 407 -30.829 18.798 -7.645 1.00174.36 C
HETATM41419 C17 BCR A 407 -30.018 18.307 -8.729 1.00174.10 C
HETATM41420 C18 BCR A 407 -29.961 18.822 -9.961 1.00174.34 C
HETATM41421 C19 BCR A 407 -29.145 18.161 -10.960 1.00174.99 C
HETATM41422 C20 BCR A 407 -29.157 18.511 -12.247 1.00174.82 C
HETATM41423 C21 BCR A 407 -28.295 17.813 -13.169 1.00174.55 C
HETATM41424 C22 BCR A 407 -28.302 17.941 -14.501 1.00173.93 C
HETATM41425 C23 BCR A 407 -27.382 17.131 -15.288 1.00173.79 C
HETATM41426 C24 BCR A 407 -27.346 17.151 -16.623 1.00173.74 C
HETATM41427 C25 BCR A 407 -26.459 16.337 -17.447 1.00173.55 C
HETATM41428 C26 BCR A 407 -25.197 16.702 -17.677 1.00173.44 C
HETATM41429 C27 BCR A 407 -24.208 15.964 -18.495 1.00172.88 C
HETATM41430 C28 BCR A 407 -24.629 14.535 -18.726 1.00172.01 C
HETATM41431 C29 BCR A 407 -26.091 14.483 -19.084 1.00172.61 C
HETATM41432 C30 BCR A 407 -27.016 15.086 -18.036 1.00173.58 C
HETATM41433 C35 BCR A 407 -30.850 16.847 -3.871 1.00173.52 C
HETATM41434 C36 BCR A 407 -30.675 20.054 -10.332 1.00174.35 C
HETATM41435 C37 BCR A 407 -29.202 18.900 -15.178 1.00173.64 C
HETATM41436 C38 BCR A 407 -24.623 17.939 -17.112 1.00173.97 C
HETATM41437 C39 BCR A 407 -27.338 14.082 -16.943 1.00174.11 C
HETATM41438 C40 BCR A 407 -28.322 15.366 -18.769 1.00174.26 C
HETATM41439 C1A DGD A 408 -39.795 38.039 -12.347 1.00174.55 C
HETATM41440 C2A DGD A 408 -39.269 38.581 -11.065 1.00174.09 C
HETATM41441 C3A DGD A 408 -38.550 39.908 -11.282 1.00173.94 C
HETATM41442 C4A DGD A 408 -38.006 40.407 -9.949 1.00172.68 C
HETATM41443 C5A DGD A 408 -36.799 41.299 -10.184 1.00172.83 C
HETATM41444 C6A DGD A 408 -36.466 42.090 -8.938 1.00173.07 C
HETATM41445 C7A DGD A 408 -34.997 42.464 -9.071 1.00173.91 C
HETATM41446 C8A DGD A 408 -34.578 43.293 -7.878 1.00174.73 C
HETATM41447 C9A DGD A 408 -33.062 43.306 -7.831 1.00174.50 C
HETATM41448 CAA DGD A 408 -32.660 43.752 -6.448 1.00175.15 C
HETATM41449 CBA DGD A 408 -31.179 43.450 -6.260 1.00174.42 C
HETATM41450 CCA DGD A 408 -30.890 43.670 -4.796 1.00173.66 C
HETATM41451 CDA DGD A 408 -29.418 43.358 -4.575 1.00172.58 C
HETATM41452 O1A DGD A 408 -40.071 38.639 -13.371 1.00175.00 O
HETATM41453 C1B DGD A 408 -36.942 34.998 -12.900 1.00175.15 C
HETATM41454 C2B DGD A 408 -36.124 33.899 -12.278 1.00174.42 C
HETATM41455 C3B DGD A 408 -35.204 34.440 -11.190 1.00173.95 C
HETATM41456 C4B DGD A 408 -33.918 33.618 -11.077 1.00173.40 C
HETATM41457 C5B DGD A 408 -33.155 34.271 -9.936 1.00172.87 C
HETATM41458 C6B DGD A 408 -31.724 34.471 -10.425 1.00173.21 C
HETATM41459 C7B DGD A 408 -30.859 34.031 -9.266 1.00174.19 C
HETATM41460 C8B DGD A 408 -29.970 35.205 -8.976 1.00173.85 C
HETATM41461 C9B DGD A 408 -29.229 34.881 -7.718 1.00174.03 C
HETATM41462 CAB DGD A 408 -28.566 36.174 -7.362 1.00174.08 C
HETATM41463 CBB DGD A 408 -29.208 36.502 -6.068 1.00174.28 C
HETATM41464 CCB DGD A 408 -28.591 37.771 -5.581 1.00173.90 C
HETATM41465 CDB DGD A 408 -29.393 37.979 -4.337 1.00173.66 C
HETATM41466 O1B DGD A 408 -36.475 36.022 -13.366 1.00175.97 O
HETATM41467 O1G DGD A 408 -39.606 36.688 -12.353 1.00174.67 O
HETATM41468 C1G DGD A 408 -40.140 35.917 -13.397 1.00174.72 C
HETATM41469 C2G DGD A 408 -38.934 35.369 -14.194 1.00175.07 C
HETATM41470 O2G DGD A 408 -38.155 34.535 -13.351 1.00174.92 O
HETATM41471 C3G DGD A 408 -39.520 34.495 -15.331 1.00174.64 C
HETATM41472 O3G DGD A 408 -38.553 34.737 -16.343 1.00174.76 O
HETATM41473 C1D DGD A 408 -38.415 33.755 -17.345 1.00174.25 C
HETATM41474 C2D DGD A 408 -38.751 32.348 -16.757 1.00174.72 C
HETATM41475 O2D DGD A 408 -37.675 32.012 -15.935 1.00174.79 O
HETATM41476 C3D DGD A 408 -38.746 31.376 -17.966 1.00174.45 C
HETATM41477 O3D DGD A 408 -39.206 30.127 -17.544 1.00174.69 O
HETATM41478 C4D DGD A 408 -39.750 31.887 -19.039 1.00173.86 C
HETATM41479 O4D DGD A 408 -41.031 31.993 -18.509 1.00173.68 O
HETATM41480 C5D DGD A 408 -39.316 33.321 -19.434 1.00173.58 C
HETATM41481 O5D DGD A 408 -39.984 33.340 -21.670 1.00175.42 O
HETATM41482 C6D DGD A 408 -40.267 33.988 -20.450 1.00174.31 C
HETATM41483 O6D DGD A 408 -39.373 34.151 -18.304 1.00173.02 O
HETATM41484 C1E DGD A 408 -41.092 32.836 -22.367 1.00176.07 C
HETATM41485 C2E DGD A 408 -40.728 31.456 -23.022 1.00175.65 C
HETATM41486 O2E DGD A 408 -40.316 30.599 -22.002 1.00174.00 O
HETATM41487 C3E DGD A 408 -39.578 31.663 -24.028 1.00175.36 C
HETATM41488 O3E DGD A 408 -39.368 30.421 -24.642 1.00174.36 O
HETATM41489 C4E DGD A 408 -40.042 32.702 -25.084 1.00175.83 C
HETATM41490 O4E DGD A 408 -41.153 32.213 -25.769 1.00175.73 O
HETATM41491 C5E DGD A 408 -40.465 34.015 -24.358 1.00175.85 C
HETATM41492 O6E DGD A 408 -41.422 33.795 -23.343 1.00176.79 O
HETATM41493 C6E DGD A 408 -41.181 35.017 -25.306 1.00174.17 C
HETATM41494 O5E DGD A 408 -42.489 35.132 -24.819 1.00173.72 O
HETATM41495 O1 LHG A 409 -20.736 49.065 16.716 1.00173.21 O
HETATM41496 C1 LHG A 409 -20.254 49.846 17.808 1.00173.35 C
HETATM41497 C2 LHG A 409 -18.905 49.316 18.226 1.00173.60 C
HETATM41498 O2 LHG A 409 -17.987 49.377 17.152 1.00173.53 O
HETATM41499 C3 LHG A 409 -18.943 47.873 18.673 1.00173.93 C
HETATM41500 O3 LHG A 409 -17.847 47.361 17.939 1.00174.57 O
HETATM41501 P LHG A 409 -16.391 47.107 18.610 1.00176.10 P
HETATM41502 O4 LHG A 409 -15.719 48.430 18.752 1.00175.71 O
HETATM41503 O5 LHG A 409 -16.601 45.975 19.550 1.00175.06 O
HETATM41504 O6 LHG A 409 -15.712 46.518 17.208 1.00174.49 O
HETATM41505 C4 LHG A 409 -15.530 47.381 16.125 1.00174.68 C
HETATM41506 C5 LHG A 409 -14.666 46.579 15.155 1.00174.53 C
HETATM41507 C6 LHG A 409 -15.285 45.218 14.872 1.00173.45 C
HETATM41508 O7 LHG A 409 -14.654 47.309 13.945 1.00175.37 O
HETATM41509 C7 LHG A 409 -14.130 48.560 14.056 1.00174.61 C
HETATM41510 O9 LHG A 409 -13.113 48.807 14.685 1.00174.78 O
HETATM41511 C8 LHG A 409 -14.871 49.510 13.199 1.00173.95 C
HETATM41512 C9 LHG A 409 -13.953 50.626 12.782 1.00174.01 C
HETATM41513 C10 LHG A 409 -14.735 51.667 12.021 1.00174.61 C
HETATM41514 O8 LHG A 409 -14.370 44.576 13.966 1.00173.31 O
HETATM41515 C23 LHG A 409 -14.766 43.376 13.441 1.00173.28 C
HETATM41516 O10 LHG A 409 -15.798 42.865 13.831 1.00172.74 O
HETATM41517 C24 LHG A 409 -14.086 42.815 12.189 1.00174.37 C
HETATM41518 C11 LHG A 409 -13.635 52.562 11.513 1.00174.79 C
HETATM41519 C12 LHG A 409 -14.172 53.423 10.416 1.00174.29 C
HETATM41520 C25 LHG A 409 -15.001 42.149 11.168 1.00175.00 C
HETATM41521 C26 LHG A 409 -14.558 42.223 9.698 1.00174.98 C
HETATM41522 C27 LHG A 409 -14.962 43.618 9.268 1.00173.66 C
HETATM41523 C28 LHG A 409 -13.915 44.418 8.526 1.00172.14 C
HETATM41524 C29 LHG A 409 -14.424 45.853 8.533 1.00172.66 C
HETATM41525 C30 LHG A 409 -13.383 46.947 8.440 1.00173.00 C
HETATM41526 C31 LHG A 409 -13.903 48.364 8.573 1.00173.98 C
HETATM41527 C32 LHG A 409 -14.872 48.805 7.487 1.00173.91 C
HETATM41528 C33 LHG A 409 -14.077 49.538 6.428 1.00173.81 C
HETATM41529 C34 LHG A 409 -14.909 50.264 5.394 1.00173.86 C
HETATM41530 C35 LHG A 409 -14.029 51.063 4.457 1.00174.39 C
HETATM41531 C36 LHG A 409 -14.872 51.492 3.271 1.00173.86 C
HETATM41532 C37 LHG A 409 -14.122 52.581 2.568 1.00172.97 C
HETATM41533 C38 LHG A 409 -14.922 53.288 1.498 1.00173.39 C
HETATM41534 C1 LMG A 410 0.661 17.528 14.770 1.00174.77 C
HETATM41535 O1 LMG A 410 -0.367 18.090 13.984 1.00175.92 O
HETATM41536 C2 LMG A 410 0.733 18.412 16.038 1.00172.92 C
HETATM41537 O2 LMG A 410 1.194 19.652 15.593 1.00173.20 O
HETATM41538 C3 LMG A 410 1.839 17.788 16.894 1.00172.96 C
HETATM41539 O3 LMG A 410 1.899 18.585 18.040 1.00173.39 O
HETATM41540 C4 LMG A 410 1.419 16.342 17.260 1.00174.12 C
HETATM41541 O4 LMG A 410 0.224 16.389 17.969 1.00174.75 O
HETATM41542 C5 LMG A 410 1.161 15.581 15.923 1.00173.85 C
HETATM41543 O5 LMG A 410 -0.705 14.267 16.491 1.00174.06 O
HETATM41544 C6 LMG A 410 0.665 14.151 16.236 1.00173.38 C
HETATM41545 O6 LMG A 410 0.192 16.240 15.137 1.00174.86 O
HETATM41546 C7 LMG A 410 -0.895 17.237 12.988 1.00174.84 C
HETATM41547 C8 LMG A 410 0.087 17.267 11.776 1.00173.51 C
HETATM41548 C9 LMG A 410 -0.733 17.346 10.482 1.00173.27 C
HETATM41549 O7 LMG A 410 0.855 18.456 11.809 1.00173.30 O
HETATM41550 C10 LMG A 410 2.138 18.383 11.365 1.00173.31 C
HETATM41551 O9 LMG A 410 2.655 17.280 11.234 1.00172.51 O
HETATM41552 C11 LMG A 410 2.609 19.670 10.765 1.00173.87 C
HETATM41553 C12 LMG A 410 2.286 19.720 9.278 1.00174.56 C
HETATM41554 C13 LMG A 410 0.892 20.261 8.999 1.00174.34 C
HETATM41555 C14 LMG A 410 0.426 19.676 7.672 1.00173.73 C
HETATM41556 C15 LMG A 410 -1.087 19.727 7.631 1.00173.44 C
HETATM41557 C16 LMG A 410 -1.561 19.696 6.190 1.00172.50 C
HETATM41558 C17 LMG A 410 -2.493 20.874 6.012 1.00172.22 C
HETATM41559 C18 LMG A 410 -3.745 20.357 5.330 1.00172.28 C
HETATM41560 C19 LMG A 410 -3.472 20.319 3.849 1.00171.64 C
HETATM41561 C20 LMG A 410 -4.805 20.478 3.170 1.00172.71 C
HETATM41562 C21 LMG A 410 -4.524 20.755 1.721 1.00174.28 C
HETATM41563 C22 LMG A 410 -5.802 21.302 1.165 1.00174.44 C
HETATM41564 C23 LMG A 410 -5.418 22.308 0.119 1.00174.13 C
HETATM41565 C24 LMG A 410 -6.702 23.015 -0.214 1.00174.02 C
HETATM41566 C25 LMG A 410 -6.380 24.124 -1.178 1.00174.10 C
HETATM41567 O8 LMG A 410 -1.138 16.026 10.204 1.00173.92 O
HETATM41568 C28 LMG A 410 -0.155 15.138 9.902 1.00174.80 C
HETATM41569 O10 LMG A 410 0.112 14.236 10.684 1.00175.39 O
HETATM41570 C29 LMG A 410 0.376 15.260 8.513 1.00174.46 C
HETATM41571 C30 LMG A 410 1.009 13.953 8.067 1.00174.09 C
HETATM41572 C31 LMG A 410 1.845 14.241 6.840 1.00173.13 C
HETATM41573 C32 LMG A 410 1.795 13.010 5.950 1.00173.19 C
HETATM41574 C33 LMG A 410 3.087 12.254 6.163 1.00173.33 C
HETATM41575 C34 LMG A 410 3.785 12.138 4.827 1.00173.48 C
HETATM41576 C35 LMG A 410 5.137 11.491 5.092 1.00173.32 C
HETATM41577 C36 LMG A 410 5.051 10.098 4.549 1.00173.12 C
HETATM41578 C37 LMG A 410 5.966 10.023 3.351 1.00172.43 C
HETATM41579 C38 LMG A 410 6.349 8.576 3.324 1.00172.39 C
HETATM41580 C39 LMG A 410 7.416 8.369 2.288 1.00172.52 C
HETATM41581 C40 LMG A 410 7.880 6.972 2.594 1.00173.25 C
HETATM41582 C41 LMG A 410 8.364 6.332 1.327 1.00173.58 C
HETATM41583 C42 LMG A 410 9.702 6.987 1.104 1.00174.12 C
HETATM41584 C43 LMG A 410 10.365 6.328 -0.073 1.00173.95 C
HETATM41585 CL CL A 411 -9.196 32.635 -25.762 1.00172.47 C
HETATM41586 O1 OEX A 412 -14.006 40.851 -25.193 1.00169.89 O
HETATM41587 CA1 OEX A 412 -14.847 40.274 -23.476 1.00172.73 C
HETATM41588 MN1 OEX A 412 -12.719 39.806 -26.088 1.00165.79 M
HETATM41589 O2 OEX A 412 -16.170 39.392 -25.917 1.00170.98 O
HETATM41590 MN2 OEX A 412 -15.120 40.835 -26.726 1.00165.77 M
HETATM41591 O3 OEX A 412 -13.987 39.409 -27.411 1.00169.67 O
HETATM41592 MN3 OEX A 412 -14.797 38.138 -26.262 1.00168.19 M
HETATM41593 O4 OEX A 412 -15.552 36.889 -25.089 1.00171.13 O
HETATM41594 MN4 OEX A 412 -13.874 36.644 -24.275 1.00173.23 M
HETATM41595 O5 OEX A 412 -13.312 38.238 -25.156 1.00172.16 O
HETATM41596 O6 SQD A 413 -7.269 50.642 18.115 1.00174.69 O
HETATM41597 C44 SQD A 413 -7.897 49.507 17.546 1.00174.69 C
HETATM41598 C45 SQD A 413 -8.462 49.795 16.154 1.00174.95 C
HETATM41599 C46 SQD A 413 -9.765 50.589 16.260 1.00174.67 C
HETATM41600 O47 SQD A 413 -7.514 50.397 15.285 1.00174.91 O
HETATM41601 C7 SQD A 413 -6.585 49.569 14.603 1.00174.13 C
HETATM41602 O49 SQD A 413 -6.454 48.401 14.932 1.00173.57 O
HETATM41603 C8 SQD A 413 -5.962 50.040 13.290 1.00173.92 C
HETATM41604 C9 SQD A 413 -4.442 49.992 13.436 1.00174.18 C
HETATM41605 C10 SQD A 413 -3.811 49.645 12.094 1.00174.54 C
HETATM41606 C11 SQD A 413 -3.657 50.915 11.247 1.00175.07 C
HETATM41607 C12 SQD A 413 -3.610 50.555 9.769 1.00175.46 C
HETATM41608 C13 SQD A 413 -2.559 51.417 9.064 1.00174.72 C
HETATM41609 C14 SQD A 413 -2.620 51.196 7.554 1.00174.00 C
HETATM41610 C15 SQD A 413 -1.254 51.475 6.935 1.00173.35 C
HETATM41611 C16 SQD A 413 -1.215 50.911 5.522 1.00173.70 C
HETATM41612 C17 SQD A 413 -1.019 52.043 4.507 1.00174.67 C
HETATM41613 C18 SQD A 413 -1.774 51.709 3.214 1.00175.26 C
HETATM41614 C19 SQD A 413 -1.124 52.425 2.033 1.00175.29 C
HETATM41615 C20 SQD A 413 -2.197 52.985 1.125 1.00175.02 C
HETATM41616 C21 SQD A 413 -1.559 53.649 -0.086 1.00174.77 C
HETATM41617 C22 SQD A 413 -2.484 54.710 -0.629 1.00174.23 C
HETATM41618 O48 SQD A 413 -9.554 51.923 15.842 1.00174.58 O
HETATM41619 C23 SQD A 413 -10.115 52.355 14.612 1.00174.31 C
HETATM41620 O10 SQD A 413 -10.847 51.608 13.985 1.00173.75 O
HETATM41621 C24 SQD A 413 -9.633 53.664 13.996 1.00174.29 C
HETATM41622 C25 SQD A 413 -10.225 53.866 12.604 1.00174.15 C
HETATM41623 C26 SQD A 413 -9.380 54.922 11.875 1.00174.12 C
HETATM41624 C27 SQD A 413 -10.184 55.548 10.728 1.00175.27 C
HETATM41625 C28 SQD A 413 -9.360 56.675 10.088 1.00174.58 C
HETATM41626 C29 SQD A 413 -10.206 57.373 9.014 1.00174.09 C
HETATM41627 C30 SQD A 413 -9.474 57.313 7.671 1.00173.90 C
HETATM41628 C31 SQD A 413 -10.379 57.872 6.564 1.00175.19 C
HETATM41629 C32 SQD A 413 -10.381 59.405 6.610 1.00176.21 C
HETATM41630 C33 SQD A 413 -9.038 59.941 6.110 1.00175.53 C
HETATM41631 C34 SQD A 413 -9.263 61.229 5.314 1.00173.61 C
HETATM41632 C35 SQD A 413 -9.492 62.389 6.256 1.00173.48 C
HETATM41633 C1 SQD A 413 -7.178 50.676 19.527 1.00174.50 C
HETATM41634 C2 SQD A 413 -5.786 50.716 20.098 1.00174.25 C
HETATM41635 O2 SQD A 413 -4.962 49.790 19.503 1.00173.90 O
HETATM41636 C3 SQD A 413 -5.903 50.407 21.562 1.00173.85 C
HETATM41637 O3 SQD A 413 -4.681 50.623 22.159 1.00172.99 O
HETATM41638 C4 SQD A 413 -6.953 51.212 22.290 1.00174.29 C
HETATM41639 O4 SQD A 413 -7.381 50.495 23.387 1.00174.39 O
HETATM41640 C5 SQD A 413 -8.161 51.602 21.474 1.00174.53 C
HETATM41641 C6 SQD A 413 -8.698 52.928 21.966 1.00175.04 C
HETATM41642 O5 SQD A 413 -7.968 51.688 20.082 1.00174.35 O
HETATM41643 S SQD A 413 -10.328 53.239 21.297 1.00176.70 S
HETATM41644 O7 SQD A 413 -10.462 54.607 20.859 1.00174.56 O
HETATM41645 O8 SQD A 413 -11.350 52.914 22.310 1.00175.58 O
HETATM41646 O9 SQD A 413 -10.587 52.529 20.065 1.00173.97 O
HETATM41647 O6 SQD A 414 -29.976 15.629 12.325 1.00175.69 O
HETATM41648 C44 SQD A 414 -28.668 15.152 12.552 1.00174.38 C
HETATM41649 C45 SQD A 414 -27.827 15.480 11.326 1.00174.56 C
HETATM41650 C46 SQD A 414 -27.579 14.216 10.511 1.00174.00 C
HETATM41651 O47 SQD A 414 -28.450 16.482 10.543 1.00175.71 O
HETATM41652 C7 SQD A 414 -28.248 17.862 10.815 1.00175.10 C
HETATM41653 O49 SQD A 414 -27.470 18.206 11.692 1.00175.07 O
HETATM41654 C8 SQD A 414 -29.258 18.880 10.279 1.00174.23 C
HETATM41655 C9 SQD A 414 -28.654 19.631 9.092 1.00173.68 C
HETATM41656 C10 SQD A 414 -28.425 18.665 7.937 1.00173.78 C
HETATM41657 C11 SQD A 414 -27.729 19.406 6.790 1.00174.35 C
HETATM41658 C12 SQD A 414 -28.250 18.916 5.449 1.00174.22 C
HETATM41659 C13 SQD A 414 -27.081 18.799 4.470 1.00173.67 C
HETATM41660 C14 SQD A 414 -26.389 20.151 4.321 1.00173.12 C
HETATM41661 C15 SQD A 414 -25.747 20.230 2.942 1.00172.65 C
HETATM41662 C16 SQD A 414 -25.281 21.652 2.677 1.00173.79 C
HETATM41663 C17 SQD A 414 -24.903 21.781 1.200 1.00175.70 C
HETATM41664 C18 SQD A 414 -23.781 20.784 0.886 1.00175.05 C
HETATM41665 C19 SQD A 414 -23.312 20.976 -0.551 1.00174.89 C
HETATM41666 C20 SQD A 414 -22.662 19.701 -1.039 1.00174.06 C
HETATM41667 C21 SQD A 414 -21.551 19.294 -0.085 1.00172.92 C
HETATM41668 C22 SQD A 414 -20.907 18.027 -0.585 1.00172.95 C
HETATM41669 O48 SQD A 414 -26.777 14.547 9.392 1.00175.64 O
HETATM41670 C23 SQD A 414 -27.331 14.520 8.084 1.00176.84 C
HETATM41671 O10 SQD A 414 -27.101 15.434 7.310 1.00177.05 O
HETATM41672 C24 SQD A 414 -28.428 13.509 7.762 1.00176.07 C
HETATM41673 C25 SQD A 414 -28.745 13.525 6.268 1.00175.21 C
HETATM41674 C26 SQD A 414 -30.128 12.897 6.043 1.00173.23 C
HETATM41675 C27 SQD A 414 -30.339 12.651 4.543 1.00172.50 C
HETATM41676 C28 SQD A 414 -31.842 12.597 4.240 1.00171.97 C
HETATM41677 C29 SQD A 414 -32.411 14.024 4.242 1.00173.40 C
HETATM41678 C30 SQD A 414 -33.833 14.013 3.673 1.00173.82 C
HETATM41679 C31 SQD A 414 -34.247 15.447 3.308 1.00174.27 C
HETATM41680 C32 SQD A 414 -35.710 15.476 2.849 1.00173.87 C
HETATM41681 C33 SQD A 414 -35.855 14.773 1.500 1.00173.99 C
HETATM41682 C34 SQD A 414 -35.257 15.636 0.386 1.00174.68 C
HETATM41683 C35 SQD A 414 -36.293 16.614 -0.124 1.00175.13 C
HETATM41684 C36 SQD A 414 -35.920 17.062 -1.515 1.00174.23 C
HETATM41685 C37 SQD A 414 -36.877 18.128 -1.981 1.00173.52 C
HETATM41686 C38 SQD A 414 -36.665 18.383 -3.452 1.00172.97 C
HETATM41687 C1 SQD A 414 -30.981 15.427 13.297 1.00175.48 C
HETATM41688 C2 SQD A 414 -32.224 16.204 12.954 1.00176.00 C
HETATM41689 O2 SQD A 414 -31.977 17.558 13.001 1.00176.18 O
HETATM41690 C3 SQD A 414 -33.351 15.901 13.895 1.00175.65 C
HETATM41691 O3 SQD A 414 -34.499 16.425 13.346 1.00175.13 O
HETATM41692 C4 SQD A 414 -33.579 14.439 14.121 1.00175.15 C
HETATM41693 O4 SQD A 414 -34.323 14.266 15.267 1.00175.32 O
HETATM41694 C5 SQD A 414 -32.312 13.651 14.245 1.00174.86 C
HETATM41695 C6 SQD A 414 -32.639 12.211 13.936 1.00175.51 C
HETATM41696 O5 SQD A 414 -31.228 14.055 13.441 1.00174.87 O
HETATM41697 S SQD A 414 -31.158 11.228 14.056 1.00179.19 S
HETATM41698 O7 SQD A 414 -30.305 11.383 12.901 1.00176.21 O
HETATM41699 O8 SQD A 414 -31.519 9.811 14.264 1.00177.21 O
HETATM41700 O9 SQD A 414 -30.297 11.712 15.111 1.00176.74 O
HETATM41701 C1 LMG A 415 -16.822 10.702 -26.725 1.00176.21 C
HETATM41702 O1 LMG A 415 -17.257 9.393 -26.433 1.00177.70 O
HETATM41703 C2 LMG A 415 -15.268 10.631 -26.787 1.00176.26 C
HETATM41704 O2 LMG A 415 -14.853 10.412 -25.467 1.00175.69 O
HETATM41705 C3 LMG A 415 -14.789 12.045 -27.207 1.00175.77 C
HETATM41706 O3 LMG A 415 -13.399 11.942 -27.348 1.00175.70 O
HETATM41707 C4 LMG A 415 -15.432 12.436 -28.570 1.00175.69 C
HETATM41708 O4 LMG A 415 -14.955 11.579 -29.560 1.00176.07 O
HETATM41709 C5 LMG A 415 -16.981 12.255 -28.443 1.00175.26 C
HETATM41710 O5 LMG A 415 -17.467 13.861 -30.095 1.00174.67 O
HETATM41711 C6 LMG A 415 -17.633 12.502 -29.821 1.00175.04 C
HETATM41712 O6 LMG A 415 -17.319 10.954 -28.027 1.00175.75 O
HETATM41713 C7 LMG A 415 -18.578 9.104 -26.854 1.00176.29 C
HETATM41714 C8 LMG A 415 -19.448 9.148 -25.565 1.00176.13 C
HETATM41715 C9 LMG A 415 -20.825 8.565 -25.897 1.00174.77 C
HETATM41716 O7 LMG A 415 -18.888 8.263 -24.616 1.00176.33 O
HETATM41717 C10 LMG A 415 -18.526 8.766 -23.403 1.00175.88 C
HETATM41718 O9 LMG A 415 -17.489 9.411 -23.321 1.00176.39 O
HETATM41719 C11 LMG A 415 -19.259 8.110 -22.274 1.00174.22 C
HETATM41720 C12 LMG A 415 -20.443 8.943 -21.819 1.00173.40 C
HETATM41721 C13 LMG A 415 -21.287 8.223 -20.779 1.00171.84 C
HETATM41722 C14 LMG A 415 -21.673 9.258 -19.739 1.00171.69 C
HETATM41723 C15 LMG A 415 -22.998 8.875 -19.125 1.00171.93 C
HETATM41724 C16 LMG A 415 -23.631 10.117 -18.523 1.00173.02 C
HETATM41725 C17 LMG A 415 -24.706 9.658 -17.570 1.00172.85 C
HETATM41726 C18 LMG A 415 -24.182 9.905 -16.172 1.00172.50 C
HETATM41727 C19 LMG A 415 -25.373 10.155 -15.282 1.00172.60 C
HETATM41728 C20 LMG A 415 -25.159 9.299 -14.062 1.00173.79 C
HETATM41729 C21 LMG A 415 -25.067 10.223 -12.878 1.00174.00 C
HETATM41730 C22 LMG A 415 -24.792 9.327 -11.706 1.00174.45 C
HETATM41731 O8 LMG A 415 -21.645 8.872 -24.788 1.00174.94 O
HETATM41732 C28 LMG A 415 -22.895 8.347 -24.801 1.00174.64 C
HETATM41733 O10 LMG A 415 -23.195 7.521 -25.653 1.00174.51 O
HETATM41734 C29 LMG A 415 -23.699 8.670 -23.585 1.00174.39 C
HETATM41735 C30 LMG A 415 -23.707 10.164 -23.332 1.00174.12 C
HETATM41736 C31 LMG A 415 -25.108 10.556 -22.914 1.00174.13 C
HETATM41737 C32 LMG A 415 -25.177 12.075 -22.956 1.00173.38 C
HETATM41738 C33 LMG A 415 -26.174 12.444 -24.037 1.00173.32 C
HETATM41739 C34 LMG A 415 -27.153 13.446 -23.467 1.00173.34 C
HETATM41740 C35 LMG A 415 -28.536 12.830 -23.624 1.00173.25 C
HETATM41741 C36 LMG A 415 -29.515 13.876 -23.190 1.00172.79 C
HETATM41742 C37 LMG A 415 -30.894 13.263 -23.239 1.00172.61 C
TER 41743 LMG A 415
ATOM 2630 N GLY B 2 2.565 10.069 22.783 1.00174.69 N
ATOM 2631 CA GLY B 2 4.012 10.112 22.888 1.00174.83 C
ATOM 2632 C GLY B 2 4.650 11.000 21.838 1.00174.53 C
ATOM 2633 O GLY B 2 4.299 12.173 21.707 1.00173.84 O
ATOM 2634 N LEU B 3 5.596 10.437 21.093 1.00174.53 N
ATOM 2635 CA LEU B 3 6.301 11.178 20.052 1.00174.86 C
ATOM 2636 C LEU B 3 5.453 11.374 18.799 1.00175.69 C
ATOM 2637 O LEU B 3 4.785 10.444 18.340 1.00174.71 O
ATOM 2638 CB LEU B 3 7.604 10.466 19.678 1.00173.82 C
ATOM 2639 CG LEU B 3 8.782 10.614 20.641 1.00173.56 C
ATOM 2640 CD1 LEU B 3 9.917 9.685 20.235 1.00174.29 C
ATOM 2641 CD2 LEU B 3 9.258 12.058 20.697 1.00172.98 C
ATOM 2642 N PRO B 4 5.480 12.594 18.238 1.00176.46 N
ATOM 2643 CA PRO B 4 4.871 12.881 16.936 1.00174.63 C
ATOM 2644 C PRO B 4 5.598 12.141 15.821 1.00174.62 C
ATOM 2645 O PRO B 4 6.757 11.767 15.997 1.00175.34 O
ATOM 2646 CB PRO B 4 5.044 14.396 16.793 1.00173.81 C
ATOM 2647 CG PRO B 4 5.191 14.894 18.193 1.00174.55 C
ATOM 2648 CD PRO B 4 5.966 13.819 18.892 1.00175.78 C
ATOM 2649 N TRP B 5 4.928 11.936 14.691 1.00174.36 N
ATOM 2650 CA TRP B 5 5.498 11.173 13.583 1.00174.77 C
ATOM 2651 C TRP B 5 6.797 11.789 13.058 1.00174.50 C
ATOM 2652 O TRP B 5 7.718 11.073 12.670 1.00175.43 O
ATOM 2653 CB TRP B 5 4.478 11.042 12.450 1.00174.65 C
ATOM 2654 CG TRP B 5 4.098 12.342 11.816 1.00174.69 C
ATOM 2655 CD1 TRP B 5 3.064 13.158 12.172 1.00174.96 C
ATOM 2656 CD2 TRP B 5 4.739 12.972 10.700 1.00173.91 C
ATOM 2657 NE1 TRP B 5 3.028 14.261 11.354 1.00174.09 N
ATOM 2658 CE2 TRP B 5 4.045 14.171 10.443 1.00173.83 C
ATOM 2659 CE3 TRP B 5 5.836 12.641 9.899 1.00173.31 C
ATOM 2660 CZ2 TRP B 5 4.411 15.038 9.417 1.00174.02 C
ATOM 2661 CZ3 TRP B 5 6.197 13.505 8.881 1.00173.90 C
ATOM 2662 CH2 TRP B 5 5.487 14.688 8.649 1.00174.58 C
ATOM 2663 N TYR B 6 6.863 13.117 13.046 1.00173.90 N
ATOM 2664 CA TYR B 6 8.043 13.827 12.560 1.00173.97 C
ATOM 2665 C TYR B 6 9.163 13.903 13.597 1.00173.84 C
ATOM 2666 O TYR B 6 10.117 14.662 13.431 1.00174.12 O
ATOM 2667 CB TYR B 6 7.662 15.242 12.118 1.00174.37 C
ATOM 2668 CG TYR B 6 6.942 16.037 13.184 1.00174.69 C
ATOM 2669 CD1 TYR B 6 5.555 16.043 13.254 1.00174.94 C
ATOM 2670 CD2 TYR B 6 7.648 16.780 14.122 1.00174.52 C
ATOM 2671 CE1 TYR B 6 4.893 16.765 14.227 1.00175.05 C
ATOM 2672 CE2 TYR B 6 6.995 17.503 15.099 1.00174.56 C
ATOM 2673 CZ TYR B 6 5.617 17.492 15.147 1.00174.70 C
ATOM 2674 OH TYR B 6 4.964 18.213 16.119 1.00173.88 O
ATOM 2675 N ARG B 7 9.045 13.120 14.665 1.00173.47 N
ATOM 2676 CA ARG B 7 10.030 13.141 15.741 1.00173.54 C
ATOM 2677 C ARG B 7 10.559 11.754 16.085 1.00173.50 C
ATOM 2678 O ARG B 7 11.390 11.610 16.981 1.00173.42 O
ATOM 2679 CB ARG B 7 9.440 13.779 16.998 1.00173.69 C
ATOM 2680 CG ARG B 7 9.291 15.289 16.937 1.00173.59 C
ATOM 2681 CD ARG B 7 8.918 15.833 18.306 1.00174.25 C
ATOM 2682 NE ARG B 7 8.756 17.283 18.319 1.00174.28 N
ATOM 2683 CZ ARG B 7 8.329 17.973 19.373 1.00174.43 C
ATOM 2684 NH1 ARG B 7 8.017 17.343 20.497 1.00174.71 N
ATOM 2685 NH2 ARG B 7 8.211 19.291 19.304 1.00174.48 N
ATOM 2686 N VAL B 8 10.062 10.741 15.383 1.00173.60 N
ATOM 2687 CA VAL B 8 10.408 9.348 15.661 1.00173.81 C
ATOM 2688 C VAL B 8 11.918 9.079 15.707 1.00174.38 C
ATOM 2689 O VAL B 8 12.361 8.161 16.399 1.00174.72 O
ATOM 2690 CB VAL B 8 9.763 8.395 14.627 1.00173.98 C
ATOM 2691 CG1 VAL B 8 8.250 8.392 14.782 1.00174.07 C
ATOM 2692 CG2 VAL B 8 10.165 8.777 13.209 1.00174.06 C
ATOM 2693 N HIS B 9 12.705 9.864 14.977 1.00174.30 N
ATOM 2694 CA HIS B 9 14.144 9.620 14.900 1.00174.68 C
ATOM 2695 C HIS B 9 14.929 10.353 15.981 1.00174.61 C
ATOM 2696 O HIS B 9 16.147 10.212 16.072 1.00174.57 O
ATOM 2697 CB HIS B 9 14.684 10.022 13.534 1.00174.45 C
ATOM 2698 CG HIS B 9 14.206 9.153 12.417 1.00173.36 C
ATOM 2699 ND1 HIS B 9 14.474 9.427 11.094 1.00173.24 N
ATOM 2700 CD2 HIS B 9 13.464 8.021 12.424 1.00172.74 C
ATOM 2701 CE1 HIS B 9 13.925 8.497 10.334 1.00172.99 C
ATOM 2702 NE2 HIS B 9 13.305 7.634 11.117 1.00172.14 N
ATOM 2703 N THR B 10 14.230 11.120 16.810 1.00174.35 N
ATOM 2704 CA THR B 10 14.860 11.781 17.944 1.00173.91 C
ATOM 2705 C THR B 10 15.256 10.748 18.996 1.00173.94 C
ATOM 2706 O THR B 10 15.903 11.070 19.991 1.00173.73 O
ATOM 2707 CB THR B 10 13.931 12.838 18.564 1.00173.40 C
ATOM 2708 OG1 THR B 10 12.669 12.239 18.884 1.00173.59 O
ATOM 2709 CG2 THR B 10 13.706 13.983 17.586 1.00172.80 C
ATOM 2710 N VAL B 11 14.859 9.501 18.761 1.00174.07 N
ATOM 2711 CA VAL B 11 15.232 8.368 19.602 1.00174.54 C
ATOM 2712 C VAL B 11 16.744 8.075 19.561 1.00175.05 C
ATOM 2713 O VAL B 11 17.229 7.178 20.250 1.00175.00 O
ATOM 2714 CB VAL B 11 14.437 7.104 19.174 1.00174.21 C
ATOM 2715 CG1 VAL B 11 15.066 6.461 17.943 1.00174.43 C
ATOM 2716 CG2 VAL B 11 14.322 6.106 20.319 1.00174.43 C
ATOM 2717 N LEU B 12 17.486 8.847 18.772 1.00174.64 N
ATOM 2718 CA LEU B 12 18.909 8.591 18.563 1.00174.18 C
ATOM 2719 C LEU B 12 19.813 9.724 19.038 1.00174.14 C
ATOM 2720 O LEU B 12 21.034 9.571 19.058 1.00174.24 O
ATOM 2721 CB LEU B 12 19.185 8.326 17.082 1.00173.30 C
ATOM 2722 CG LEU B 12 18.454 7.152 16.434 1.00173.56 C
ATOM 2723 CD1 LEU B 12 18.966 6.934 15.022 1.00173.99 C
ATOM 2724 CD2 LEU B 12 18.612 5.893 17.267 1.00173.53 C
ATOM 2725 N ILE B 13 19.211 10.857 19.394 1.00174.00 N
ATOM 2726 CA ILE B 13 19.949 12.066 19.767 1.00174.13 C
ATOM 2727 C ILE B 13 21.088 11.810 20.762 1.00174.86 C
ATOM 2728 O ILE B 13 22.131 12.466 20.710 1.00175.07 O
ATOM 2729 CB ILE B 13 18.991 13.130 20.356 1.00173.88 C
ATOM 2730 CG1 ILE B 13 17.885 13.458 19.351 1.00173.25 C
ATOM 2731 CG2 ILE B 13 19.746 14.395 20.742 1.00174.30 C
ATOM 2732 CD1 ILE B 13 17.055 14.670 19.726 1.00174.24 C
ATOM 2733 N ASN B 14 20.906 10.830 21.642 1.00174.56 N
ATOM 2734 CA ASN B 14 21.966 10.443 22.568 1.00173.62 C
ATOM 2735 C ASN B 14 22.040 8.930 22.722 1.00173.70 C
ATOM 2736 O ASN B 14 21.914 8.391 23.820 1.00173.93 O
ATOM 2737 CB ASN B 14 21.769 11.111 23.935 1.00173.38 C
ATOM 2738 CG ASN B 14 20.333 11.039 24.430 1.00173.27 C
ATOM 2739 OD1 ASN B 14 19.613 10.078 24.160 1.00173.05 O
ATOM 2740 ND2 ASN B 14 19.916 12.058 25.174 1.00172.53 N
ATOM 2741 N ASP B 15 22.242 8.255 21.597 1.00173.90 N
ATOM 2742 CA ASP B 15 22.417 6.810 21.567 1.00174.36 C
ATOM 2743 C ASP B 15 23.404 6.459 20.457 1.00174.48 C
ATOM 2744 O ASP B 15 23.007 5.921 19.425 1.00174.85 O
ATOM 2745 CB ASP B 15 21.077 6.102 21.353 1.00174.01 C
ATOM 2746 CG ASP B 15 21.133 4.624 21.694 1.00173.87 C
ATOM 2747 OD1 ASP B 15 22.232 4.034 21.637 1.00173.45 O
ATOM 2748 OD2 ASP B 15 20.074 4.049 22.013 1.00173.81 O
ATOM 2749 N PRO B 16 24.692 6.784 20.665 1.00174.13 N
ATOM 2750 CA PRO B 16 25.776 6.656 19.682 1.00173.98 C
ATOM 2751 C PRO B 16 25.784 5.330 18.923 1.00174.60 C
ATOM 2752 O PRO B 16 26.109 5.304 17.737 1.00174.95 O
ATOM 2753 CB PRO B 16 27.031 6.787 20.548 1.00173.51 C
ATOM 2754 CG PRO B 16 26.600 7.663 21.667 1.00173.52 C
ATOM 2755 CD PRO B 16 25.213 7.191 21.983 1.00173.97 C
ATOM 2756 N GLY B 17 25.428 4.248 19.609 1.00174.75 N
ATOM 2757 CA GLY B 17 25.356 2.936 18.993 1.00174.86 C
ATOM 2758 C GLY B 17 24.312 2.852 17.896 1.00174.92 C
ATOM 2759 O GLY B 17 24.623 2.533 16.748 1.00174.64 O
ATOM 2760 N ARG B 18 23.064 3.135 18.259 1.00175.15 N
ATOM 2761 CA ARG B 18 21.947 3.050 17.326 1.00174.92 C
ATOM 2762 C ARG B 18 21.985 4.173 16.291 1.00174.55 C
ATOM 2763 O ARG B 18 21.336 4.091 15.249 1.00173.98 O
ATOM 2764 CB ARG B 18 20.623 3.091 18.089 1.00174.55 C
ATOM 2765 CG ARG B 18 20.588 2.201 19.316 1.00174.05 C
ATOM 2766 CD ARG B 18 20.061 0.812 19.002 1.00173.74 C
ATOM 2767 NE ARG B 18 18.697 0.633 19.493 1.00173.63 N
ATOM 2768 CZ ARG B 18 18.137 -0.549 19.725 1.00174.19 C
ATOM 2769 NH1 ARG B 18 18.823 -1.664 19.516 1.00174.65 N
ATOM 2770 NH2 ARG B 18 16.890 -0.618 20.172 1.00174.14 N
ATOM 2771 N LEU B 19 22.748 5.221 16.586 1.00174.13 N
ATOM 2772 CA LEU B 19 22.921 6.325 15.654 1.00172.94 C
ATOM 2773 C LEU B 19 23.880 5.925 14.542 1.00172.99 C
ATOM 2774 O LEU B 19 23.688 6.286 13.382 1.00173.29 O
ATOM 2775 CB LEU B 19 23.444 7.563 16.378 1.00173.11 C
ATOM 2776 CG LEU B 19 23.588 8.812 15.511 1.00173.33 C
ATOM 2777 CD1 LEU B 19 22.231 9.477 15.338 1.00173.59 C
ATOM 2778 CD2 LEU B 19 24.605 9.772 16.094 1.00173.92 C
ATOM 2779 N ILE B 20 24.914 5.173 14.910 1.00173.40 N
ATOM 2780 CA ILE B 20 25.867 4.646 13.942 1.00173.90 C
ATOM 2781 C ILE B 20 25.178 3.580 13.097 1.00174.13 C
ATOM 2782 O ILE B 20 25.364 3.517 11.880 1.00173.63 O
ATOM 2783 CB ILE B 20 27.113 4.052 14.636 1.00174.21 C
ATOM 2784 CG1 ILE B 20 28.026 5.167 15.146 1.00174.26 C
ATOM 2785 CG2 ILE B 20 27.882 3.145 13.690 1.00174.15 C
ATOM 2786 CD1 ILE B 20 29.066 4.692 16.144 1.00174.15 C
ATOM 2787 N ALA B 21 24.365 2.759 13.755 1.00174.67 N
ATOM 2788 CA ALA B 21 23.594 1.721 13.082 1.00174.00 C
ATOM 2789 C ALA B 21 22.663 2.334 12.043 1.00173.52 C
ATOM 2790 O ALA B 21 22.486 1.790 10.956 1.00173.71 O
ATOM 2791 CB ALA B 21 22.797 0.903 14.098 1.00173.70 C
ATOM 2792 N ALA B 22 22.065 3.468 12.389 1.00173.51 N
ATOM 2793 CA ALA B 22 21.193 4.187 11.469 1.00174.07 C
ATOM 2794 C ALA B 22 21.971 4.716 10.259 1.00173.70 C
ATOM 2795 O ALA B 22 21.605 4.450 9.113 1.00173.07 O
ATOM 2796 CB ALA B 22 20.492 5.323 12.190 1.00174.28 C
ATOM 2797 N HIS B 23 23.031 5.476 10.522 1.00173.92 N
ATOM 2798 CA HIS B 23 23.890 6.020 9.475 1.00173.70 C
ATOM 2799 C HIS B 23 24.474 4.912 8.608 1.00173.63 C
ATOM 2800 O HIS B 23 24.761 5.108 7.427 1.00174.23 O
ATOM 2801 CB HIS B 23 25.032 6.830 10.082 1.00174.43 C
ATOM 2802 CG HIS B 23 24.596 7.987 10.919 1.00174.93 C
ATOM 2803 ND1 HIS B 23 23.355 8.051 11.532 1.00174.91 N
ATOM 2804 CD2 HIS B 23 25.218 9.146 11.238 1.00175.11 C
ATOM 2805 CE1 HIS B 23 23.239 9.190 12.172 1.00174.61 C
ATOM 2806 NE2 HIS B 23 24.365 9.877 12.023 1.00175.26 N
ATOM 2807 N LEU B 24 24.656 3.745 9.213 1.00173.08 N
ATOM 2808 CA LEU B 24 25.168 2.589 8.502 1.00173.16 C
ATOM 2809 C LEU B 24 24.131 2.104 7.504 1.00173.64 C
ATOM 2810 O LEU B 24 24.453 1.816 6.354 1.00173.89 O
ATOM 2811 CB LEU B 24 25.537 1.477 9.478 1.00173.18 C
ATOM 2812 CG LEU B 24 27.011 1.401 9.860 1.00173.27 C
ATOM 2813 CD1 LEU B 24 27.241 0.284 10.866 1.00173.88 C
ATOM 2814 CD2 LEU B 24 27.877 1.202 8.627 1.00173.30 C
ATOM 2815 N MET B 25 22.879 2.042 7.947 1.00173.88 N
ATOM 2816 CA MET B 25 21.779 1.628 7.088 1.00173.76 C
ATOM 2817 C MET B 25 21.582 2.600 5.928 1.00173.59 C
ATOM 2818 O MET B 25 21.374 2.182 4.790 1.00173.73 O
ATOM 2819 CB MET B 25 20.492 1.509 7.898 1.00173.34 C
ATOM 2820 CG MET B 25 19.343 0.918 7.113 1.00172.73 C
ATOM 2821 SD MET B 25 19.756 -0.701 6.436 1.00171.14 S
ATOM 2822 CE MET B 25 19.494 -1.739 7.870 1.00173.74 C
ATOM 2823 N HIS B 26 21.651 3.894 6.225 1.00173.23 N
ATOM 2824 CA HIS B 26 21.549 4.925 5.197 1.00173.57 C
ATOM 2825 C HIS B 26 22.625 4.750 4.131 1.00173.42 C
ATOM 2826 O HIS B 26 22.327 4.685 2.937 1.00173.60 O
ATOM 2827 CB HIS B 26 21.657 6.319 5.811 1.00174.41 C
ATOM 2828 CG HIS B 26 21.720 7.417 4.794 1.00175.29 C
ATOM 2829 ND1 HIS B 26 22.905 7.858 4.247 1.00174.87 N
ATOM 2830 CD2 HIS B 26 20.743 8.155 4.216 1.00174.86 C
ATOM 2831 CE1 HIS B 26 22.657 8.821 3.379 1.00174.59 C
ATOM 2832 NE2 HIS B 26 21.352 9.022 3.342 1.00174.38 N
ATOM 2833 N THR B 27 23.875 4.686 4.578 1.00173.21 N
ATOM 2834 CA THR B 27 25.017 4.484 3.693 1.00173.33 C
ATOM 2835 C THR B 27 24.834 3.231 2.838 1.00173.69 C
ATOM 2836 O THR B 27 25.186 3.218 1.656 1.00174.35 O
ATOM 2837 CB THR B 27 26.327 4.380 4.498 1.00173.27 C
ATOM 2838 OG1 THR B 27 26.477 5.544 5.320 1.00173.29 O
ATOM 2839 CG2 THR B 27 27.523 4.271 3.572 1.00173.49 C
ATOM 2840 N ALA B 28 24.279 2.185 3.441 1.00173.32 N
ATOM 2841 CA ALA B 28 23.980 0.946 2.729 1.00173.27 C
ATOM 2842 C ALA B 28 22.980 1.179 1.600 1.00173.39 C
ATOM 2843 O ALA B 28 23.143 0.656 0.498 1.00174.09 O
ATOM 2844 CB ALA B 28 23.454 -0.105 3.694 1.00173.89 C
ATOM 2845 N LEU B 29 21.940 1.959 1.882 1.00173.04 N
ATOM 2846 CA LEU B 29 20.919 2.268 0.884 1.00173.43 C
ATOM 2847 C LEU B 29 21.479 3.089 -0.273 1.00173.48 C
ATOM 2848 O LEU B 29 21.159 2.841 -1.436 1.00173.19 O
ATOM 2849 CB LEU B 29 19.752 3.019 1.525 1.00173.25 C
ATOM 2850 CG LEU B 29 18.906 2.246 2.535 1.00172.98 C
ATOM 2851 CD1 LEU B 29 17.957 3.183 3.260 1.00173.44 C
ATOM 2852 CD2 LEU B 29 18.141 1.133 1.841 1.00172.82 C
ATOM 2853 N VAL B 30 22.314 4.069 0.055 1.00173.43 N
ATOM 2854 CA VAL B 30 22.905 4.942 -0.951 1.00172.97 C
ATOM 2855 C VAL B 30 23.897 4.169 -1.812 1.00172.83 C
ATOM 2856 O VAL B 30 23.959 4.359 -3.027 1.00173.80 O
ATOM 2857 CB VAL B 30 23.606 6.150 -0.301 1.00173.67 C
ATOM 2858 CG1 VAL B 30 24.242 7.035 -1.356 1.00174.05 C
ATOM 2859 CG2 VAL B 30 22.613 6.945 0.526 1.00174.29 C
ATOM 2860 N ALA B 31 24.657 3.281 -1.180 1.00172.64 N
ATOM 2861 CA ALA B 31 25.577 2.416 -1.906 1.00172.86 C
ATOM 2862 C ALA B 31 24.787 1.380 -2.695 1.00173.53 C
ATOM 2863 O ALA B 31 25.164 1.011 -3.806 1.00174.05 O
ATOM 2864 CB ALA B 31 26.545 1.741 -0.950 1.00173.53 C
ATOM 2865 N GLY B 32 23.694 0.910 -2.100 1.00173.76 N
ATOM 2866 CA GLY B 32 22.797 -0.027 -2.749 1.00173.51 C
ATOM 2867 C GLY B 32 22.178 0.552 -4.006 1.00173.63 C
ATOM 2868 O GLY B 32 22.119 -0.112 -5.040 1.00173.95 O
ATOM 2869 N TRP B 33 21.704 1.791 -3.909 1.00173.72 N
ATOM 2870 CA TRP B 33 21.146 2.492 -5.062 1.00174.06 C
ATOM 2871 C TRP B 33 22.156 2.632 -6.197 1.00173.52 C
ATOM 2872 O TRP B 33 21.857 2.295 -7.341 1.00172.86 O
ATOM 2873 CB TRP B 33 20.637 3.880 -4.656 1.00174.06 C
ATOM 2874 CG TRP B 33 20.219 4.719 -5.829 1.00173.36 C
ATOM 2875 CD1 TRP B 33 19.001 4.719 -6.440 1.00173.46 C
ATOM 2876 CD2 TRP B 33 21.020 5.683 -6.528 1.00173.10 C
ATOM 2877 NE1 TRP B 33 18.994 5.616 -7.480 1.00173.40 N
ATOM 2878 CE2 TRP B 33 20.219 6.221 -7.554 1.00173.23 C
ATOM 2879 CE3 TRP B 33 22.333 6.140 -6.386 1.00173.63 C
ATOM 2880 CZ2 TRP B 33 20.689 7.196 -8.433 1.00173.68 C
ATOM 2881 CZ3 TRP B 33 22.798 7.105 -7.263 1.00174.17 C
ATOM 2882 CH2 TRP B 33 21.979 7.621 -8.273 1.00174.39 C
ATOM 2883 N ALA B 34 23.349 3.121 -5.867 1.00173.96 N
ATOM 2884 CA ALA B 34 24.398 3.385 -6.852 1.00174.10 C
ATOM 2885 C ALA B 34 24.707 2.171 -7.721 1.00173.88 C
ATOM 2886 O ALA B 34 24.701 2.259 -8.948 1.00174.26 O
ATOM 2887 CB ALA B 34 25.662 3.865 -6.154 1.00174.61 C
ATOM 2888 N GLY B 35 24.981 1.042 -7.074 1.00173.90 N
ATOM 2889 CA GLY B 35 25.257 -0.197 -7.776 1.00173.65 C
ATOM 2890 C GLY B 35 24.111 -0.631 -8.668 1.00173.29 C
ATOM 2891 O GLY B 35 24.312 -0.963 -9.836 1.00173.34 O
ATOM 2892 N SER B 36 22.905 -0.627 -8.115 1.00173.01 N
ATOM 2893 CA SER B 36 21.734 -1.122 -8.825 1.00172.94 C
ATOM 2894 C SER B 36 21.213 -0.129 -9.867 1.00173.47 C
ATOM 2895 O SER B 36 20.589 -0.531 -10.850 1.00174.06 O
ATOM 2896 CB SER B 36 20.631 -1.473 -7.826 1.00172.87 C
ATOM 2897 OG SER B 36 20.419 -0.412 -6.911 1.00173.19 O
ATOM 2898 N MET B 37 21.467 1.160 -9.658 1.00173.44 N
ATOM 2899 CA MET B 37 21.106 2.172 -10.650 1.00173.50 C
ATOM 2900 C MET B 37 21.995 2.039 -11.878 1.00172.66 C
ATOM 2901 O MET B 37 21.561 2.283 -13.005 1.00172.10 O
ATOM 2902 CB MET B 37 21.220 3.582 -10.065 1.00173.86 C
ATOM 2903 CG MET B 37 20.967 4.708 -11.059 1.00174.00 C
ATOM 2904 SD MET B 37 19.286 4.761 -11.701 1.00174.28 S
ATOM 2905 CE MET B 37 19.206 6.453 -12.287 1.00173.03 C
ATOM 2906 N ALA B 38 23.243 1.647 -11.647 1.00172.84 N
ATOM 2907 CA ALA B 38 24.192 1.405 -12.724 1.00173.13 C
ATOM 2908 C ALA B 38 23.733 0.240 -13.592 1.00173.16 C
ATOM 2909 O ALA B 38 23.695 0.347 -14.819 1.00173.36 O
ATOM 2910 CB ALA B 38 25.580 1.138 -12.160 1.00173.88 C
ATOM 2911 N LEU B 39 23.394 -0.874 -12.947 1.00173.35 N
ATOM 2912 CA LEU B 39 22.871 -2.049 -13.641 1.00173.67 C
ATOM 2913 C LEU B 39 21.676 -1.704 -14.528 1.00173.78 C
ATOM 2914 O LEU B 39 21.526 -2.252 -15.619 1.00174.26 O
ATOM 2915 CB LEU B 39 22.469 -3.132 -12.635 1.00173.17 C
ATOM 2916 CG LEU B 39 23.569 -3.676 -11.725 1.00172.84 C
ATOM 2917 CD1 LEU B 39 22.979 -4.611 -10.685 1.00173.88 C
ATOM 2918 CD2 LEU B 39 24.627 -4.388 -12.547 1.00172.45 C
ATOM 2919 N TYR B 40 20.829 -0.797 -14.050 1.00173.66 N
ATOM 2920 CA TYR B 40 19.676 -0.352 -14.823 1.00173.58 C
ATOM 2921 C TYR B 40 20.121 0.349 -16.099 1.00172.95 C
ATOM 2922 O TYR B 40 19.549 0.138 -17.167 1.00172.94 O
ATOM 2923 CB TYR B 40 18.792 0.581 -13.992 1.00173.79 C
ATOM 2924 CG TYR B 40 17.619 1.146 -14.759 1.00173.50 C
ATOM 2925 CD1 TYR B 40 16.497 0.371 -15.021 1.00173.58 C
ATOM 2926 CD2 TYR B 40 17.636 2.453 -15.227 1.00173.72 C
ATOM 2927 CE1 TYR B 40 15.424 0.886 -15.726 1.00173.50 C
ATOM 2928 CE2 TYR B 40 16.569 2.974 -15.933 1.00173.46 C
ATOM 2929 CZ TYR B 40 15.466 2.186 -16.179 1.00173.12 C
ATOM 2930 OH TYR B 40 14.401 2.703 -16.880 1.00172.80 O
ATOM 2931 N GLU B 41 21.149 1.179 -15.979 1.00172.74 N
ATOM 2932 CA GLU B 41 21.675 1.906 -17.125 1.00172.90 C
ATOM 2933 C GLU B 41 22.382 0.959 -18.087 1.00172.85 C
ATOM 2934 O GLU B 41 22.229 1.073 -19.301 1.00173.27 O
ATOM 2935 CB GLU B 41 22.624 3.016 -16.667 1.00173.25 C
ATOM 2936 CG GLU B 41 21.964 4.062 -15.780 1.00173.39 C
ATOM 2937 CD GLU B 41 22.774 5.341 -15.679 1.00173.39 C
ATOM 2938 OE1 GLU B 41 23.989 5.302 -15.966 1.00173.77 O
ATOM 2939 OE2 GLU B 41 22.195 6.386 -15.313 1.00173.02 O
ATOM 2940 N LEU B 42 23.142 0.016 -17.541 1.00172.77 N
ATOM 2941 CA LEU B 42 23.858 -0.959 -18.357 1.00173.05 C
ATOM 2942 C LEU B 42 22.904 -1.872 -19.117 1.00172.57 C
ATOM 2943 O LEU B 42 23.263 -2.443 -20.148 1.00172.96 O
ATOM 2944 CB LEU B 42 24.798 -1.799 -17.490 1.00174.11 C
ATOM 2945 CG LEU B 42 26.053 -1.087 -16.985 1.00174.77 C
ATOM 2946 CD1 LEU B 42 26.914 -2.038 -16.173 1.00175.30 C
ATOM 2947 CD2 LEU B 42 26.834 -0.513 -18.157 1.00174.20 C
ATOM 2948 N ALA B 43 21.687 -2.009 -18.603 1.00171.83 N
ATOM 2949 CA ALA B 43 20.691 -2.858 -19.237 1.00172.33 C
ATOM 2950 C ALA B 43 19.910 -2.109 -20.312 1.00173.41 C
ATOM 2951 O ALA B 43 19.112 -2.707 -21.033 1.00173.67 O
ATOM 2952 CB ALA B 43 19.742 -3.423 -18.190 1.00173.33 C
ATOM 2953 N THR B 44 20.143 -0.803 -20.422 1.00173.89 N
ATOM 2954 CA THR B 44 19.393 0.028 -21.363 1.00173.70 C
ATOM 2955 C THR B 44 20.275 0.906 -22.250 1.00172.52 C
ATOM 2956 O THR B 44 19.812 1.434 -23.259 1.00171.60 O
ATOM 2957 CB THR B 44 18.396 0.945 -20.623 1.00173.97 C
ATOM 2958 OG1 THR B 44 19.115 1.845 -19.773 1.00174.60 O
ATOM 2959 CG2 THR B 44 17.428 0.125 -19.781 1.00174.00 C
ATOM 2960 N PHE B 45 21.540 1.064 -21.875 1.00172.38 N
ATOM 2961 CA PHE B 45 22.444 1.930 -22.625 1.00172.12 C
ATOM 2962 C PHE B 45 22.917 1.277 -23.919 1.00172.49 C
ATOM 2963 O PHE B 45 23.271 0.099 -23.938 1.00172.88 O
ATOM 2964 CB PHE B 45 23.651 2.320 -21.770 1.00172.86 C
ATOM 2965 CG PHE B 45 24.739 3.005 -22.542 1.00173.39 C
ATOM 2966 CD1 PHE B 45 24.592 4.318 -22.952 1.00173.71 C
ATOM 2967 CD2 PHE B 45 25.911 2.336 -22.857 1.00173.92 C
ATOM 2968 CE1 PHE B 45 25.592 4.954 -23.663 1.00173.93 C
ATOM 2969 CE2 PHE B 45 26.914 2.966 -23.568 1.00173.99 C
ATOM 2970 CZ PHE B 45 26.754 4.276 -23.972 1.00173.88 C
ATOM 2971 N ASP B 46 22.915 2.050 -25.000 1.00173.29 N
ATOM 2972 CA ASP B 46 23.373 1.561 -26.295 1.00173.89 C
ATOM 2973 C ASP B 46 24.706 2.199 -26.692 1.00173.51 C
ATOM 2974 O ASP B 46 24.762 3.394 -26.982 1.00173.48 O
ATOM 2975 CB ASP B 46 22.322 1.832 -27.372 1.00174.60 C
ATOM 2976 CG ASP B 46 22.754 1.349 -28.740 1.00174.76 C
ATOM 2977 OD1 ASP B 46 23.455 0.317 -28.811 1.00173.79 O
ATOM 2978 OD2 ASP B 46 22.401 2.004 -29.744 1.00175.40 O
ATOM 2979 N PRO B 47 25.785 1.399 -26.698 1.00173.21 N
ATOM 2980 CA PRO B 47 27.137 1.842 -27.049 1.00173.10 C
ATOM 2981 C PRO B 47 27.414 1.822 -28.551 1.00173.17 C
ATOM 2982 O PRO B 47 28.535 2.113 -28.966 1.00173.70 O
ATOM 2983 CB PRO B 47 28.020 0.823 -26.334 1.00173.65 C
ATOM 2984 CG PRO B 47 27.219 -0.428 -26.407 1.00174.02 C
ATOM 2985 CD PRO B 47 25.790 0.016 -26.190 1.00174.05 C
ATOM 2986 N SER B 48 26.408 1.471 -29.346 1.00173.44 N
ATOM 2987 CA SER B 48 26.574 1.290 -30.789 1.00174.21 C
ATOM 2988 C SER B 48 27.111 2.518 -31.528 1.00174.66 C
ATOM 2989 O SER B 48 27.675 2.388 -32.614 1.00174.96 O
ATOM 2990 CB SER B 48 25.241 0.874 -31.417 1.00174.57 C
ATOM 2991 OG SER B 48 24.314 1.947 -31.403 1.00174.76 O
ATOM 2992 N ASP B 49 26.940 3.702 -30.948 1.00174.49 N
ATOM 2993 CA ASP B 49 27.377 4.932 -31.605 1.00173.96 C
ATOM 2994 C ASP B 49 27.632 6.060 -30.612 1.00173.40 C
ATOM 2995 O ASP B 49 26.695 6.700 -30.143 1.00173.56 O
ATOM 2996 CB ASP B 49 26.337 5.376 -32.638 1.00174.13 C
ATOM 2997 CG ASP B 49 26.677 6.712 -33.274 1.00174.21 C
ATOM 2998 OD1 ASP B 49 27.860 6.932 -33.606 1.00174.78 O
ATOM 2999 OD2 ASP B 49 25.758 7.543 -33.446 1.00173.75 O
ATOM 3000 N PRO B 50 28.911 6.309 -30.294 1.00172.91 N
ATOM 3001 CA PRO B 50 29.304 7.370 -29.364 1.00173.17 C
ATOM 3002 C PRO B 50 29.254 8.760 -29.994 1.00173.45 C
ATOM 3003 O PRO B 50 29.390 9.760 -29.289 1.00173.47 O
ATOM 3004 CB PRO B 50 30.740 6.988 -29.006 1.00173.74 C
ATOM 3005 CG PRO B 50 31.246 6.341 -30.247 1.00173.11 C
ATOM 3006 CD PRO B 50 30.077 5.529 -30.747 1.00173.05 C
ATOM 3007 N VAL B 51 29.060 8.818 -31.308 1.00173.79 N
ATOM 3008 CA VAL B 51 29.035 10.087 -32.026 1.00173.97 C
ATOM 3009 C VAL B 51 27.683 10.788 -31.941 1.00173.49 C
ATOM 3010 O VAL B 51 27.573 11.868 -31.365 1.00173.81 O
ATOM 3011 CB VAL B 51 29.391 9.895 -33.512 1.00174.41 C
ATOM 3012 CG1 VAL B 51 29.540 11.243 -34.202 1.00174.03 C
ATOM 3013 CG2 VAL B 51 30.662 9.063 -33.651 1.00174.95 C
ATOM 3014 N LEU B 52 26.658 10.170 -32.516 1.00173.11 N
ATOM 3015 CA LEU B 52 25.342 10.791 -32.586 1.00173.31 C
ATOM 3016 C LEU B 52 24.378 10.254 -31.533 1.00174.10 C
ATOM 3017 O LEU B 52 23.283 10.788 -31.358 1.00174.38 O
ATOM 3018 CB LEU B 52 24.747 10.603 -33.981 1.00173.03 C
ATOM 3019 CG LEU B 52 25.422 11.413 -35.088 1.00173.31 C
ATOM 3020 CD1 LEU B 52 24.539 11.464 -36.320 1.00174.11 C
ATOM 3021 CD2 LEU B 52 25.757 12.818 -34.606 1.00173.36 C
ATOM 3022 N ASN B 53 24.782 9.202 -30.829 1.00174.17 N
ATOM 3023 CA ASN B 53 23.961 8.670 -29.743 1.00174.06 C
ATOM 3024 C ASN B 53 24.763 8.357 -28.475 1.00173.89 C
ATOM 3025 O ASN B 53 24.865 7.199 -28.070 1.00174.10 O
ATOM 3026 CB ASN B 53 23.225 7.416 -30.216 1.00174.10 C
ATOM 3027 CG ASN B 53 22.108 7.006 -29.278 1.00174.20 C
ATOM 3028 OD1 ASN B 53 21.391 7.849 -28.740 1.00174.12 O
ATOM 3029 ND2 ASN B 53 21.951 5.702 -29.081 1.00174.32 N
ATOM 3030 N PRO B 54 25.334 9.393 -27.840 1.00173.34 N
ATOM 3031 CA PRO B 54 26.126 9.191 -26.624 1.00172.83 C
ATOM 3032 C PRO B 54 25.259 9.091 -25.371 1.00172.80 C
ATOM 3033 O PRO B 54 24.057 9.358 -25.434 1.00172.55 O
ATOM 3034 CB PRO B 54 27.004 10.440 -26.584 1.00172.87 C
ATOM 3035 CG PRO B 54 26.129 11.487 -27.173 1.00173.81 C
ATOM 3036 CD PRO B 54 25.352 10.805 -28.264 1.00173.84 C
ATOM 3037 N MET B 55 25.872 8.691 -24.259 1.00173.31 N
ATOM 3038 CA MET B 55 25.192 8.521 -22.975 1.00173.31 C
ATOM 3039 C MET B 55 24.212 9.640 -22.607 1.00172.88 C
ATOM 3040 O MET B 55 23.108 9.369 -22.136 1.00173.23 O
ATOM 3041 CB MET B 55 26.233 8.368 -21.861 1.00173.42 C
ATOM 3042 CG MET B 55 27.275 9.477 -21.808 1.00173.72 C
ATOM 3043 SD MET B 55 28.375 9.293 -20.391 1.00172.58 S
ATOM 3044 CE MET B 55 29.451 7.976 -20.951 1.00172.38 C
ATOM 3045 N TRP B 56 24.605 10.891 -22.828 1.00172.77 N
ATOM 3046 CA TRP B 56 23.774 12.018 -22.412 1.00173.04 C
ATOM 3047 C TRP B 56 22.574 12.222 -23.336 1.00172.97 C
ATOM 3048 O TRP B 56 21.752 13.110 -23.110 1.00172.85 O
ATOM 3049 CB TRP B 56 24.600 13.304 -22.330 1.00173.87 C
ATOM 3050 CG TRP B 56 25.334 13.661 -23.586 1.00174.22 C
ATOM 3051 CD1 TRP B 56 26.612 13.314 -23.915 1.00174.28 C
ATOM 3052 CD2 TRP B 56 24.839 14.450 -24.676 1.00173.82 C
ATOM 3053 NE1 TRP B 56 26.943 13.834 -25.142 1.00174.37 N
ATOM 3054 CE2 TRP B 56 25.871 14.535 -25.631 1.00173.66 C
ATOM 3055 CE3 TRP B 56 23.625 15.090 -24.937 1.00173.45 C
ATOM 3056 CZ2 TRP B 56 25.724 15.231 -26.829 1.00172.88 C
ATOM 3057 CZ3 TRP B 56 23.481 15.782 -26.125 1.00172.97 C
ATOM 3058 CH2 TRP B 56 24.524 15.846 -27.056 1.00172.81 C
ATOM 3059 N ARG B 57 22.475 11.397 -24.372 1.00173.03 N
ATOM 3060 CA ARG B 57 21.301 11.398 -25.235 1.00173.60 C
ATOM 3061 C ARG B 57 20.346 10.292 -24.807 1.00173.54 C
ATOM 3062 O ARG B 57 19.155 10.330 -25.113 1.00173.65 O
ATOM 3063 CB ARG B 57 21.699 11.222 -26.701 1.00174.03 C
ATOM 3064 CG ARG B 57 22.301 12.463 -27.342 1.00174.17 C
ATOM 3065 CD ARG B 57 21.247 13.525 -27.616 1.00174.28 C
ATOM 3066 NE ARG B 57 20.212 13.055 -28.534 1.00174.46 N
ATOM 3067 CZ ARG B 57 19.227 13.815 -29.003 1.00174.33 C
ATOM 3068 NH1 ARG B 57 19.142 15.088 -28.643 1.00173.98 N
ATOM 3069 NH2 ARG B 57 18.328 13.303 -29.833 1.00174.23 N
ATOM 3070 N GLN B 58 20.880 9.308 -24.091 1.00173.53 N
ATOM 3071 CA GLN B 58 20.094 8.158 -23.663 1.00173.91 C
ATOM 3072 C GLN B 58 19.683 8.273 -22.200 1.00173.86 C
ATOM 3073 O GLN B 58 19.407 7.268 -21.549 1.00173.48 O
ATOM 3074 CB GLN B 58 20.879 6.865 -23.882 1.00173.81 C
ATOM 3075 CG GLN B 58 21.308 6.640 -25.320 1.00173.85 C
ATOM 3076 CD GLN B 58 22.193 5.419 -25.473 1.00174.26 C
ATOM 3077 OE1 GLN B 58 21.908 4.358 -24.917 1.00174.72 O
ATOM 3078 NE2 GLN B 58 23.272 5.563 -26.233 1.00174.16 N
ATOM 3079 N GLY B 59 19.640 9.503 -21.696 1.00173.93 N
ATOM 3080 CA GLY B 59 19.253 9.762 -20.320 1.00173.86 C
ATOM 3081 C GLY B 59 20.091 9.033 -19.286 1.00174.31 C
ATOM 3082 O GLY B 59 19.567 8.552 -18.282 1.00174.30 O
ATOM 3083 N MET B 60 21.395 8.952 -19.530 1.00174.73 N
ATOM 3084 CA MET B 60 22.319 8.328 -18.587 1.00174.51 C
ATOM 3085 C MET B 60 22.734 9.323 -17.507 1.00174.19 C
ATOM 3086 O MET B 60 23.165 10.434 -17.814 1.00174.19 O
ATOM 3087 CB MET B 60 23.552 7.793 -19.320 1.00174.29 C
ATOM 3088 CG MET B 60 23.261 6.660 -20.293 1.00173.83 C
ATOM 3089 SD MET B 60 22.753 5.139 -19.467 1.00173.28 S
ATOM 3090 CE MET B 60 21.015 5.066 -19.889 1.00173.25 C
ATOM 3091 N PHE B 61 22.616 8.921 -16.247 1.00173.41 N
ATOM 3092 CA PHE B 61 22.875 9.832 -15.137 1.00172.86 C
ATOM 3093 C PHE B 61 24.068 9.396 -14.296 1.00173.04 C
ATOM 3094 O PHE B 61 24.858 10.226 -13.849 1.00172.67 O
ATOM 3095 CB PHE B 61 21.630 9.955 -14.255 1.00172.92 C
ATOM 3096 CG PHE B 61 21.810 10.863 -13.073 1.00173.16 C
ATOM 3097 CD1 PHE B 61 22.059 12.213 -13.254 1.00173.52 C
ATOM 3098 CD2 PHE B 61 21.715 10.372 -11.781 1.00173.54 C
ATOM 3099 CE1 PHE B 61 22.223 13.055 -12.171 1.00173.45 C
ATOM 3100 CE2 PHE B 61 21.876 11.211 -10.693 1.00174.07 C
ATOM 3101 CZ PHE B 61 22.129 12.554 -10.889 1.00173.86 C
ATOM 3102 N VAL B 62 24.197 8.089 -14.088 1.00173.75 N
ATOM 3103 CA VAL B 62 25.280 7.542 -13.281 1.00174.52 C
ATOM 3104 C VAL B 62 26.497 7.219 -14.145 1.00173.98 C
ATOM 3105 O VAL B 62 27.641 7.429 -13.735 1.00173.94 O
ATOM 3106 CB VAL B 62 24.814 6.278 -12.522 1.00175.05 C
ATOM 3107 CG1 VAL B 62 25.998 5.439 -12.069 1.00174.40 C
ATOM 3108 CG2 VAL B 62 23.950 6.669 -11.335 1.00174.93 C
ATOM 3109 N LEU B 63 26.234 6.735 -15.355 1.00173.41 N
ATOM 3110 CA LEU B 63 27.282 6.363 -16.303 1.00172.91 C
ATOM 3111 C LEU B 63 28.370 7.425 -16.536 1.00172.97 C
ATOM 3112 O LEU B 63 29.549 7.077 -16.605 1.00173.37 O
ATOM 3113 CB LEU B 63 26.652 5.993 -17.649 1.00173.34 C
ATOM 3114 CG LEU B 63 27.533 5.186 -18.604 1.00173.84 C
ATOM 3115 CD1 LEU B 63 27.706 3.769 -18.086 1.00173.25 C
ATOM 3116 CD2 LEU B 63 26.946 5.185 -20.006 1.00174.41 C
ATOM 3117 N PRO B 64 27.996 8.716 -16.663 1.00173.11 N
ATOM 3118 CA PRO B 64 29.070 9.692 -16.881 1.00173.69 C
ATOM 3119 C PRO B 64 30.006 9.844 -15.687 1.00173.37 C
ATOM 3120 O PRO B 64 31.213 10.000 -15.873 1.00173.51 O
ATOM 3121 CB PRO B 64 28.309 10.998 -17.136 1.00173.76 C
ATOM 3122 CG PRO B 64 26.985 10.796 -16.489 1.00173.42 C
ATOM 3123 CD PRO B 64 26.672 9.359 -16.749 1.00173.50 C
ATOM 3124 N PHE B 65 29.456 9.800 -14.479 1.00172.90 N
ATOM 3125 CA PHE B 65 30.260 9.942 -13.272 1.00173.43 C
ATOM 3126 C PHE B 65 31.245 8.786 -13.103 1.00174.26 C
ATOM 3127 O PHE B 65 32.226 8.903 -12.371 1.00175.42 O
ATOM 3128 CB PHE B 65 29.356 10.054 -12.044 1.00173.81 C
ATOM 3129 CG PHE B 65 28.600 11.350 -11.968 1.00173.42 C
ATOM 3130 CD1 PHE B 65 29.165 12.464 -11.371 1.00173.75 C
ATOM 3131 CD2 PHE B 65 27.328 11.456 -12.502 1.00173.10 C
ATOM 3132 CE1 PHE B 65 28.473 13.658 -11.302 1.00173.66 C
ATOM 3133 CE2 PHE B 65 26.629 12.648 -12.436 1.00172.96 C
ATOM 3134 CZ PHE B 65 27.203 13.749 -11.836 1.00173.30 C
ATOM 3135 N MET B 66 30.987 7.675 -13.786 1.00173.80 N
ATOM 3136 CA MET B 66 31.890 6.531 -13.741 1.00173.54 C
ATOM 3137 C MET B 66 32.999 6.669 -14.779 1.00172.99 C
ATOM 3138 O MET B 66 34.084 6.111 -14.624 1.00172.75 O
ATOM 3139 CB MET B 66 31.125 5.228 -13.968 1.00173.30 C
ATOM 3140 CG MET B 66 30.321 4.755 -12.770 1.00173.10 C
ATOM 3141 SD MET B 66 29.659 3.097 -13.018 1.00171.02 S
ATOM 3142 CE MET B 66 28.311 3.428 -14.146 1.00172.95 C
ATOM 3143 N ALA B 67 32.718 7.422 -15.835 1.00173.08 N
ATOM 3144 CA ALA B 67 33.675 7.605 -16.918 1.00173.81 C
ATOM 3145 C ALA B 67 34.651 8.731 -16.600 1.00173.93 C
ATOM 3146 O ALA B 67 35.807 8.704 -17.026 1.00174.43 O
ATOM 3147 CB ALA B 67 32.944 7.884 -18.224 1.00174.43 C
ATOM 3148 N ARG B 68 34.177 9.717 -15.847 1.00173.33 N
ATOM 3149 CA ARG B 68 34.984 10.872 -15.474 1.00173.56 C
ATOM 3150 C ARG B 68 36.240 10.494 -14.690 1.00174.03 C
ATOM 3151 O ARG B 68 37.244 11.203 -14.733 1.00174.30 O
ATOM 3152 CB ARG B 68 34.140 11.854 -14.657 1.00173.24 C
ATOM 3153 CG ARG B 68 34.838 13.164 -14.342 1.00174.22 C
ATOM 3154 CD ARG B 68 33.912 14.112 -13.609 1.00174.02 C
ATOM 3155 NE ARG B 68 33.335 13.499 -12.419 1.00173.43 N
ATOM 3156 CZ ARG B 68 32.606 14.152 -11.520 1.00173.95 C
ATOM 3157 NH1 ARG B 68 32.365 15.448 -11.671 1.00173.93 N
ATOM 3158 NH2 ARG B 68 32.122 13.508 -10.469 1.00174.32 N
ATOM 3159 N LEU B 69 36.189 9.369 -13.986 1.00174.52 N
ATOM 3160 CA LEU B 69 37.286 8.996 -13.101 1.00175.46 C
ATOM 3161 C LEU B 69 38.025 7.738 -13.555 1.00175.56 C
ATOM 3162 O LEU B 69 38.833 7.187 -12.808 1.00175.42 O
ATOM 3163 CB LEU B 69 36.768 8.808 -11.674 1.00175.86 C
ATOM 3164 CG LEU B 69 36.135 10.035 -11.013 1.00175.35 C
ATOM 3165 CD1 LEU B 69 35.709 9.724 -9.584 1.00174.75 C
ATOM 3166 CD2 LEU B 69 37.090 11.218 -11.048 1.00174.90 C
ATOM 3167 N GLY B 70 37.749 7.283 -14.774 1.00174.93 N
ATOM 3168 CA GLY B 70 38.504 6.182 -15.347 1.00174.82 C
ATOM 3169 C GLY B 70 37.705 5.063 -15.988 1.00174.19 C
ATOM 3170 O GLY B 70 38.000 4.655 -17.113 1.00173.88 O
ATOM 3171 N VAL B 71 36.699 4.563 -15.277 1.00173.85 N
ATOM 3172 CA VAL B 71 35.916 3.426 -15.753 1.00173.52 C
ATOM 3173 C VAL B 71 35.178 3.768 -17.043 1.00173.19 C
ATOM 3174 O VAL B 71 34.173 4.476 -17.029 1.00173.01 O
ATOM 3175 CB VAL B 71 34.903 2.959 -14.693 1.00173.98 C
ATOM 3176 CG1 VAL B 71 34.036 1.837 -15.243 1.00174.06 C
ATOM 3177 CG2 VAL B 71 35.632 2.500 -13.443 1.00174.53 C
ATOM 3178 N THR B 72 35.689 3.254 -18.157 1.00172.88 N
ATOM 3179 CA THR B 72 35.142 3.574 -19.471 1.00173.12 C
ATOM 3180 C THR B 72 34.945 2.336 -20.338 1.00172.73 C
ATOM 3181 O THR B 72 34.789 2.443 -21.553 1.00173.45 O
ATOM 3182 CB THR B 72 36.053 4.560 -20.227 1.00174.22 C
ATOM 3183 OG1 THR B 72 37.389 4.040 -20.269 1.00174.17 O
ATOM 3184 CG2 THR B 72 36.065 5.915 -19.538 1.00174.84 C
ATOM 3185 N GLY B 73 34.954 1.163 -19.716 1.00172.10 N
ATOM 3186 CA GLY B 73 34.809 -0.074 -20.460 1.00172.25 C
ATOM 3187 C GLY B 73 33.826 -1.039 -19.831 1.00172.93 C
ATOM 3188 O GLY B 73 33.446 -0.888 -18.671 1.00173.33 O
ATOM 3189 N SER B 74 33.412 -2.035 -20.607 1.00173.53 N
ATOM 3190 CA SER B 74 32.485 -3.051 -20.128 1.00173.59 C
ATOM 3191 C SER B 74 33.069 -4.446 -20.318 1.00174.14 C
ATOM 3192 O SER B 74 33.893 -4.666 -21.205 1.00174.13 O
ATOM 3193 CB SER B 74 31.144 -2.940 -20.854 1.00173.40 C
ATOM 3194 OG SER B 74 30.295 -4.024 -20.524 1.00172.65 O
ATOM 3195 N TRP B 75 32.636 -5.386 -19.482 1.00174.85 N
ATOM 3196 CA TRP B 75 33.081 -6.774 -19.584 1.00175.96 C
ATOM 3197 C TRP B 75 32.669 -7.406 -20.911 1.00175.46 C
ATOM 3198 O TRP B 75 33.260 -8.394 -21.347 1.00176.35 O
ATOM 3199 CB TRP B 75 32.530 -7.606 -18.423 1.00176.59 C
ATOM 3200 CG TRP B 75 33.237 -7.384 -17.118 1.00176.09 C
ATOM 3201 CD1 TRP B 75 34.469 -6.825 -16.934 1.00175.30 C
ATOM 3202 CD2 TRP B 75 32.754 -7.726 -15.814 1.00175.85 C
ATOM 3203 NE1 TRP B 75 34.780 -6.793 -15.596 1.00174.95 N
ATOM 3204 CE2 TRP B 75 33.742 -7.342 -14.885 1.00175.10 C
ATOM 3205 CE3 TRP B 75 31.578 -8.320 -15.337 1.00175.25 C
ATOM 3206 CZ2 TRP B 75 33.594 -7.530 -13.513 1.00174.53 C
ATOM 3207 CZ3 TRP B 75 31.432 -8.505 -13.973 1.00174.46 C
ATOM 3208 CH2 TRP B 75 32.435 -8.112 -13.077 1.00174.22 C
ATOM 3209 N SER B 76 31.655 -6.832 -21.549 1.00174.21 N
ATOM 3210 CA SER B 76 31.151 -7.376 -22.801 1.00173.67 C
ATOM 3211 C SER B 76 32.015 -6.960 -23.990 1.00173.28 C
ATOM 3212 O SER B 76 31.854 -7.487 -25.090 1.00173.06 O
ATOM 3213 CB SER B 76 29.703 -6.940 -23.020 1.00173.54 C
ATOM 3214 OG SER B 76 29.608 -5.528 -23.092 1.00173.49 O
ATOM 3215 N GLY B 77 32.945 -6.037 -23.761 1.00173.07 N
ATOM 3216 CA GLY B 77 33.901 -5.659 -24.789 1.00173.74 C
ATOM 3217 C GLY B 77 33.890 -4.213 -25.261 1.00174.01 C
ATOM 3218 O GLY B 77 34.938 -3.680 -25.629 1.00174.39 O
ATOM 3219 N TRP B 78 32.724 -3.572 -25.265 1.00173.76 N
ATOM 3220 CA TRP B 78 32.633 -2.205 -25.778 1.00173.45 C
ATOM 3221 C TRP B 78 33.209 -1.185 -24.800 1.00173.72 C
ATOM 3222 O TRP B 78 33.545 -1.520 -23.663 1.00174.08 O
ATOM 3223 CB TRP B 78 31.182 -1.841 -26.115 1.00173.35 C
ATOM 3224 CG TRP B 78 30.233 -1.954 -24.965 1.00173.21 C
ATOM 3225 CD1 TRP B 78 29.456 -3.026 -24.652 1.00173.16 C
ATOM 3226 CD2 TRP B 78 29.960 -0.956 -23.973 1.00173.37 C
ATOM 3227 NE1 TRP B 78 28.713 -2.761 -23.527 1.00172.95 N
ATOM 3228 CE2 TRP B 78 29.004 -1.496 -23.091 1.00173.37 C
ATOM 3229 CE3 TRP B 78 30.429 0.342 -23.746 1.00173.84 C
ATOM 3230 CZ2 TRP B 78 28.511 -0.788 -21.998 1.00173.98 C
ATOM 3231 CZ3 TRP B 78 29.938 1.044 -22.661 1.00174.55 C
ATOM 3232 CH2 TRP B 78 28.988 0.478 -21.801 1.00174.67 C
ATOM 3233 N SER B 79 33.315 0.061 -25.254 1.00173.37 N
ATOM 3234 CA SER B 79 33.888 1.131 -24.445 1.00173.30 C
ATOM 3235 C SER B 79 33.287 2.485 -24.809 1.00172.70 C
ATOM 3236 O SER B 79 32.867 2.700 -25.946 1.00172.41 O
ATOM 3237 CB SER B 79 35.409 1.172 -24.609 1.00173.65 C
ATOM 3238 OG SER B 79 35.776 1.750 -25.852 1.00173.15 O
ATOM 3239 N ILE B 80 33.247 3.388 -23.832 1.00172.87 N
ATOM 3240 CA ILE B 80 32.669 4.719 -24.006 1.00172.30 C
ATOM 3241 C ILE B 80 33.291 5.477 -25.175 1.00172.02 C
ATOM 3242 O ILE B 80 32.586 6.120 -25.952 1.00171.99 O
ATOM 3243 CB ILE B 80 32.822 5.562 -22.720 1.00173.07 C
ATOM 3244 CG1 ILE B 80 31.961 4.979 -21.599 1.00174.11 C
ATOM 3245 CG2 ILE B 80 32.453 7.018 -22.972 1.00172.24 C
ATOM 3246 CD1 ILE B 80 30.538 4.674 -22.015 1.00173.54 C
ATOM 3247 N THR B 81 34.609 5.376 -25.309 1.00172.52 N
ATOM 3248 CA THR B 81 35.323 6.086 -26.365 1.00173.40 C
ATOM 3249 C THR B 81 34.994 5.507 -27.737 1.00173.33 C
ATOM 3250 O THR B 81 35.184 6.166 -28.760 1.00173.29 O
ATOM 3251 CB THR B 81 36.847 6.038 -26.147 1.00173.73 C
ATOM 3252 OG1 THR B 81 37.296 4.679 -26.187 1.00173.51 O
ATOM 3253 CG2 THR B 81 37.210 6.642 -24.800 1.00173.44 C
ATOM 3254 N GLY B 82 34.498 4.276 -27.751 1.00173.04 N
ATOM 3255 CA GLY B 82 34.081 3.642 -28.986 1.00172.85 C
ATOM 3256 C GLY B 82 35.099 2.648 -29.504 1.00173.62 C
ATOM 3257 O GLY B 82 35.022 2.211 -30.652 1.00173.72 O
ATOM 3258 N GLU B 83 36.057 2.290 -28.654 1.00173.78 N
ATOM 3259 CA GLU B 83 37.105 1.350 -29.036 1.00173.98 C
ATOM 3260 C GLU B 83 36.670 -0.093 -28.819 1.00173.75 C
ATOM 3261 O GLU B 83 35.677 -0.361 -28.144 1.00173.60 O
ATOM 3262 CB GLU B 83 38.389 1.623 -28.250 1.00173.65 C
ATOM 3263 CG GLU B 83 38.958 3.016 -28.445 1.00174.45 C
ATOM 3264 CD GLU B 83 40.263 3.214 -27.699 1.00175.44 C
ATOM 3265 OE1 GLU B 83 41.193 2.404 -27.900 1.00175.56 O
ATOM 3266 OE2 GLU B 83 40.360 4.179 -26.912 1.00176.00 O
ATOM 3267 N THR B 84 37.423 -1.020 -29.400 1.00173.89 N
ATOM 3268 CA THR B 84 37.173 -2.444 -29.217 1.00174.40 C
ATOM 3269 C THR B 84 38.468 -3.176 -28.888 1.00174.24 C
ATOM 3270 O THR B 84 39.556 -2.607 -28.982 1.00173.43 O
ATOM 3271 CB THR B 84 36.537 -3.074 -30.467 1.00174.68 C
ATOM 3272 OG1 THR B 84 37.186 -2.573 -31.641 1.00175.78 O
ATOM 3273 CG2 THR B 84 35.051 -2.749 -30.531 1.00173.22 C
ATOM 3274 N GLY B 85 38.345 -4.441 -28.495 1.00174.46 N
ATOM 3275 CA GLY B 85 39.499 -5.244 -28.133 1.00174.93 C
ATOM 3276 C GLY B 85 40.141 -4.840 -26.817 1.00176.43 C
ATOM 3277 O GLY B 85 41.089 -5.484 -26.363 1.00177.23 O
ATOM 3278 N ILE B 86 39.629 -3.775 -26.206 1.00176.20 N
ATOM 3279 CA ILE B 86 40.165 -3.271 -24.945 1.00175.72 C
ATOM 3280 C ILE B 86 39.842 -4.204 -23.777 1.00175.21 C
ATOM 3281 O ILE B 86 38.849 -4.933 -23.804 1.00174.62 O
ATOM 3282 CB ILE B 86 39.646 -1.838 -24.644 1.00174.11 C
ATOM 3283 CG1 ILE B 86 38.133 -1.735 -24.863 1.00173.82 C
ATOM 3284 CG2 ILE B 86 40.333 -0.829 -25.548 1.00172.83 C
ATOM 3285 CD1 ILE B 86 37.275 -2.131 -23.671 1.00173.99 C
ATOM 3286 N ASP B 87 40.696 -4.185 -22.760 1.00174.86 N
ATOM 3287 CA ASP B 87 40.499 -5.011 -21.577 1.00174.65 C
ATOM 3288 C ASP B 87 40.416 -4.118 -20.346 1.00174.71 C
ATOM 3289 O ASP B 87 41.443 -3.713 -19.801 1.00175.00 O
ATOM 3290 CB ASP B 87 41.633 -6.031 -21.433 1.00175.24 C
ATOM 3291 CG ASP B 87 41.358 -7.071 -20.357 1.00175.39 C
ATOM 3292 OD1 ASP B 87 41.059 -6.696 -19.203 1.00175.00 O
ATOM 3293 OD2 ASP B 87 41.447 -8.276 -20.670 1.00175.66 O
ATOM 3294 N PRO B 88 39.189 -3.803 -19.907 1.00174.42 N
ATOM 3295 CA PRO B 88 38.942 -2.932 -18.755 1.00174.21 C
ATOM 3296 C PRO B 88 39.395 -3.557 -17.439 1.00174.60 C
ATOM 3297 O PRO B 88 39.503 -2.858 -16.431 1.00174.86 O
ATOM 3298 CB PRO B 88 37.422 -2.758 -18.776 1.00174.05 C
ATOM 3299 CG PRO B 88 36.929 -4.022 -19.396 1.00173.89 C
ATOM 3300 CD PRO B 88 37.931 -4.316 -20.476 1.00174.04 C
ATOM 3301 N GLY B 89 39.652 -4.860 -17.454 1.00174.38 N
ATOM 3302 CA GLY B 89 40.014 -5.575 -16.246 1.00174.36 C
ATOM 3303 C GLY B 89 38.775 -5.907 -15.441 1.00174.24 C
ATOM 3304 O GLY B 89 37.735 -6.248 -16.004 1.00173.99 O
ATOM 3305 N PHE B 90 38.879 -5.804 -14.120 1.00173.84 N
ATOM 3306 CA PHE B 90 37.727 -6.033 -13.255 1.00173.49 C
ATOM 3307 C PHE B 90 36.895 -4.766 -13.116 1.00173.25 C
ATOM 3308 O PHE B 90 35.666 -4.821 -13.094 1.00173.53 O
ATOM 3309 CB PHE B 90 38.170 -6.525 -11.874 1.00173.52 C
ATOM 3310 CG PHE B 90 37.055 -6.586 -10.866 1.00173.96 C
ATOM 3311 CD1 PHE B 90 36.175 -7.655 -10.851 1.00174.24 C
ATOM 3312 CD2 PHE B 90 36.892 -5.580 -9.928 1.00174.29 C
ATOM 3313 CE1 PHE B 90 35.148 -7.716 -9.926 1.00173.94 C
ATOM 3314 CE2 PHE B 90 35.867 -5.635 -9.001 1.00174.49 C
ATOM 3315 CZ PHE B 90 34.995 -6.707 -9.000 1.00173.82 C
ATOM 3316 N TRP B 91 37.568 -3.625 -13.025 1.00173.16 N
ATOM 3317 CA TRP B 91 36.881 -2.365 -12.781 1.00173.64 C
ATOM 3318 C TRP B 91 36.198 -1.824 -14.033 1.00174.47 C
ATOM 3319 O TRP B 91 36.596 -0.794 -14.581 1.00174.31 O
ATOM 3320 CB TRP B 91 37.854 -1.326 -12.225 1.00173.44 C
ATOM 3321 CG TRP B 91 38.354 -1.660 -10.856 1.00173.56 C
ATOM 3322 CD1 TRP B 91 39.650 -1.860 -10.485 1.00174.21 C
ATOM 3323 CD2 TRP B 91 37.564 -1.851 -9.675 1.00173.98 C
ATOM 3324 NE1 TRP B 91 39.718 -2.156 -9.144 1.00173.93 N
ATOM 3325 CE2 TRP B 91 38.451 -2.157 -8.625 1.00173.89 C
ATOM 3326 CE3 TRP B 91 36.194 -1.790 -9.405 1.00174.39 C
ATOM 3327 CZ2 TRP B 91 38.014 -2.402 -7.326 1.00174.07 C
ATOM 3328 CZ3 TRP B 91 35.761 -2.034 -8.115 1.00174.84 C
ATOM 3329 CH2 TRP B 91 36.668 -2.335 -7.090 1.00174.76 C
ATOM 3330 N SER B 92 35.167 -2.536 -14.478 1.00174.88 N
ATOM 3331 CA SER B 92 34.302 -2.067 -15.552 1.00174.67 C
ATOM 3332 C SER B 92 33.028 -1.511 -14.932 1.00174.13 C
ATOM 3333 O SER B 92 32.871 -1.540 -13.711 1.00174.17 O
ATOM 3334 CB SER B 92 33.978 -3.197 -16.533 1.00174.07 C
ATOM 3335 OG SER B 92 33.180 -4.194 -15.917 1.00173.86 O
ATOM 3336 N PHE B 93 32.131 -0.987 -15.762 1.00173.73 N
ATOM 3337 CA PHE B 93 30.830 -0.528 -15.283 1.00173.23 C
ATOM 3338 C PHE B 93 30.119 -1.626 -14.500 1.00173.17 C
ATOM 3339 O PHE B 93 29.483 -1.362 -13.481 1.00173.43 O
ATOM 3340 CB PHE B 93 29.962 -0.061 -16.451 1.00173.31 C
ATOM 3341 CG PHE B 93 30.536 1.101 -17.201 1.00173.48 C
ATOM 3342 CD1 PHE B 93 30.626 2.346 -16.604 1.00173.36 C
ATOM 3343 CD2 PHE B 93 30.976 0.954 -18.505 1.00173.44 C
ATOM 3344 CE1 PHE B 93 31.156 3.421 -17.288 1.00173.63 C
ATOM 3345 CE2 PHE B 93 31.506 2.025 -19.197 1.00173.44 C
ATOM 3346 CZ PHE B 93 31.595 3.259 -18.586 1.00173.77 C
ATOM 3347 N GLU B 94 30.231 -2.859 -14.988 1.00173.05 N
ATOM 3348 CA GLU B 94 29.701 -4.018 -14.280 1.00173.34 C
ATOM 3349 C GLU B 94 30.414 -4.188 -12.943 1.00173.38 C
ATOM 3350 O GLU B 94 29.777 -4.393 -11.911 1.00174.02 O
ATOM 3351 CB GLU B 94 29.852 -5.290 -15.120 1.00173.80 C
ATOM 3352 CG GLU B 94 29.052 -5.297 -16.415 1.00174.79 C
ATOM 3353 CD GLU B 94 29.737 -4.530 -17.528 1.00174.53 C
ATOM 3354 OE1 GLU B 94 30.985 -4.504 -17.551 1.00174.37 O
ATOM 3355 OE2 GLU B 94 29.030 -3.956 -18.382 1.00174.07 O
ATOM 3356 N GLY B 95 31.742 -4.109 -12.979 1.00173.41 N
ATOM 3357 CA GLY B 95 32.567 -4.209 -11.788 1.00173.88 C
ATOM 3358 C GLY B 95 32.203 -3.203 -10.712 1.00173.86 C
ATOM 3359 O GLY B 95 32.001 -3.569 -9.555 1.00174.47 O
ATOM 3360 N VAL B 96 32.132 -1.933 -11.097 1.00173.48 N
ATOM 3361 CA VAL B 96 31.732 -0.862 -10.189 1.00173.49 C
ATOM 3362 C VAL B 96 30.366 -1.131 -9.562 1.00173.27 C
ATOM 3363 O VAL B 96 30.203 -1.050 -8.343 1.00172.86 O
ATOM 3364 CB VAL B 96 31.689 0.497 -10.909 1.00173.95 C
ATOM 3365 CG1 VAL B 96 31.149 1.574 -9.983 1.00174.24 C
ATOM 3366 CG2 VAL B 96 33.071 0.867 -11.415 1.00174.43 C
ATOM 3367 N ALA B 97 29.389 -1.443 -10.409 1.00173.48 N
ATOM 3368 CA ALA B 97 28.046 -1.781 -9.953 1.00173.30 C
ATOM 3369 C ALA B 97 28.074 -2.956 -8.980 1.00173.31 C
ATOM 3370 O ALA B 97 27.398 -2.933 -7.952 1.00173.35 O
ATOM 3371 CB ALA B 97 27.151 -2.096 -11.142 1.00173.77 C
ATOM 3372 N LEU B 98 28.860 -3.975 -9.314 1.00173.95 N
ATOM 3373 CA LEU B 98 29.041 -5.142 -8.453 1.00174.01 C
ATOM 3374 C LEU B 98 29.571 -4.747 -7.080 1.00173.94 C
ATOM 3375 O LEU B 98 29.006 -5.123 -6.057 1.00174.12 O
ATOM 3376 CB LEU B 98 29.992 -6.146 -9.106 1.00174.40 C
ATOM 3377 CG LEU B 98 30.441 -7.325 -8.239 1.00173.63 C
ATOM 3378 CD1 LEU B 98 29.258 -8.194 -7.842 1.00173.27 C
ATOM 3379 CD2 LEU B 98 31.498 -8.147 -8.960 1.00173.62 C
ATOM 3380 N ALA B 99 30.661 -3.986 -7.079 1.00174.13 N
ATOM 3381 CA ALA B 99 31.303 -3.505 -5.857 1.00174.53 C
ATOM 3382 C ALA B 99 30.310 -2.855 -4.895 1.00174.42 C
ATOM 3383 O ALA B 99 30.210 -3.247 -3.731 1.00174.70 O
ATOM 3384 CB ALA B 99 32.414 -2.525 -6.204 1.00174.77 C
ATOM 3385 N HIS B 100 29.600 -1.844 -5.389 1.00173.81 N
ATOM 3386 CA HIS B 100 28.642 -1.086 -4.591 1.00173.59 C
ATOM 3387 C HIS B 100 27.568 -1.960 -3.955 1.00173.70 C
ATOM 3388 O HIS B 100 27.197 -1.762 -2.796 1.00173.72 O
ATOM 3389 CB HIS B 100 27.978 -0.026 -5.461 1.00172.88 C
ATOM 3390 CG HIS B 100 28.848 1.159 -5.721 1.00172.32 C
ATOM 3391 ND1 HIS B 100 30.003 1.082 -6.469 1.00172.44 N
ATOM 3392 CD2 HIS B 100 28.738 2.449 -5.327 1.00172.44 C
ATOM 3393 CE1 HIS B 100 30.564 2.276 -6.529 1.00173.02 C
ATOM 3394 NE2 HIS B 100 29.816 3.122 -5.844 1.00172.64 N
ATOM 3395 N ILE B 101 27.072 -2.919 -4.727 1.00173.61 N
ATOM 3396 CA ILE B 101 26.059 -3.845 -4.246 1.00173.23 C
ATOM 3397 C ILE B 101 26.589 -4.666 -3.073 1.00173.66 C
ATOM 3398 O ILE B 101 25.906 -4.831 -2.062 1.00173.72 O
ATOM 3399 CB ILE B 101 25.587 -4.783 -5.368 1.00173.08 C
ATOM 3400 CG1 ILE B 101 24.798 -3.992 -6.412 1.00174.34 C
ATOM 3401 CG2 ILE B 101 24.732 -5.905 -4.811 1.00173.30 C
ATOM 3402 CD1 ILE B 101 23.588 -3.277 -5.847 1.00174.32 C
ATOM 3403 N VAL B 102 27.823 -5.149 -3.199 1.00174.16 N
ATOM 3404 CA VAL B 102 28.440 -5.955 -2.153 1.00173.77 C
ATOM 3405 C VAL B 102 28.714 -5.117 -0.911 1.00173.95 C
ATOM 3406 O VAL B 102 28.438 -5.545 0.209 1.00174.58 O
ATOM 3407 CB VAL B 102 29.758 -6.600 -2.631 1.00172.90 C
ATOM 3408 CG1 VAL B 102 30.365 -7.455 -1.525 1.00172.48 C
ATOM 3409 CG2 VAL B 102 29.530 -7.423 -3.888 1.00173.80 C
ATOM 3410 N LEU B 103 29.261 -3.922 -1.116 1.00173.86 N
ATOM 3411 CA LEU B 103 29.515 -2.997 -0.017 1.00173.90 C
ATOM 3412 C LEU B 103 28.230 -2.660 0.737 1.00173.91 C
ATOM 3413 O LEU B 103 28.247 -2.472 1.953 1.00174.02 O
ATOM 3414 CB LEU B 103 30.170 -1.715 -0.541 1.00173.33 C
ATOM 3415 CG LEU B 103 30.373 -0.585 0.470 1.00173.08 C
ATOM 3416 CD1 LEU B 103 31.245 -1.056 1.622 1.00174.23 C
ATOM 3417 CD2 LEU B 103 30.982 0.629 -0.200 1.00173.36 C
ATOM 3418 N SER B 104 27.116 -2.605 0.014 1.00173.61 N
ATOM 3419 CA SER B 104 25.823 -2.308 0.622 1.00173.46 C
ATOM 3420 C SER B 104 25.400 -3.429 1.564 1.00173.68 C
ATOM 3421 O SER B 104 24.895 -3.175 2.658 1.00173.99 O
ATOM 3422 CB SER B 104 24.756 -2.096 -0.454 1.00174.00 C
ATOM 3423 OG SER B 104 23.482 -1.883 0.128 1.00174.10 O
ATOM 3424 N GLY B 105 25.610 -4.668 1.130 1.00173.91 N
ATOM 3425 CA GLY B 105 25.297 -5.832 1.938 1.00173.95 C
ATOM 3426 C GLY B 105 26.096 -5.895 3.226 1.00173.32 C
ATOM 3427 O GLY B 105 25.578 -6.295 4.267 1.00172.61 O
ATOM 3428 N LEU B 106 27.365 -5.510 3.151 1.00173.38 N
ATOM 3429 CA LEU B 106 28.240 -5.517 4.318 1.00172.97 C
ATOM 3430 C LEU B 106 27.832 -4.441 5.317 1.00173.49 C
ATOM 3431 O LEU B 106 27.792 -4.683 6.523 1.00174.15 O
ATOM 3432 CB LEU B 106 29.696 -5.317 3.897 1.00172.79 C
ATOM 3433 CG LEU B 106 30.302 -6.438 3.054 1.00173.03 C
ATOM 3434 CD1 LEU B 106 31.643 -6.010 2.482 1.00173.48 C
ATOM 3435 CD2 LEU B 106 30.444 -7.714 3.872 1.00173.92 C
ATOM 3436 N LEU B 107 27.532 -3.252 4.803 1.00173.42 N
ATOM 3437 CA LEU B 107 27.085 -2.140 5.633 1.00173.49 C
ATOM 3438 C LEU B 107 25.746 -2.461 6.287 1.00173.53 C
ATOM 3439 O LEU B 107 25.442 -1.976 7.376 1.00173.62 O
ATOM 3440 CB LEU B 107 26.976 -0.861 4.802 1.00173.77 C
ATOM 3441 CG LEU B 107 28.293 -0.312 4.250 1.00174.03 C
ATOM 3442 CD1 LEU B 107 28.028 0.725 3.169 1.00173.30 C
ATOM 3443 CD2 LEU B 107 29.164 0.264 5.360 1.00174.67 C
ATOM 3444 N PHE B 108 24.953 -3.281 5.604 1.00173.42 N
ATOM 3445 CA PHE B 108 23.676 -3.750 6.126 1.00173.33 C
ATOM 3446 C PHE B 108 23.885 -4.598 7.376 1.00173.62 C
ATOM 3447 O PHE B 108 23.346 -4.294 8.441 1.00173.73 O
ATOM 3448 CB PHE B 108 22.928 -4.549 5.056 1.00173.58 C
ATOM 3449 CG PHE B 108 21.633 -5.137 5.531 1.00173.39 C
ATOM 3450 CD1 PHE B 108 20.502 -4.346 5.651 1.00172.44 C
ATOM 3451 CD2 PHE B 108 21.543 -6.481 5.855 1.00174.25 C
ATOM 3452 CE1 PHE B 108 19.309 -4.883 6.091 1.00173.25 C
ATOM 3453 CE2 PHE B 108 20.352 -7.024 6.294 1.00174.71 C
ATOM 3454 CZ PHE B 108 19.234 -6.224 6.413 1.00174.72 C
ATOM 3455 N LEU B 109 24.665 -5.667 7.231 1.00173.63 N
ATOM 3456 CA LEU B 109 25.012 -6.543 8.346 1.00173.70 C
ATOM 3457 C LEU B 109 25.630 -5.769 9.510 1.00173.76 C
ATOM 3458 O LEU B 109 25.295 -6.006 10.670 1.00174.18 O
ATOM 3459 CB LEU B 109 25.975 -7.639 7.880 1.00173.96 C
ATOM 3460 CG LEU B 109 25.476 -8.560 6.765 1.00174.10 C
ATOM 3461 CD1 LEU B 109 26.539 -9.588 6.405 1.00174.69 C
ATOM 3462 CD2 LEU B 109 24.176 -9.241 7.169 1.00173.64 C
ATOM 3463 N ALA B 110 26.528 -4.842 9.188 1.00173.72 N
ATOM 3464 CA ALA B 110 27.177 -4.004 10.192 1.00173.43 C
ATOM 3465 C ALA B 110 26.160 -3.152 10.945 1.00173.05 C
ATOM 3466 O ALA B 110 26.263 -2.972 12.158 1.00172.91 O
ATOM 3467 CB ALA B 110 28.230 -3.118 9.544 1.00173.68 C
ATOM 3468 N ALA B 111 25.187 -2.618 10.213 1.00172.94 N
ATOM 3469 CA ALA B 111 24.129 -1.810 10.810 1.00172.76 C
ATOM 3470 C ALA B 111 23.329 -2.621 11.823 1.00172.31 C
ATOM 3471 O ALA B 111 22.889 -2.099 12.846 1.00172.30 O
ATOM 3472 CB ALA B 111 23.213 -1.259 9.732 1.00173.28 C
ATOM 3473 N CYS B 112 23.149 -3.903 11.524 1.00171.96 N
ATOM 3474 CA CYS B 112 22.429 -4.812 12.404 1.00172.48 C
ATOM 3475 C CYS B 112 23.195 -5.066 13.698 1.00173.04 C
ATOM 3476 O CYS B 112 22.627 -5.002 14.787 1.00173.00 O
ATOM 3477 CB CYS B 112 22.154 -6.131 11.690 1.00172.66 C
ATOM 3478 SG CYS B 112 20.888 -6.007 10.412 1.00171.09 S
ATOM 3479 N TRP B 113 24.486 -5.358 13.565 1.00173.34 N
ATOM 3480 CA TRP B 113 25.348 -5.593 14.716 1.00173.69 C
ATOM 3481 C TRP B 113 25.348 -4.373 15.636 1.00173.69 C
ATOM 3482 O TRP B 113 25.153 -4.498 16.845 1.00173.36 O
ATOM 3483 CB TRP B 113 26.776 -5.929 14.264 1.00174.61 C
ATOM 3484 CG TRP B 113 27.675 -6.396 15.379 1.00174.62 C
ATOM 3485 CD1 TRP B 113 27.957 -7.688 15.717 1.00174.28 C
ATOM 3486 CD2 TRP B 113 28.409 -5.573 16.295 1.00174.97 C
ATOM 3487 NE1 TRP B 113 28.817 -7.722 16.787 1.00174.51 N
ATOM 3488 CE2 TRP B 113 29.111 -6.437 17.161 1.00174.67 C
ATOM 3489 CE3 TRP B 113 28.540 -4.192 16.469 1.00174.58 C
ATOM 3490 CZ2 TRP B 113 29.930 -5.964 18.185 1.00174.56 C
ATOM 3491 CZ3 TRP B 113 29.354 -3.725 17.486 1.00173.96 C
ATOM 3492 CH2 TRP B 113 30.037 -4.608 18.330 1.00174.11 C
ATOM 3493 N HIS B 114 25.560 -3.193 15.055 1.00173.52 N
ATOM 3494 CA HIS B 114 25.617 -1.953 15.826 1.00173.23 C
ATOM 3495 C HIS B 114 24.284 -1.562 16.432 1.00173.08 C
ATOM 3496 O HIS B 114 24.214 -0.692 17.301 1.00173.31 O
ATOM 3497 CB HIS B 114 26.106 -0.805 14.955 1.00172.81 C
ATOM 3498 CG HIS B 114 27.592 -0.709 14.879 1.00172.18 C
ATOM 3499 ND1 HIS B 114 28.366 -0.347 15.959 1.00172.10 N
ATOM 3500 CD2 HIS B 114 28.449 -0.933 13.857 1.00172.41 C
ATOM 3501 CE1 HIS B 114 29.638 -0.352 15.605 1.00172.22 C
ATOM 3502 NE2 HIS B 114 29.714 -0.700 14.334 1.00172.48 N
ATOM 3503 N TRP B 115 23.225 -2.209 15.976 1.00172.87 N
ATOM 3504 CA TRP B 115 21.909 -1.937 16.508 1.00173.41 C
ATOM 3505 C TRP B 115 21.683 -2.784 17.754 1.00174.33 C
ATOM 3506 O TRP B 115 21.248 -2.279 18.788 1.00174.90 O
ATOM 3507 CB TRP B 115 20.844 -2.212 15.454 1.00174.12 C
ATOM 3508 CG TRP B 115 19.471 -1.965 15.945 1.00174.77 C
ATOM 3509 CD1 TRP B 115 18.622 -2.878 16.490 1.00174.95 C
ATOM 3510 CD2 TRP B 115 18.775 -0.714 15.949 1.00175.02 C
ATOM 3511 NE1 TRP B 115 17.437 -2.275 16.833 1.00174.88 N
ATOM 3512 CE2 TRP B 115 17.505 -0.943 16.509 1.00174.67 C
ATOM 3513 CE3 TRP B 115 19.102 0.583 15.529 1.00175.23 C
ATOM 3514 CZ2 TRP B 115 16.562 0.066 16.665 1.00174.10 C
ATOM 3515 CZ3 TRP B 115 18.163 1.586 15.684 1.00175.04 C
ATOM 3516 CH2 TRP B 115 16.907 1.322 16.247 1.00174.68 C
ATOM 3517 N VAL B 116 21.999 -4.071 17.649 1.00174.29 N
ATOM 3518 CA VAL B 116 21.824 -5.001 18.761 1.00174.04 C
ATOM 3519 C VAL B 116 22.809 -4.697 19.892 1.00173.85 C
ATOM 3520 O VAL B 116 22.424 -4.639 21.061 1.00173.80 O
ATOM 3521 CB VAL B 116 21.994 -6.468 18.300 1.00173.41 C
ATOM 3522 CG1 VAL B 116 22.423 -7.351 19.456 1.00173.56 C
ATOM 3523 CG2 VAL B 116 20.702 -6.985 17.701 1.00172.22 C
ATOM 3524 N TYR B 117 24.073 -4.479 19.538 1.00173.20 N
ATOM 3525 CA TYR B 117 25.105 -4.163 20.523 1.00172.54 C
ATOM 3526 C TYR B 117 25.308 -2.657 20.635 1.00172.77 C
ATOM 3527 O TYR B 117 26.393 -2.140 20.370 1.00172.15 O
ATOM 3528 CB TYR B 117 26.418 -4.858 20.158 1.00172.48 C
ATOM 3529 CG TYR B 117 26.306 -6.363 20.144 1.00173.60 C
ATOM 3530 CD1 TYR B 117 26.139 -7.077 21.324 1.00174.62 C
ATOM 3531 CD2 TYR B 117 26.351 -7.072 18.953 1.00173.81 C
ATOM 3532 CE1 TYR B 117 26.029 -8.455 21.317 1.00174.62 C
ATOM 3533 CE2 TYR B 117 26.244 -8.449 18.935 1.00174.13 C
ATOM 3534 CZ TYR B 117 26.081 -9.136 20.119 1.00174.23 C
ATOM 3535 OH TYR B 117 25.973 -10.508 20.098 1.00174.01 O
ATOM 3536 N TRP B 118 24.247 -1.965 21.034 1.00173.78 N
ATOM 3537 CA TRP B 118 24.242 -0.509 21.114 1.00174.34 C
ATOM 3538 C TRP B 118 25.008 0.026 22.320 1.00174.44 C
ATOM 3539 O TRP B 118 25.589 1.111 22.263 1.00174.14 O
ATOM 3540 CB TRP B 118 22.801 0.002 21.164 1.00174.44 C
ATOM 3541 CG TRP B 118 22.053 -0.479 22.372 1.00174.93 C
ATOM 3542 CD1 TRP B 118 21.326 -1.628 22.482 1.00174.89 C
ATOM 3543 CD2 TRP B 118 21.966 0.173 23.646 1.00175.20 C
ATOM 3544 NE1 TRP B 118 20.790 -1.732 23.743 1.00175.15 N
ATOM 3545 CE2 TRP B 118 21.168 -0.640 24.477 1.00175.23 C
ATOM 3546 CE3 TRP B 118 22.483 1.366 24.163 1.00174.89 C
ATOM 3547 CZ2 TRP B 118 20.877 -0.298 25.797 1.00174.41 C
ATOM 3548 CZ3 TRP B 118 22.194 1.701 25.473 1.00175.06 C
ATOM 3549 CH2 TRP B 118 21.399 0.872 26.275 1.00174.54 C
ATOM 3550 N ASP B 119 25.010 -0.737 23.409 1.00174.83 N
ATOM 3551 CA ASP B 119 25.558 -0.253 24.671 1.00174.50 C
ATOM 3552 C ASP B 119 27.030 -0.604 24.831 1.00174.02 C
ATOM 3553 O ASP B 119 27.429 -1.225 25.815 1.00173.49 O
ATOM 3554 CB ASP B 119 24.757 -0.808 25.849 1.00174.71 C
ATOM 3555 CG ASP B 119 24.950 0.004 27.117 1.00174.82 C
ATOM 3556 OD1 ASP B 119 25.314 1.195 27.012 1.00173.41 O
ATOM 3557 OD2 ASP B 119 24.732 -0.547 28.217 1.00176.63 O
ATOM 3558 N LEU B 120 27.831 -0.203 23.851 1.00174.56 N
ATOM 3559 CA LEU B 120 29.274 -0.344 23.953 1.00174.97 C
ATOM 3560 C LEU B 120 29.807 0.694 24.935 1.00174.58 C
ATOM 3561 O LEU B 120 29.267 1.797 25.035 1.00174.09 O
ATOM 3562 CB LEU B 120 29.933 -0.184 22.582 1.00174.92 C
ATOM 3563 CG LEU B 120 29.414 -1.116 21.482 1.00174.57 C
ATOM 3564 CD1 LEU B 120 29.987 -0.731 20.125 1.00174.12 C
ATOM 3565 CD2 LEU B 120 29.723 -2.571 21.807 1.00174.68 C
ATOM 3566 N GLU B 121 30.858 0.330 25.663 1.00174.83 N
ATOM 3567 CA GLU B 121 31.440 1.207 26.673 1.00175.08 C
ATOM 3568 C GLU B 121 32.063 2.451 26.046 1.00175.43 C
ATOM 3569 O GLU B 121 32.121 3.508 26.675 1.00175.30 O
ATOM 3570 CB GLU B 121 32.479 0.442 27.509 1.00175.08 C
ATOM 3571 CG GLU B 121 33.739 0.008 26.754 1.00175.48 C
ATOM 3572 CD GLU B 121 34.816 1.077 26.721 1.00176.12 C
ATOM 3573 OE1 GLU B 121 35.121 1.653 27.785 1.00176.13 O
ATOM 3574 OE2 GLU B 121 35.358 1.337 25.625 1.00175.92 O
ATOM 3575 N LEU B 122 32.520 2.317 24.803 1.00175.33 N
ATOM 3576 CA LEU B 122 33.182 3.400 24.077 1.00174.54 C
ATOM 3577 C LEU B 122 32.351 4.682 24.019 1.00174.23 C
ATOM 3578 O LEU B 122 32.894 5.780 23.887 1.00173.64 O
ATOM 3579 CB LEU B 122 33.520 2.939 22.657 1.00174.21 C
ATOM 3580 CG LEU B 122 34.438 3.841 21.833 1.00174.35 C
ATOM 3581 CD1 LEU B 122 35.694 4.167 22.618 1.00173.41 C
ATOM 3582 CD2 LEU B 122 34.784 3.178 20.509 1.00174.51 C
ATOM 3583 N PHE B 123 31.036 4.536 24.130 1.00174.78 N
ATOM 3584 CA PHE B 123 30.122 5.666 24.030 1.00174.89 C
ATOM 3585 C PHE B 123 29.795 6.229 25.407 1.00174.51 C
ATOM 3586 O PHE B 123 29.155 7.272 25.527 1.00174.12 O
ATOM 3587 CB PHE B 123 28.840 5.243 23.310 1.00174.60 C
ATOM 3588 CG PHE B 123 29.086 4.512 22.022 1.00173.97 C
ATOM 3589 CD1 PHE B 123 30.050 4.956 21.132 1.00173.84 C
ATOM 3590 CD2 PHE B 123 28.361 3.376 21.706 1.00173.84 C
ATOM 3591 CE1 PHE B 123 30.282 4.284 19.948 1.00174.18 C
ATOM 3592 CE2 PHE B 123 28.589 2.699 20.523 1.00174.13 C
ATOM 3593 CZ PHE B 123 29.551 3.155 19.643 1.00174.46 C
ATOM 3594 N ARG B 124 30.243 5.529 26.443 1.00174.22 N
ATOM 3595 CA ARG B 124 30.036 5.970 27.816 1.00173.85 C
ATOM 3596 C ARG B 124 31.237 6.765 28.323 1.00173.82 C
ATOM 3597 O ARG B 124 32.382 6.338 28.173 1.00174.03 O
ATOM 3598 CB ARG B 124 29.772 4.770 28.730 1.00174.40 C
ATOM 3599 CG ARG B 124 28.426 4.095 28.502 1.00173.71 C
ATOM 3600 CD ARG B 124 27.281 4.977 28.981 1.00174.08 C
ATOM 3601 NE ARG B 124 25.955 4.432 28.686 1.00173.62 N
ATOM 3602 CZ ARG B 124 25.455 3.315 29.210 1.00173.55 C
ATOM 3603 NH1 ARG B 124 26.152 2.616 30.094 1.00175.05 N
ATOM 3604 NH2 ARG B 124 24.242 2.909 28.866 1.00173.05 N
ATOM 3605 N ASP B 125 30.970 7.926 28.912 1.00173.65 N
ATOM 3606 CA ASP B 125 32.024 8.765 29.473 1.00174.14 C
ATOM 3607 C ASP B 125 32.463 8.230 30.836 1.00175.03 C
ATOM 3608 O ASP B 125 31.635 8.065 31.730 1.00175.26 O
ATOM 3609 CB ASP B 125 31.543 10.215 29.594 1.00173.81 C
ATOM 3610 CG ASP B 125 32.582 11.128 30.215 1.00173.89 C
ATOM 3611 OD1 ASP B 125 33.735 11.136 29.736 1.00173.54 O
ATOM 3612 OD2 ASP B 125 32.244 11.840 31.184 1.00174.10 O
ATOM 3613 N PRO B 126 33.770 7.956 30.996 1.00175.17 N
ATOM 3614 CA PRO B 126 34.352 7.432 32.239 1.00174.45 C
ATOM 3615 C PRO B 126 33.964 8.245 33.471 1.00174.10 C
ATOM 3616 O PRO B 126 33.658 7.671 34.518 1.00174.37 O
ATOM 3617 CB PRO B 126 35.856 7.523 31.978 1.00174.20 C
ATOM 3618 CG PRO B 126 35.973 7.376 30.501 1.00174.61 C
ATOM 3619 CD PRO B 126 34.798 8.141 29.956 1.00174.62 C
ATOM 3620 N ARG B 127 33.985 9.567 33.339 1.00173.81 N
ATOM 3621 CA ARG B 127 33.602 10.467 34.422 1.00174.28 C
ATOM 3622 C ARG B 127 32.131 10.290 34.812 1.00174.82 C
ATOM 3623 O ARG B 127 31.828 9.752 35.878 1.00174.62 O
ATOM 3624 CB ARG B 127 33.899 11.921 34.019 1.00174.02 C
ATOM 3625 CG ARG B 127 33.172 13.016 34.812 1.00174.91 C
ATOM 3626 CD ARG B 127 33.344 12.896 36.322 1.00175.29 C
ATOM 3627 NE ARG B 127 32.385 13.746 37.025 1.00174.99 N
ATOM 3628 CZ ARG B 127 31.901 13.494 38.237 1.00175.40 C
ATOM 3629 NH1 ARG B 127 32.287 12.412 38.900 1.00175.51 N
ATOM 3630 NH2 ARG B 127 31.032 14.329 38.790 1.00175.31 N
ATOM 3631 N THR B 128 31.223 10.740 33.952 1.00175.15 N
ATOM 3632 CA THR B 128 29.806 10.789 34.297 1.00175.15 C
ATOM 3633 C THR B 128 29.113 9.424 34.241 1.00175.66 C
ATOM 3634 O THR B 128 28.015 9.261 34.772 1.00176.06 O
ATOM 3635 CB THR B 128 29.055 11.768 33.373 1.00174.91 C
ATOM 3636 OG1 THR B 128 29.379 11.480 32.007 1.00174.68 O
ATOM 3637 CG2 THR B 128 29.443 13.205 33.689 1.00174.52 C
ATOM 3638 N GLY B 129 29.752 8.448 33.602 1.00175.55 N
ATOM 3639 CA GLY B 129 29.175 7.120 33.476 1.00175.05 C
ATOM 3640 C GLY B 129 27.947 7.063 32.583 1.00175.58 C
ATOM 3641 O GLY B 129 27.262 6.041 32.519 1.00175.58 O
ATOM 3642 N GLU B 130 27.668 8.164 31.891 1.00175.22 N
ATOM 3643 CA GLU B 130 26.514 8.252 31.001 1.00175.11 C
ATOM 3644 C GLU B 130 26.980 8.478 29.559 1.00174.74 C
ATOM 3645 O GLU B 130 28.087 8.975 29.345 1.00174.03 O
ATOM 3646 CB GLU B 130 25.578 9.373 31.464 1.00174.92 C
ATOM 3647 CG GLU B 130 26.201 10.753 31.462 1.00175.52 C
ATOM 3648 CD GLU B 130 25.415 11.742 32.298 1.00176.22 C
ATOM 3649 OE1 GLU B 130 25.737 12.949 32.258 1.00176.79 O
ATOM 3650 OE2 GLU B 130 24.475 11.309 32.999 1.00176.26 O
ATOM 3651 N PRO B 131 26.148 8.101 28.567 1.00175.17 N
ATOM 3652 CA PRO B 131 26.519 8.229 27.151 1.00174.24 C
ATOM 3653 C PRO B 131 26.976 9.632 26.758 1.00174.01 C
ATOM 3654 O PRO B 131 26.314 10.615 27.094 1.00174.18 O
ATOM 3655 CB PRO B 131 25.226 7.858 26.414 1.00173.87 C
ATOM 3656 CG PRO B 131 24.138 8.016 27.432 1.00174.26 C
ATOM 3657 CD PRO B 131 24.778 7.578 28.708 1.00175.29 C
ATOM 3658 N ALA B 132 28.098 9.711 26.050 1.00173.97 N
ATOM 3659 CA ALA B 132 28.678 10.990 25.656 1.00174.13 C
ATOM 3660 C ALA B 132 29.679 10.813 24.516 1.00175.21 C
ATOM 3661 O ALA B 132 30.400 9.815 24.458 1.00175.45 O
ATOM 3662 CB ALA B 132 29.347 11.658 26.849 1.00173.69 C
ATOM 3663 N LEU B 133 29.712 11.786 23.609 1.00175.26 N
ATOM 3664 CA LEU B 133 30.644 11.765 22.484 1.00174.54 C
ATOM 3665 C LEU B 133 31.438 13.063 22.406 1.00173.90 C
ATOM 3666 O LEU B 133 30.862 14.150 22.349 1.00173.42 O
ATOM 3667 CB LEU B 133 29.902 11.529 21.166 1.00174.32 C
ATOM 3668 CG LEU B 133 29.176 10.198 20.970 1.00174.80 C
ATOM 3669 CD1 LEU B 133 28.307 10.247 19.723 1.00173.79 C
ATOM 3670 CD2 LEU B 133 30.170 9.049 20.889 1.00174.32 C
ATOM 3671 N ASP B 134 32.761 12.943 22.397 1.00173.71 N
ATOM 3672 CA ASP B 134 33.636 14.107 22.335 1.00174.32 C
ATOM 3673 C ASP B 134 33.742 14.615 20.900 1.00174.36 C
ATOM 3674 O ASP B 134 34.673 14.266 20.174 1.00175.38 O
ATOM 3675 CB ASP B 134 35.019 13.769 22.894 1.00174.61 C
ATOM 3676 CG ASP B 134 35.929 14.979 22.979 1.00174.93 C
ATOM 3677 OD1 ASP B 134 35.417 16.094 23.209 1.00175.76 O
ATOM 3678 OD2 ASP B 134 37.157 14.813 22.832 1.00173.98 O
ATOM 3679 N LEU B 135 32.767 15.427 20.503 1.00173.74 N
ATOM 3680 CA LEU B 135 32.696 15.985 19.152 1.00173.33 C
ATOM 3681 C LEU B 135 33.972 16.695 18.653 1.00173.09 C
ATOM 3682 O LEU B 135 34.432 16.394 17.551 1.00172.94 O
ATOM 3683 CB LEU B 135 31.501 16.944 19.054 1.00173.41 C
ATOM 3684 CG LEU B 135 30.128 16.368 19.400 1.00173.91 C
ATOM 3685 CD1 LEU B 135 29.119 17.484 19.597 1.00174.56 C
ATOM 3686 CD2 LEU B 135 29.660 15.420 18.311 1.00173.93 C
ATOM 3687 N PRO B 136 34.543 17.638 19.439 1.00173.06 N
ATOM 3688 CA PRO B 136 35.735 18.354 18.958 1.00173.28 C
ATOM 3689 C PRO B 136 36.890 17.460 18.493 1.00173.60 C
ATOM 3690 O PRO B 136 37.505 17.751 17.465 1.00172.81 O
ATOM 3691 CB PRO B 136 36.156 19.170 20.182 1.00173.64 C
ATOM 3692 CG PRO B 136 34.885 19.427 20.894 1.00173.72 C
ATOM 3693 CD PRO B 136 34.136 18.134 20.769 1.00173.65 C
ATOM 3694 N LYS B 137 37.178 16.395 19.235 1.00174.90 N
ATOM 3695 CA LYS B 137 38.280 15.507 18.878 1.00174.99 C
ATOM 3696 C LYS B 137 37.905 14.623 17.690 1.00175.23 C
ATOM 3697 O LYS B 137 38.744 14.338 16.834 1.00175.03 O
ATOM 3698 CB LYS B 137 38.697 14.639 20.069 1.00173.49 C
ATOM 3699 CG LYS B 137 40.126 14.110 19.971 1.00172.28 C
ATOM 3700 CD LYS B 137 40.418 13.063 21.034 1.00171.65 C
ATOM 3701 CE LYS B 137 40.084 13.570 22.425 1.00172.45 C
ATOM 3702 NZ LYS B 137 39.934 12.453 23.396 1.00173.24 N
ATOM 3703 N MET B 138 36.645 14.195 17.647 1.00175.15 N
ATOM 3704 CA MET B 138 36.139 13.403 16.528 1.00174.00 C
ATOM 3705 C MET B 138 36.330 14.125 15.205 1.00173.46 C
ATOM 3706 O MET B 138 36.869 13.560 14.251 1.00173.57 O
ATOM 3707 CB MET B 138 34.656 13.079 16.709 1.00173.23 C
ATOM 3708 CG MET B 138 34.365 11.897 17.603 1.00174.00 C
ATOM 3709 SD MET B 138 32.659 11.368 17.376 1.00173.43 S
ATOM 3710 CE MET B 138 31.782 12.555 18.381 1.00173.35 C
ATOM 3711 N PHE B 139 35.860 15.368 15.157 1.00173.14 N
ATOM 3712 CA PHE B 139 36.001 16.208 13.976 1.00173.73 C
ATOM 3713 C PHE B 139 37.445 16.237 13.498 1.00173.21 C
ATOM 3714 O PHE B 139 37.710 16.110 12.306 1.00173.58 O
ATOM 3715 CB PHE B 139 35.512 17.629 14.261 1.00174.40 C
ATOM 3716 CG PHE B 139 35.878 18.615 13.191 1.00174.00 C
ATOM 3717 CD1 PHE B 139 35.278 18.553 11.943 1.00173.70 C
ATOM 3718 CD2 PHE B 139 36.819 19.602 13.428 1.00173.58 C
ATOM 3719 CE1 PHE B 139 35.612 19.456 10.952 1.00173.40 C
ATOM 3720 CE2 PHE B 139 37.156 20.509 12.440 1.00173.05 C
ATOM 3721 CZ PHE B 139 36.552 20.433 11.202 1.00173.26 C
ATOM 3722 N GLY B 140 38.373 16.394 14.438 1.00172.57 N
ATOM 3723 CA GLY B 140 39.788 16.387 14.123 1.00173.19 C
ATOM 3724 C GLY B 140 40.219 15.089 13.471 1.00173.77 C
ATOM 3725 O GLY B 140 40.918 15.098 12.459 1.00174.27 O
ATOM 3726 N ILE B 141 39.801 13.973 14.060 1.00173.78 N
ATOM 3727 CA ILE B 141 40.095 12.651 13.515 1.00174.42 C
ATOM 3728 C ILE B 141 39.572 12.498 12.088 1.00174.22 C
ATOM 3729 O ILE B 141 40.330 12.184 11.170 1.00174.13 O
ATOM 3730 CB ILE B 141 39.498 11.535 14.394 1.00174.14 C
ATOM 3731 CG1 ILE B 141 40.093 11.594 15.803 1.00174.09 C
ATOM 3732 CG2 ILE B 141 39.742 10.170 13.764 1.00173.46 C
ATOM 3733 CD1 ILE B 141 39.653 10.461 16.702 1.00174.42 C
ATOM 3734 N HIS B 142 38.270 12.710 11.914 1.00174.01 N
ATOM 3735 CA HIS B 142 37.637 12.630 10.599 1.00173.49 C
ATOM 3736 C HIS B 142 38.287 13.565 9.584 1.00173.28 C
ATOM 3737 O HIS B 142 38.595 13.153 8.467 1.00173.38 O
ATOM 3738 CB HIS B 142 36.142 12.939 10.708 1.00173.58 C
ATOM 3739 CG HIS B 142 35.375 11.926 11.498 1.00174.32 C
ATOM 3740 ND1 HIS B 142 34.043 12.082 11.814 1.00174.52 N
ATOM 3741 CD2 HIS B 142 35.752 10.740 12.034 1.00174.28 C
ATOM 3742 CE1 HIS B 142 33.633 11.038 12.512 1.00174.26 C
ATOM 3743 NE2 HIS B 142 34.651 10.209 12.660 1.00174.07 N
ATOM 3744 N LEU B 143 38.482 14.822 9.973 1.00173.55 N
ATOM 3745 CA LEU B 143 39.102 15.814 9.099 1.00173.71 C
ATOM 3746 C LEU B 143 40.500 15.381 8.671 1.00173.83 C
ATOM 3747 O LEU B 143 40.929 15.657 7.549 1.00174.07 O
ATOM 3748 CB LEU B 143 39.169 17.176 9.793 1.00173.23 C
ATOM 3749 CG LEU B 143 39.814 18.327 9.021 1.00172.64 C
ATOM 3750 CD1 LEU B 143 39.117 18.521 7.683 1.00173.36 C
ATOM 3751 CD2 LEU B 143 39.782 19.608 9.840 1.00172.79 C
ATOM 3752 N PHE B 144 41.204 14.703 9.570 1.00173.51 N
ATOM 3753 CA PHE B 144 42.530 14.180 9.267 1.00173.59 C
ATOM 3754 C PHE B 144 42.427 13.095 8.204 1.00173.98 C
ATOM 3755 O PHE B 144 43.197 13.079 7.244 1.00174.40 O
ATOM 3756 CB PHE B 144 43.202 13.635 10.527 1.00173.81 C
ATOM 3757 CG PHE B 144 44.513 12.946 10.267 1.00174.58 C
ATOM 3758 CD1 PHE B 144 45.678 13.680 10.122 1.00174.40 C
ATOM 3759 CD2 PHE B 144 44.581 11.566 10.171 1.00176.03 C
ATOM 3760 CE1 PHE B 144 46.887 13.052 9.882 1.00175.19 C
ATOM 3761 CE2 PHE B 144 45.786 10.931 9.931 1.00177.09 C
ATOM 3762 CZ PHE B 144 46.941 11.675 9.787 1.00176.70 C
ATOM 3763 N LEU B 145 41.469 12.189 8.385 1.00173.51 N
ATOM 3764 CA LEU B 145 41.236 11.104 7.439 1.00173.48 C
ATOM 3765 C LEU B 145 40.788 11.633 6.083 1.00173.83 C
ATOM 3766 O LEU B 145 41.202 11.125 5.041 1.00173.65 O
ATOM 3767 CB LEU B 145 40.191 10.133 7.986 1.00172.67 C
ATOM 3768 CG LEU B 145 40.573 9.390 9.265 1.00173.10 C
ATOM 3769 CD1 LEU B 145 39.327 9.051 10.062 1.00173.54 C
ATOM 3770 CD2 LEU B 145 41.371 8.134 8.939 1.00172.73 C
ATOM 3771 N ALA B 146 39.929 12.647 6.110 1.00174.05 N
ATOM 3772 CA ALA B 146 39.426 13.272 4.891 1.00173.82 C
ATOM 3773 C ALA B 146 40.563 13.859 4.061 1.00173.69 C
ATOM 3774 O ALA B 146 40.724 13.518 2.892 1.00174.19 O
ATOM 3775 CB ALA B 146 38.408 14.349 5.230 1.00173.57 C
ATOM 3776 N GLY B 147 41.343 14.743 4.676 1.00173.49 N
ATOM 3777 CA GLY B 147 42.489 15.347 4.020 1.00173.75 C
ATOM 3778 C GLY B 147 43.516 14.330 3.556 1.00174.31 C
ATOM 3779 O GLY B 147 44.141 14.501 2.509 1.00174.52 O
ATOM 3780 N LEU B 148 43.692 13.272 4.342 1.00174.63 N
ATOM 3781 CA LEU B 148 44.612 12.195 3.995 1.00175.23 C
ATOM 3782 C LEU B 148 44.128 11.460 2.748 1.00175.47 C
ATOM 3783 O LEU B 148 44.923 11.087 1.884 1.00175.43 O
ATOM 3784 CB LEU B 148 44.761 11.216 5.162 1.00175.05 C
ATOM 3785 CG LEU B 148 45.662 9.994 4.962 1.00174.70 C
ATOM 3786 CD1 LEU B 148 47.031 10.410 4.439 1.00175.01 C
ATOM 3787 CD2 LEU B 148 45.791 9.197 6.253 1.00173.39 C
ATOM 3788 N LEU B 149 42.817 11.259 2.663 1.00175.38 N
ATOM 3789 CA LEU B 149 42.215 10.582 1.521 1.00174.93 C
ATOM 3790 C LEU B 149 42.118 11.538 0.336 1.00173.99 C
ATOM 3791 O LEU B 149 42.262 11.129 -0.819 1.00172.99 O
ATOM 3792 CB LEU B 149 40.833 10.034 1.889 1.00174.60 C
ATOM 3793 CG LEU B 149 40.132 9.150 0.855 1.00174.33 C
ATOM 3794 CD1 LEU B 149 40.971 7.921 0.528 1.00175.15 C
ATOM 3795 CD2 LEU B 149 38.741 8.748 1.332 1.00174.39 C
ATOM 3796 N CYS B 150 41.865 12.811 0.633 1.00174.39 N
ATOM 3797 CA CYS B 150 41.833 13.862 -0.382 1.00174.82 C
ATOM 3798 C CYS B 150 43.171 13.975 -1.101 1.00174.70 C
ATOM 3799 O CYS B 150 43.225 14.009 -2.332 1.00174.62 O
ATOM 3800 CB CYS B 150 41.465 15.208 0.249 1.00175.30 C
ATOM 3801 SG CYS B 150 41.297 16.571 -0.929 1.00175.23 S
ATOM 3802 N PHE B 151 44.244 14.053 -0.317 1.00174.82 N
ATOM 3803 CA PHE B 151 45.603 14.102 -0.845 1.00174.74 C
ATOM 3804 C PHE B 151 45.873 12.960 -1.821 1.00174.60 C
ATOM 3805 O PHE B 151 46.240 13.193 -2.971 1.00174.51 O
ATOM 3806 CB PHE B 151 46.622 14.067 0.296 1.00174.43 C
ATOM 3807 CG PHE B 151 48.043 13.922 -0.165 1.00174.42 C
ATOM 3808 CD1 PHE B 151 48.703 14.986 -0.757 1.00173.88 C
ATOM 3809 CD2 PHE B 151 48.721 12.723 -0.009 1.00174.69 C
ATOM 3810 CE1 PHE B 151 50.011 14.859 -1.185 1.00173.45 C
ATOM 3811 CE2 PHE B 151 50.029 12.589 -0.435 1.00175.04 C
ATOM 3812 CZ PHE B 151 50.676 13.659 -1.025 1.00174.14 C
ATOM 3813 N GLY B 152 45.690 11.730 -1.346 1.00174.10 N
ATOM 3814 CA GLY B 152 45.888 10.540 -2.154 1.00173.85 C
ATOM 3815 C GLY B 152 45.153 10.555 -3.481 1.00174.10 C
ATOM 3816 O GLY B 152 45.719 10.193 -4.513 1.00174.10 O
ATOM 3817 N PHE B 153 43.885 10.957 -3.447 1.00174.18 N
ATOM 3818 CA PHE B 153 43.064 11.049 -4.652 1.00174.49 C
ATOM 3819 C PHE B 153 43.699 11.971 -5.690 1.00174.38 C
ATOM 3820 O PHE B 153 43.781 11.635 -6.870 1.00174.43 O
ATOM 3821 CB PHE B 153 41.655 11.538 -4.308 1.00174.55 C
ATOM 3822 CG PHE B 153 40.771 11.731 -5.508 1.00174.32 C
ATOM 3823 CD1 PHE B 153 40.478 10.670 -6.348 1.00173.93 C
ATOM 3824 CD2 PHE B 153 40.236 12.975 -5.799 1.00174.02 C
ATOM 3825 CE1 PHE B 153 39.667 10.845 -7.453 1.00173.86 C
ATOM 3826 CE2 PHE B 153 39.425 13.158 -6.903 1.00173.90 C
ATOM 3827 CZ PHE B 153 39.140 12.090 -7.731 1.00174.16 C
ATOM 3828 N GLY B 154 44.142 13.141 -5.241 1.00174.24 N
ATOM 3829 CA GLY B 154 44.824 14.078 -6.113 1.00174.36 C
ATOM 3830 C GLY B 154 46.209 13.593 -6.497 1.00174.80 C
ATOM 3831 O GLY B 154 46.593 13.648 -7.665 1.00174.89 O
ATOM 3832 N ALA B 155 46.956 13.115 -5.506 1.00174.73 N
ATOM 3833 CA ALA B 155 48.347 12.707 -5.694 1.00174.52 C
ATOM 3834 C ALA B 155 48.529 11.487 -6.597 1.00174.38 C
ATOM 3835 O ALA B 155 49.400 11.481 -7.467 1.00174.35 O
ATOM 3836 CB ALA B 155 48.995 12.439 -4.341 1.00173.86 C
ATOM 3837 N PHE B 156 47.716 10.454 -6.393 1.00174.25 N
ATOM 3838 CA PHE B 156 47.937 9.184 -7.081 1.00174.10 C
ATOM 3839 C PHE B 156 46.934 8.883 -8.186 1.00174.40 C
ATOM 3840 O PHE B 156 47.310 8.408 -9.256 1.00174.43 O
ATOM 3841 CB PHE B 156 47.928 8.034 -6.073 1.00173.42 C
ATOM 3842 CG PHE B 156 48.966 8.164 -5.004 1.00174.23 C
ATOM 3843 CD1 PHE B 156 50.216 7.593 -5.168 1.00174.50 C
ATOM 3844 CD2 PHE B 156 48.700 8.864 -3.839 1.00174.69 C
ATOM 3845 CE1 PHE B 156 51.181 7.711 -4.190 1.00174.99 C
ATOM 3846 CE2 PHE B 156 49.662 8.985 -2.855 1.00175.19 C
ATOM 3847 CZ PHE B 156 50.904 8.409 -3.031 1.00175.14 C
ATOM 3848 N HIS B 157 45.662 9.151 -7.930 1.00174.71 N
ATOM 3849 CA HIS B 157 44.623 8.835 -8.904 1.00174.76 C
ATOM 3850 C HIS B 157 44.626 9.776 -10.106 1.00174.02 C
ATOM 3851 O HIS B 157 44.797 9.337 -11.242 1.00174.06 O
ATOM 3852 CB HIS B 157 43.250 8.849 -8.232 1.00174.87 C
ATOM 3853 CG HIS B 157 42.139 8.377 -9.118 1.00174.33 C
ATOM 3854 ND1 HIS B 157 41.561 7.136 -8.989 1.00173.68 N
ATOM 3855 CD2 HIS B 157 41.491 8.992 -10.136 1.00174.14 C
ATOM 3856 CE1 HIS B 157 40.608 6.998 -9.897 1.00173.27 C
ATOM 3857 NE2 HIS B 157 40.548 8.109 -10.605 1.00173.86 N
ATOM 3858 N LEU B 158 44.426 11.064 -9.852 1.00173.28 N
ATOM 3859 CA LEU B 158 44.331 12.050 -10.922 1.00172.86 C
ATOM 3860 C LEU B 158 45.636 12.214 -11.699 1.00173.44 C
ATOM 3861 O LEU B 158 45.619 12.474 -12.901 1.00174.07 O
ATOM 3862 CB LEU B 158 43.899 13.401 -10.352 1.00172.28 C
ATOM 3863 CG LEU B 158 42.559 13.408 -9.615 1.00172.63 C
ATOM 3864 CD1 LEU B 158 42.179 14.825 -9.224 1.00173.12 C
ATOM 3865 CD2 LEU B 158 41.473 12.774 -10.470 1.00173.13 C
ATOM 3866 N THR B 159 46.763 12.058 -11.013 1.00173.55 N
ATOM 3867 CA THR B 159 48.067 12.252 -11.644 1.00173.66 C
ATOM 3868 C THR B 159 48.467 11.072 -12.522 1.00172.66 C
ATOM 3869 O THR B 159 49.265 11.220 -13.447 1.00171.82 O
ATOM 3870 CB THR B 159 49.175 12.475 -10.599 1.00174.10 C
ATOM 3871 OG1 THR B 159 49.185 11.380 -9.677 1.00174.47 O
ATOM 3872 CG2 THR B 159 48.944 13.770 -9.840 1.00174.09 C
ATOM 3873 N GLY B 160 47.915 9.900 -12.231 1.00172.62 N
ATOM 3874 CA GLY B 160 48.255 8.707 -12.982 1.00172.78 C
ATOM 3875 C GLY B 160 49.379 7.920 -12.337 1.00173.86 C
ATOM 3876 O GLY B 160 49.726 6.835 -12.804 1.00174.16 O
ATOM 3877 N LEU B 161 49.961 8.486 -11.281 1.00174.71 N
ATOM 3878 CA LEU B 161 51.010 7.824 -10.504 1.00175.04 C
ATOM 3879 C LEU B 161 50.602 6.408 -10.118 1.00173.80 C
ATOM 3880 O LEU B 161 51.282 5.437 -10.452 1.00172.76 O
ATOM 3881 CB LEU B 161 51.334 8.630 -9.243 1.00175.21 C
ATOM 3882 CG LEU B 161 52.570 9.532 -9.274 1.00176.39 C
ATOM 3883 CD1 LEU B 161 52.414 10.633 -10.316 1.00175.80 C
ATOM 3884 CD2 LEU B 161 52.847 10.117 -7.897 1.00175.55 C
ATOM 3885 N PHE B 162 49.487 6.305 -9.405 1.00173.87 N
ATOM 3886 CA PHE B 162 48.903 5.013 -9.082 1.00174.30 C
ATOM 3887 C PHE B 162 47.400 5.093 -9.300 1.00174.21 C
ATOM 3888 O PHE B 162 46.614 4.980 -8.361 1.00173.55 O
ATOM 3889 CB PHE B 162 49.230 4.609 -7.643 1.00174.13 C
ATOM 3890 CG PHE B 162 48.814 3.207 -7.299 1.00174.27 C
ATOM 3891 CD1 PHE B 162 49.204 2.142 -8.095 1.00174.36 C
ATOM 3892 CD2 PHE B 162 48.038 2.952 -6.182 1.00174.31 C
ATOM 3893 CE1 PHE B 162 48.827 0.850 -7.783 1.00174.01 C
ATOM 3894 CE2 PHE B 162 47.658 1.663 -5.864 1.00174.63 C
ATOM 3895 CZ PHE B 162 48.054 0.610 -6.666 1.00174.66 C
ATOM 3896 N GLY B 163 47.012 5.307 -10.555 1.00174.41 N
ATOM 3897 CA GLY B 163 45.614 5.448 -10.917 1.00174.80 C
ATOM 3898 C GLY B 163 45.433 5.764 -12.390 1.00175.33 C
ATOM 3899 O GLY B 163 46.413 5.944 -13.114 1.00174.86 O
ATOM 3900 N PRO B 164 44.172 5.830 -12.844 1.00175.72 N
ATOM 3901 CA PRO B 164 43.804 6.077 -14.242 1.00174.95 C
ATOM 3902 C PRO B 164 43.987 7.530 -14.682 1.00174.53 C
ATOM 3903 O PRO B 164 44.548 7.779 -15.748 1.00174.28 O
ATOM 3904 CB PRO B 164 42.324 5.692 -14.274 1.00174.13 C
ATOM 3905 CG PRO B 164 41.848 6.009 -12.901 1.00174.13 C
ATOM 3906 CD PRO B 164 42.981 5.582 -12.010 1.00174.83 C
ATOM 3907 N GLY B 165 43.510 8.470 -13.873 1.00174.39 N
ATOM 3908 CA GLY B 165 43.500 9.872 -14.245 1.00173.77 C
ATOM 3909 C GLY B 165 42.081 10.404 -14.220 1.00173.66 C
ATOM 3910 O GLY B 165 41.302 10.064 -13.330 1.00173.85 O
ATOM 3911 N MET B 166 41.739 11.236 -15.197 1.00173.84 N
ATOM 3912 CA MET B 166 40.386 11.775 -15.301 1.00173.95 C
ATOM 3913 C MET B 166 40.044 12.113 -16.747 1.00173.70 C
ATOM 3914 O MET B 166 40.907 12.080 -17.623 1.00173.67 O
ATOM 3915 CB MET B 166 40.223 13.014 -14.418 1.00173.69 C
ATOM 3916 CG MET B 166 41.042 14.210 -14.864 1.00173.49 C
ATOM 3917 SD MET B 166 40.796 15.643 -13.801 1.00172.26 S
ATOM 3918 CE MET B 166 39.102 16.073 -14.198 1.00172.60 C
ATOM 3919 N TRP B 167 38.779 12.438 -16.993 1.00173.70 N
ATOM 3920 CA TRP B 167 38.325 12.761 -18.339 1.00173.24 C
ATOM 3921 C TRP B 167 38.831 14.126 -18.786 1.00172.78 C
ATOM 3922 O TRP B 167 38.611 15.134 -18.113 1.00172.10 O
ATOM 3923 CB TRP B 167 36.799 12.718 -18.415 1.00173.91 C
ATOM 3924 CG TRP B 167 36.276 12.711 -19.815 1.00173.62 C
ATOM 3925 CD1 TRP B 167 35.937 13.795 -20.569 1.00173.12 C
ATOM 3926 CD2 TRP B 167 36.039 11.561 -20.635 1.00174.10 C
ATOM 3927 NE1 TRP B 167 35.500 13.391 -21.808 1.00173.41 N
ATOM 3928 CE2 TRP B 167 35.553 12.024 -21.873 1.00173.98 C
ATOM 3929 CE3 TRP B 167 36.189 10.184 -20.441 1.00174.34 C
ATOM 3930 CZ2 TRP B 167 35.216 11.159 -22.913 1.00174.46 C
ATOM 3931 CZ3 TRP B 167 35.854 9.328 -21.474 1.00174.06 C
ATOM 3932 CH2 TRP B 167 35.373 9.817 -22.694 1.00174.09 C
ATOM 3933 N VAL B 168 39.503 14.149 -19.932 1.00173.03 N
ATOM 3934 CA VAL B 168 40.039 15.384 -20.494 1.00173.70 C
ATOM 3935 C VAL B 168 39.719 15.458 -21.981 1.00173.95 C
ATOM 3936 O VAL B 168 39.928 14.493 -22.714 1.00174.20 O
ATOM 3937 CB VAL B 168 41.563 15.485 -20.291 1.00174.57 C
ATOM 3938 CG1 VAL B 168 42.137 16.654 -21.081 1.00173.90 C
ATOM 3939 CG2 VAL B 168 41.896 15.625 -18.815 1.00175.78 C
ATOM 3940 N SER B 169 39.225 16.609 -22.426 1.00174.00 N
ATOM 3941 CA SER B 169 38.786 16.764 -23.808 1.00174.77 C
ATOM 3942 C SER B 169 39.293 18.054 -24.440 1.00174.25 C
ATOM 3943 O SER B 169 39.856 18.911 -23.763 1.00173.73 O
ATOM 3944 CB SER B 169 37.259 16.724 -23.884 1.00175.28 C
ATOM 3945 OG SER B 169 36.820 16.651 -25.230 1.00175.21 O
ATOM 3946 N ASP B 170 39.094 18.174 -25.749 1.00174.24 N
ATOM 3947 CA ASP B 170 39.445 19.383 -26.484 1.00173.80 C
ATOM 3948 C ASP B 170 38.411 20.475 -26.196 1.00174.11 C
ATOM 3949 O ASP B 170 37.394 20.205 -25.555 1.00174.10 O
ATOM 3950 CB ASP B 170 39.529 19.078 -27.986 1.00173.30 C
ATOM 3951 CG ASP B 170 38.281 18.408 -28.512 1.00173.19 C
ATOM 3952 OD1 ASP B 170 38.098 17.204 -28.240 1.00173.45 O
ATOM 3953 OD2 ASP B 170 37.486 19.084 -29.199 1.00172.90 O
ATOM 3954 N PRO B 171 38.654 21.714 -26.666 1.00174.46 N
ATOM 3955 CA PRO B 171 37.675 22.775 -26.399 1.00174.15 C
ATOM 3956 C PRO B 171 36.321 22.586 -27.080 1.00173.78 C
ATOM 3957 O PRO B 171 35.438 23.424 -26.896 1.00174.00 O
ATOM 3958 CB PRO B 171 38.371 24.022 -26.947 1.00173.27 C
ATOM 3959 CG PRO B 171 39.811 23.731 -26.772 1.00174.08 C
ATOM 3960 CD PRO B 171 39.931 22.279 -27.140 1.00174.67 C
ATOM 3961 N TYR B 172 36.156 21.516 -27.849 1.00173.39 N
ATOM 3962 CA TYR B 172 34.894 21.286 -28.539 1.00172.98 C
ATOM 3963 C TYR B 172 34.411 19.843 -28.421 1.00172.61 C
ATOM 3964 O TYR B 172 33.649 19.371 -29.264 1.00172.22 O
ATOM 3965 CB TYR B 172 35.034 21.679 -30.011 1.00173.25 C
ATOM 3966 CG TYR B 172 35.281 23.157 -30.213 1.00173.38 C
ATOM 3967 CD1 TYR B 172 34.225 24.057 -30.239 1.00173.25 C
ATOM 3968 CD2 TYR B 172 36.569 23.655 -30.355 1.00173.43 C
ATOM 3969 CE1 TYR B 172 34.441 25.407 -30.418 1.00172.97 C
ATOM 3970 CE2 TYR B 172 36.797 25.007 -30.532 1.00173.40 C
ATOM 3971 CZ TYR B 172 35.730 25.878 -30.561 1.00172.90 C
ATOM 3972 OH TYR B 172 35.947 27.226 -30.737 1.00172.32 O
ATOM 3973 N GLY B 173 34.838 19.167 -27.357 1.00173.12 N
ATOM 3974 CA GLY B 173 34.461 17.787 -27.091 1.00173.36 C
ATOM 3975 C GLY B 173 34.474 16.855 -28.289 1.00173.37 C
ATOM 3976 O GLY B 173 33.421 16.462 -28.788 1.00173.25 O
ATOM 3977 N LEU B 174 35.669 16.495 -28.749 1.00173.56 N
ATOM 3978 CA LEU B 174 35.809 15.622 -29.912 1.00173.43 C
ATOM 3979 C LEU B 174 36.839 14.521 -29.679 1.00173.21 C
ATOM 3980 O LEU B 174 36.776 13.461 -30.299 1.00173.47 O
ATOM 3981 CB LEU B 174 36.202 16.438 -31.147 1.00173.75 C
ATOM 3982 CG LEU B 174 35.286 17.596 -31.548 1.00173.83 C
ATOM 3983 CD1 LEU B 174 35.922 18.423 -32.657 1.00174.22 C
ATOM 3984 CD2 LEU B 174 33.919 17.086 -31.971 1.00173.70 C
ATOM 3985 N THR B 175 37.781 14.777 -28.777 1.00172.98 N
ATOM 3986 CA THR B 175 38.919 13.885 -28.574 1.00173.12 C
ATOM 3987 C THR B 175 38.867 13.225 -27.197 1.00173.24 C
ATOM 3988 O THR B 175 39.543 12.225 -26.951 1.00173.26 O
ATOM 3989 CB THR B 175 40.254 14.648 -28.726 1.00173.19 C
ATOM 3990 OG1 THR B 175 40.188 15.515 -29.863 1.00173.19 O
ATOM 3991 CG2 THR B 175 41.426 13.683 -28.886 1.00173.40 C
ATOM 3992 N GLY B 176 38.052 13.801 -26.317 1.00173.26 N
ATOM 3993 CA GLY B 176 37.933 13.398 -24.923 1.00173.52 C
ATOM 3994 C GLY B 176 38.150 11.947 -24.538 1.00173.89 C
ATOM 3995 O GLY B 176 37.684 11.030 -25.214 1.00173.72 O
ATOM 3996 N SER B 177 38.857 11.757 -23.427 1.00174.47 N
ATOM 3997 CA SER B 177 39.193 10.434 -22.917 1.00174.41 C
ATOM 3998 C SER B 177 39.777 10.550 -21.513 1.00173.84 C
ATOM 3999 O SER B 177 39.937 11.652 -20.990 1.00173.59 O
ATOM 4000 CB SER B 177 40.186 9.729 -23.845 1.00174.32 C
ATOM 4001 OG SER B 177 41.467 10.331 -23.778 1.00174.66 O
ATOM 4002 N VAL B 178 40.101 9.412 -20.911 1.00173.49 N
ATOM 4003 CA VAL B 178 40.724 9.408 -19.593 1.00173.59 C
ATOM 4004 C VAL B 178 42.237 9.529 -19.724 1.00174.07 C
ATOM 4005 O VAL B 178 42.883 8.701 -20.366 1.00174.04 O
ATOM 4006 CB VAL B 178 40.378 8.133 -18.804 1.00174.20 C
ATOM 4007 CG1 VAL B 178 41.174 8.079 -17.507 1.00174.18 C
ATOM 4008 CG2 VAL B 178 38.887 8.074 -18.524 1.00174.08 C
ATOM 4009 N GLN B 179 42.797 10.567 -19.112 1.00174.28 N
ATOM 4010 CA GLN B 179 44.229 10.829 -19.202 1.00174.91 C
ATOM 4011 C GLN B 179 44.792 11.321 -17.874 1.00175.01 C
ATOM 4012 O GLN B 179 44.111 12.027 -17.132 1.00174.64 O
ATOM 4013 CB GLN B 179 44.519 11.859 -20.295 1.00174.31 C
ATOM 4014 CG GLN B 179 44.332 11.343 -21.709 1.00174.19 C
ATOM 4015 CD GLN B 179 45.521 10.537 -22.187 1.00175.41 C
ATOM 4016 OE1 GLN B 179 46.657 11.010 -22.159 1.00176.04 O
ATOM 4017 NE2 GLN B 179 45.265 9.313 -22.637 1.00175.55 N
ATOM 4018 N PRO B 180 46.043 10.943 -17.569 1.00175.41 N
ATOM 4019 CA PRO B 180 46.734 11.432 -16.374 1.00174.53 C
ATOM 4020 C PRO B 180 46.973 12.936 -16.446 1.00173.75 C
ATOM 4021 O PRO B 180 47.531 13.422 -17.429 1.00173.41 O
ATOM 4022 CB PRO B 180 48.058 10.665 -16.400 1.00174.95 C
ATOM 4023 CG PRO B 180 47.754 9.428 -17.186 1.00175.25 C
ATOM 4024 CD PRO B 180 46.830 9.910 -18.262 1.00175.23 C
ATOM 4025 N VAL B 181 46.558 13.662 -15.414 1.00173.58 N
ATOM 4026 CA VAL B 181 46.699 15.111 -15.407 1.00173.50 C
ATOM 4027 C VAL B 181 47.733 15.583 -14.395 1.00173.23 C
ATOM 4028 O VAL B 181 47.673 15.235 -13.217 1.00173.52 O
ATOM 4029 CB VAL B 181 45.359 15.801 -15.101 1.00173.90 C
ATOM 4030 CG1 VAL B 181 45.511 17.314 -15.186 1.00173.80 C
ATOM 4031 CG2 VAL B 181 44.288 15.317 -16.060 1.00174.28 C
ATOM 4032 N ALA B 182 48.682 16.381 -14.869 1.00173.13 N
ATOM 4033 CA ALA B 182 49.697 16.955 -14.001 1.00173.30 C
ATOM 4034 C ALA B 182 49.115 18.144 -13.246 1.00173.06 C
ATOM 4035 O ALA B 182 48.283 18.875 -13.783 1.00172.71 O
ATOM 4036 CB ALA B 182 50.915 17.372 -14.810 1.00174.26 C
ATOM 4037 N PRO B 183 49.542 18.333 -11.989 1.00173.26 N
ATOM 4038 CA PRO B 183 49.065 19.434 -11.147 1.00173.39 C
ATOM 4039 C PRO B 183 49.340 20.812 -11.743 1.00173.01 C
ATOM 4040 O PRO B 183 49.996 20.926 -12.778 1.00172.90 O
ATOM 4041 CB PRO B 183 49.855 19.242 -9.850 1.00173.67 C
ATOM 4042 CG PRO B 183 50.147 17.784 -9.811 1.00174.26 C
ATOM 4043 CD PRO B 183 50.433 17.428 -11.241 1.00173.84 C
ATOM 4044 N GLU B 184 48.845 21.847 -11.074 1.00173.42 N
ATOM 4045 CA GLU B 184 48.982 23.214 -11.555 1.00173.84 C
ATOM 4046 C GLU B 184 48.800 24.193 -10.402 1.00174.22 C
ATOM 4047 O GLU B 184 47.677 24.513 -10.013 1.00174.69 O
ATOM 4048 CB GLU B 184 47.967 23.497 -12.666 1.00173.75 C
ATOM 4049 CG GLU B 184 47.935 24.938 -13.164 1.00173.83 C
ATOM 4050 CD GLU B 184 49.190 25.341 -13.915 1.00173.99 C
ATOM 4051 OE1 GLU B 184 50.238 25.547 -13.267 1.00174.23 O
ATOM 4052 OE2 GLU B 184 49.125 25.452 -15.156 1.00173.87 O
ATOM 4053 N TRP B 185 49.917 24.661 -9.856 1.00174.02 N
ATOM 4054 CA TRP B 185 49.888 25.535 -8.690 1.00173.92 C
ATOM 4055 C TRP B 185 49.952 27.000 -9.099 1.00173.43 C
ATOM 4056 O TRP B 185 49.847 27.893 -8.261 1.00173.91 O
ATOM 4057 CB TRP B 185 51.043 25.200 -7.744 1.00174.31 C
ATOM 4058 CG TRP B 185 51.041 23.776 -7.283 1.00174.48 C
ATOM 4059 CD1 TRP B 185 50.312 23.248 -6.257 1.00174.14 C
ATOM 4060 CD2 TRP B 185 51.800 22.695 -7.835 1.00174.66 C
ATOM 4061 NE1 TRP B 185 50.574 21.904 -6.134 1.00173.54 N
ATOM 4062 CE2 TRP B 185 51.484 21.540 -7.091 1.00174.58 C
ATOM 4063 CE3 TRP B 185 52.718 22.591 -8.885 1.00174.48 C
ATOM 4064 CZ2 TRP B 185 52.054 20.298 -7.363 1.00174.85 C
ATOM 4065 CZ3 TRP B 185 53.281 21.357 -9.154 1.00174.53 C
ATOM 4066 CH2 TRP B 185 52.948 20.227 -8.396 1.00175.16 C
ATOM 4067 N GLY B 186 50.126 27.241 -10.394 1.00172.48 N
ATOM 4068 CA GLY B 186 50.122 28.593 -10.923 1.00172.75 C
ATOM 4069 C GLY B 186 48.767 29.269 -10.811 1.00173.31 C
ATOM 4070 O GLY B 186 47.834 28.715 -10.232 1.00173.75 O
ATOM 4071 N PRO B 187 48.650 30.479 -11.377 1.00173.84 N
ATOM 4072 CA PRO B 187 47.404 31.251 -11.346 1.00173.83 C
ATOM 4073 C PRO B 187 46.293 30.597 -12.163 1.00173.65 C
ATOM 4074 O PRO B 187 45.132 30.629 -11.760 1.00173.85 O
ATOM 4075 CB PRO B 187 47.815 32.594 -11.953 1.00174.35 C
ATOM 4076 CG PRO B 187 48.982 32.270 -12.821 1.00175.04 C
ATOM 4077 CD PRO B 187 49.727 31.205 -12.071 1.00174.62 C
ATOM 4078 N ASP B 188 46.656 30.015 -13.302 1.00173.45 N
ATOM 4079 CA ASP B 188 45.698 29.351 -14.179 1.00173.99 C
ATOM 4080 C ASP B 188 45.119 28.081 -13.542 1.00174.64 C
ATOM 4081 O ASP B 188 44.226 27.450 -14.103 1.00175.20 O
ATOM 4082 CB ASP B 188 46.364 29.022 -15.522 1.00174.33 C
ATOM 4083 CG ASP B 188 45.383 28.492 -16.551 1.00174.44 C
ATOM 4084 OD1 ASP B 188 44.674 29.308 -17.174 1.00173.64 O
ATOM 4085 OD2 ASP B 188 45.327 27.259 -16.744 1.00174.99 O
ATOM 4086 N GLY B 189 45.618 27.714 -12.365 1.00174.88 N
ATOM 4087 CA GLY B 189 45.130 26.533 -11.675 1.00174.73 C
ATOM 4088 C GLY B 189 43.832 26.776 -10.928 1.00174.18 C
ATOM 4089 O GLY B 189 43.250 25.860 -10.352 1.00173.15 O
ATOM 4090 N PHE B 190 43.371 28.021 -10.941 1.00174.60 N
ATOM 4091 CA PHE B 190 42.099 28.365 -10.322 1.00174.39 C
ATOM 4092 C PHE B 190 41.059 28.578 -11.409 1.00174.66 C
ATOM 4093 O PHE B 190 39.979 29.120 -11.167 1.00174.38 O
ATOM 4094 CB PHE B 190 42.245 29.601 -9.434 1.00173.96 C
ATOM 4095 CG PHE B 190 42.984 29.333 -8.155 1.00173.66 C
ATOM 4096 CD1 PHE B 190 44.366 29.261 -8.143 1.00174.04 C
ATOM 4097 CD2 PHE B 190 42.296 29.126 -6.972 1.00173.93 C
ATOM 4098 CE1 PHE B 190 45.052 29.004 -6.972 1.00174.33 C
ATOM 4099 CE2 PHE B 190 42.975 28.869 -5.796 1.00174.99 C
ATOM 4100 CZ PHE B 190 44.356 28.808 -5.798 1.00175.19 C
ATOM 4101 N ASN B 191 41.411 28.150 -12.617 1.00175.09 N
ATOM 4102 CA ASN B 191 40.492 28.148 -13.746 1.00174.61 C
ATOM 4103 C ASN B 191 39.621 26.898 -13.704 1.00174.66 C
ATOM 4104 O ASN B 191 40.138 25.781 -13.704 1.00174.66 O
ATOM 4105 CB ASN B 191 41.264 28.215 -15.065 1.00174.56 C
ATOM 4106 CG ASN B 191 40.362 28.411 -16.271 1.00174.37 C
ATOM 4107 OD1 ASN B 191 39.377 27.696 -16.460 1.00173.76 O
ATOM 4108 ND2 ASN B 191 40.709 29.381 -17.102 1.00174.79 N
ATOM 4109 N PRO B 192 38.295 27.082 -13.665 1.00173.90 N
ATOM 4110 CA PRO B 192 37.334 25.973 -13.632 1.00173.78 C
ATOM 4111 C PRO B 192 37.482 25.019 -14.819 1.00173.06 C
ATOM 4112 O PRO B 192 37.164 23.836 -14.700 1.00172.74 O
ATOM 4113 CB PRO B 192 35.981 26.689 -13.676 1.00173.66 C
ATOM 4114 CG PRO B 192 36.279 28.011 -14.317 1.00173.38 C
ATOM 4115 CD PRO B 192 37.615 28.384 -13.759 1.00172.65 C
ATOM 4116 N TYR B 193 37.951 25.537 -15.951 1.00173.02 N
ATOM 4117 CA TYR B 193 38.078 24.742 -17.167 1.00173.45 C
ATOM 4118 C TYR B 193 39.470 24.137 -17.333 1.00173.53 C
ATOM 4119 O TYR B 193 39.796 23.604 -18.392 1.00173.88 O
ATOM 4120 CB TYR B 193 37.736 25.594 -18.389 1.00173.89 C
ATOM 4121 CG TYR B 193 36.317 26.117 -18.385 1.00174.29 C
ATOM 4122 CD1 TYR B 193 35.246 25.278 -18.661 1.00174.52 C
ATOM 4123 CD2 TYR B 193 36.049 27.450 -18.101 1.00174.26 C
ATOM 4124 CE1 TYR B 193 33.946 25.751 -18.654 1.00174.56 C
ATOM 4125 CE2 TYR B 193 34.753 27.932 -18.092 1.00174.16 C
ATOM 4126 CZ TYR B 193 33.707 27.078 -18.370 1.00174.00 C
ATOM 4127 OH TYR B 193 32.416 27.554 -18.361 1.00173.14 O
ATOM 4128 N ASN B 194 40.290 24.217 -16.290 1.00172.82 N
ATOM 4129 CA ASN B 194 41.628 23.639 -16.336 1.00172.15 C
ATOM 4130 C ASN B 194 41.770 22.454 -15.387 1.00172.57 C
ATOM 4131 O ASN B 194 41.717 22.620 -14.169 1.00173.32 O
ATOM 4132 CB ASN B 194 42.684 24.697 -16.012 1.00172.47 C
ATOM 4133 CG ASN B 194 44.099 24.159 -16.123 1.00172.93 C
ATOM 4134 OD1 ASN B 194 44.602 23.506 -15.209 1.00173.27 O
ATOM 4135 ND2 ASN B 194 44.748 24.430 -17.248 1.00173.77 N
ATOM 4136 N PRO B 195 41.947 21.251 -15.952 1.00172.49 N
ATOM 4137 CA PRO B 195 42.077 19.986 -15.221 1.00173.78 C
ATOM 4138 C PRO B 195 43.194 19.999 -14.182 1.00174.61 C
ATOM 4139 O PRO B 195 43.031 19.428 -13.103 1.00174.74 O
ATOM 4140 CB PRO B 195 42.388 18.981 -16.333 1.00173.87 C
ATOM 4141 CG PRO B 195 41.741 19.564 -17.539 1.00173.46 C
ATOM 4142 CD PRO B 195 41.993 21.038 -17.409 1.00172.69 C
ATOM 4143 N GLY B 196 44.313 20.636 -14.517 1.00174.54 N
ATOM 4144 CA GLY B 196 45.440 20.759 -13.610 1.00174.26 C
ATOM 4145 C GLY B 196 45.075 21.355 -12.264 1.00174.15 C
ATOM 4146 O GLY B 196 45.681 21.025 -11.244 1.00174.01 O
ATOM 4147 N GLY B 197 44.078 22.235 -12.262 1.00174.15 N
ATOM 4148 CA GLY B 197 43.619 22.867 -11.041 1.00173.41 C
ATOM 4149 C GLY B 197 42.862 21.922 -10.128 1.00174.04 C
ATOM 4150 O GLY B 197 42.892 22.070 -8.907 1.00174.43 O
ATOM 4151 N VAL B 198 42.183 20.949 -10.726 1.00174.02 N
ATOM 4152 CA VAL B 198 41.439 19.954 -9.964 1.00174.27 C
ATOM 4153 C VAL B 198 42.409 19.024 -9.237 1.00173.99 C
ATOM 4154 O VAL B 198 42.122 18.532 -8.144 1.00173.80 O
ATOM 4155 CB VAL B 198 40.505 19.133 -10.876 1.00173.79 C
ATOM 4156 CG1 VAL B 198 39.712 18.119 -10.066 1.00174.96 C
ATOM 4157 CG2 VAL B 198 39.567 20.056 -11.634 1.00172.92 C
ATOM 4158 N VAL B 199 43.569 18.809 -9.846 1.00173.66 N
ATOM 4159 CA VAL B 199 44.597 17.956 -9.267 1.00173.68 C
ATOM 4160 C VAL B 199 45.310 18.662 -8.118 1.00174.68 C
ATOM 4161 O VAL B 199 45.327 18.163 -6.990 1.00174.63 O
ATOM 4162 CB VAL B 199 45.632 17.527 -10.321 1.00173.44 C
ATOM 4163 CG1 VAL B 199 46.600 16.523 -9.725 1.00173.70 C
ATOM 4164 CG2 VAL B 199 44.936 16.949 -11.548 1.00172.95 C
ATOM 4165 N ALA B 200 45.909 19.812 -8.423 1.00175.26 N
ATOM 4166 CA ALA B 200 46.587 20.655 -7.435 1.00175.30 C
ATOM 4167 C ALA B 200 45.730 20.898 -6.196 1.00174.93 C
ATOM 4168 O ALA B 200 46.232 20.873 -5.073 1.00174.84 O
ATOM 4169 CB ALA B 200 46.987 21.985 -8.062 1.00175.12 C
ATOM 4170 N HIS B 201 44.443 21.153 -6.409 1.00174.35 N
ATOM 4171 CA HIS B 201 43.498 21.352 -5.314 1.00173.70 C
ATOM 4172 C HIS B 201 43.547 20.237 -4.275 1.00174.19 C
ATOM 4173 O HIS B 201 43.857 20.478 -3.111 1.00174.40 O
ATOM 4174 CB HIS B 201 42.075 21.474 -5.848 1.00172.78 C
ATOM 4175 CG HIS B 201 41.023 21.283 -4.800 1.00172.31 C
ATOM 4176 ND1 HIS B 201 40.350 20.093 -4.638 1.00173.46 N
ATOM 4177 CD2 HIS B 201 40.538 22.124 -3.856 1.00172.32 C
ATOM 4178 CE1 HIS B 201 39.490 20.209 -3.640 1.00173.75 C
ATOM 4179 NE2 HIS B 201 39.585 21.431 -3.150 1.00173.10 N
ATOM 4180 N HIS B 202 43.223 19.023 -4.708 1.00174.09 N
ATOM 4181 CA HIS B 202 43.106 17.881 -3.809 1.00174.01 C
ATOM 4182 C HIS B 202 44.417 17.562 -3.115 1.00173.77 C
ATOM 4183 O HIS B 202 44.438 16.969 -2.037 1.00173.50 O
ATOM 4184 CB HIS B 202 42.630 16.655 -4.579 1.00174.02 C
ATOM 4185 CG HIS B 202 41.216 16.755 -5.051 1.00174.19 C
ATOM 4186 ND1 HIS B 202 40.840 17.552 -6.110 1.00174.10 N
ATOM 4187 CD2 HIS B 202 40.085 16.157 -4.608 1.00173.74 C
ATOM 4188 CE1 HIS B 202 39.537 17.438 -6.302 1.00173.98 C
ATOM 4189 NE2 HIS B 202 39.056 16.598 -5.403 1.00173.28 N
ATOM 4190 N ILE B 203 45.513 17.966 -3.740 1.00174.02 N
ATOM 4191 CA ILE B 203 46.824 17.796 -3.144 1.00174.58 C
ATOM 4192 C ILE B 203 47.056 18.869 -2.088 1.00174.87 C
ATOM 4193 O ILE B 203 47.436 18.567 -0.958 1.00174.71 O
ATOM 4194 CB ILE B 203 47.931 17.859 -4.204 1.00175.20 C
ATOM 4195 CG1 ILE B 203 47.750 16.732 -5.226 1.00174.65 C
ATOM 4196 CG2 ILE B 203 49.299 17.790 -3.548 1.00176.08 C
ATOM 4197 CD1 ILE B 203 48.675 16.826 -6.417 1.00174.33 C
ATOM 4198 N ALA B 204 46.807 20.122 -2.457 1.00174.85 N
ATOM 4199 CA ALA B 204 46.979 21.244 -1.539 1.00174.77 C
ATOM 4200 C ALA B 204 45.959 21.209 -0.404 1.00174.97 C
ATOM 4201 O ALA B 204 46.329 21.215 0.772 1.00174.93 O
ATOM 4202 CB ALA B 204 46.885 22.562 -2.296 1.00173.73 C
ATOM 4203 N ALA B 205 44.678 21.176 -0.762 1.00174.72 N
ATOM 4204 CA ALA B 205 43.600 21.098 0.223 1.00174.64 C
ATOM 4205 C ALA B 205 43.724 19.843 1.082 1.00174.67 C
ATOM 4206 O ALA B 205 43.380 19.852 2.265 1.00174.18 O
ATOM 4207 CB ALA B 205 42.244 21.134 -0.467 1.00174.16 C
ATOM 4208 N GLY B 206 44.214 18.765 0.476 1.00174.48 N
ATOM 4209 CA GLY B 206 44.446 17.525 1.192 1.00173.92 C
ATOM 4210 C GLY B 206 45.454 17.710 2.308 1.00174.04 C
ATOM 4211 O GLY B 206 45.196 17.339 3.452 1.00174.12 O
ATOM 4212 N ILE B 207 46.600 18.295 1.972 1.00174.24 N
ATOM 4213 CA ILE B 207 47.652 18.564 2.948 1.00174.72 C
ATOM 4214 C ILE B 207 47.155 19.491 4.051 1.00174.89 C
ATOM 4215 O ILE B 207 47.339 19.214 5.238 1.00175.33 O
ATOM 4216 CB ILE B 207 48.891 19.191 2.284 1.00174.18 C
ATOM 4217 CG1 ILE B 207 49.542 18.189 1.328 1.00174.30 C
ATOM 4218 CG2 ILE B 207 49.893 19.635 3.335 1.00174.52 C
ATOM 4219 CD1 ILE B 207 50.747 18.732 0.601 1.00173.70 C
ATOM 4220 N VAL B 208 46.536 20.596 3.649 1.00174.15 N
ATOM 4221 CA VAL B 208 45.922 21.522 4.592 1.00173.93 C
ATOM 4222 C VAL B 208 44.907 20.794 5.474 1.00174.39 C
ATOM 4223 O VAL B 208 44.816 21.050 6.677 1.00174.89 O
ATOM 4224 CB VAL B 208 45.244 22.695 3.855 1.00172.73 C
ATOM 4225 CG1 VAL B 208 44.375 23.500 4.804 1.00173.12 C
ATOM 4226 CG2 VAL B 208 46.293 23.585 3.217 1.00172.22 C
ATOM 4227 N GLY B 209 44.169 19.862 4.875 1.00173.94 N
ATOM 4228 CA GLY B 209 43.200 19.065 5.605 1.00173.75 C
ATOM 4229 C GLY B 209 43.861 18.143 6.610 1.00173.67 C
ATOM 4230 O GLY B 209 43.326 17.900 7.692 1.00173.49 O
ATOM 4231 N ILE B 210 45.033 17.630 6.248 1.00173.88 N
ATOM 4232 CA ILE B 210 45.809 16.782 7.144 1.00173.56 C
ATOM 4233 C ILE B 210 46.320 17.593 8.329 1.00173.01 C
ATOM 4234 O ILE B 210 46.202 17.172 9.480 1.00173.59 O
ATOM 4235 CB ILE B 210 47.001 16.124 6.420 1.00173.55 C
ATOM 4236 CG1 ILE B 210 46.508 15.164 5.335 1.00173.76 C
ATOM 4237 CG2 ILE B 210 47.882 15.379 7.406 1.00174.25 C
ATOM 4238 CD1 ILE B 210 47.612 14.362 4.678 1.00173.36 C
ATOM 4239 N ILE B 211 46.885 18.761 8.038 1.00171.87 N
ATOM 4240 CA ILE B 211 47.371 19.670 9.070 1.00172.14 C
ATOM 4241 C ILE B 211 46.243 20.111 9.998 1.00172.54 C
ATOM 4242 O ILE B 211 46.335 19.948 11.215 1.00173.25 O
ATOM 4243 CB ILE B 211 48.035 20.915 8.458 1.00172.50 C
ATOM 4244 CG1 ILE B 211 49.318 20.529 7.720 1.00173.11 C
ATOM 4245 CG2 ILE B 211 48.327 21.947 9.534 1.00173.16 C
ATOM 4246 CD1 ILE B 211 49.926 21.658 6.918 1.00173.39 C
ATOM 4247 N ALA B 212 45.194 20.687 9.415 1.00172.56 N
ATOM 4248 CA ALA B 212 44.012 21.115 10.164 1.00173.20 C
ATOM 4249 C ALA B 212 43.462 20.001 11.050 1.00174.01 C
ATOM 4250 O ALA B 212 43.019 20.251 12.171 1.00174.57 O
ATOM 4251 CB ALA B 212 42.934 21.603 9.212 1.00173.84 C
ATOM 4252 N GLY B 213 43.485 18.776 10.532 1.00174.10 N
ATOM 4253 CA GLY B 213 43.025 17.617 11.275 1.00174.58 C
ATOM 4254 C GLY B 213 43.814 17.411 12.552 1.00174.39 C
ATOM 4255 O GLY B 213 43.238 17.357 13.640 1.00174.38 O
ATOM 4256 N LEU B 214 45.133 17.296 12.412 1.00174.00 N
ATOM 4257 CA LEU B 214 46.037 17.145 13.549 1.00173.68 C
ATOM 4258 C LEU B 214 45.810 18.217 14.609 1.00174.22 C
ATOM 4259 O LEU B 214 45.808 17.923 15.803 1.00174.91 O
ATOM 4260 CB LEU B 214 47.492 17.175 13.082 1.00173.32 C
ATOM 4261 CG LEU B 214 47.945 15.984 12.237 1.00173.12 C
ATOM 4262 CD1 LEU B 214 49.374 16.182 11.753 1.00173.55 C
ATOM 4263 CD2 LEU B 214 47.809 14.687 13.023 1.00173.24 C
ATOM 4264 N PHE B 215 45.628 19.457 14.163 1.00173.79 N
ATOM 4265 CA PHE B 215 45.353 20.580 15.058 1.00174.08 C
ATOM 4266 C PHE B 215 44.156 20.296 15.967 1.00174.56 C
ATOM 4267 O PHE B 215 44.272 20.344 17.191 1.00174.84 O
ATOM 4268 CB PHE B 215 45.117 21.864 14.248 1.00173.63 C
ATOM 4269 CG PHE B 215 44.802 23.069 15.092 1.00174.05 C
ATOM 4270 CD1 PHE B 215 45.817 23.891 15.555 1.00174.94 C
ATOM 4271 CD2 PHE B 215 43.492 23.377 15.430 1.00173.61 C
ATOM 4272 CE1 PHE B 215 45.531 24.996 16.336 1.00175.30 C
ATOM 4273 CE2 PHE B 215 43.203 24.480 16.211 1.00173.51 C
ATOM 4274 CZ PHE B 215 44.225 25.287 16.666 1.00174.59 C
ATOM 4275 N HIS B 216 43.008 20.003 15.360 1.00174.71 N
ATOM 4276 CA HIS B 216 41.766 19.765 16.098 1.00174.32 C
ATOM 4277 C HIS B 216 41.790 18.501 16.946 1.00173.94 C
ATOM 4278 O HIS B 216 40.915 18.291 17.788 1.00173.69 O
ATOM 4279 CB HIS B 216 40.596 19.708 15.125 1.00174.37 C
ATOM 4280 CG HIS B 216 40.395 20.985 14.379 1.00174.21 C
ATOM 4281 ND1 HIS B 216 40.895 21.194 13.112 1.00174.09 N
ATOM 4282 CD2 HIS B 216 39.785 22.136 14.740 1.00173.04 C
ATOM 4283 CE1 HIS B 216 40.580 22.414 12.716 1.00173.38 C
ATOM 4284 NE2 HIS B 216 39.908 23.005 13.686 1.00172.78 N
ATOM 4285 N ILE B 217 42.791 17.660 16.721 1.00174.29 N
ATOM 4286 CA ILE B 217 42.982 16.485 17.551 1.00174.87 C
ATOM 4287 C ILE B 217 43.723 16.895 18.818 1.00175.13 C
ATOM 4288 O ILE B 217 43.477 16.358 19.899 1.00176.15 O
ATOM 4289 CB ILE B 217 43.760 15.382 16.803 1.00174.42 C
ATOM 4290 CG1 ILE B 217 42.971 14.922 15.576 1.00174.03 C
ATOM 4291 CG2 ILE B 217 44.041 14.196 17.714 1.00174.62 C
ATOM 4292 CD1 ILE B 217 43.573 13.732 14.863 1.00173.53 C
ATOM 4293 N LEU B 218 44.597 17.887 18.684 1.00174.44 N
ATOM 4294 CA LEU B 218 45.436 18.316 19.798 1.00174.27 C
ATOM 4295 C LEU B 218 44.832 19.497 20.551 1.00174.40 C
ATOM 4296 O LEU B 218 44.431 19.364 21.708 1.00175.34 O
ATOM 4297 CB LEU B 218 46.838 18.679 19.300 1.00173.45 C
ATOM 4298 CG LEU B 218 47.570 17.634 18.455 1.00173.46 C
ATOM 4299 CD1 LEU B 218 48.962 18.122 18.085 1.00172.69 C
ATOM 4300 CD2 LEU B 218 47.636 16.302 19.184 1.00173.68 C
ATOM 4301 N VAL B 219 44.773 20.652 19.895 1.00174.08 N
ATOM 4302 CA VAL B 219 44.230 21.858 20.513 1.00174.24 C
ATOM 4303 C VAL B 219 42.739 21.719 20.807 1.00174.33 C
ATOM 4304 O VAL B 219 41.964 21.286 19.955 1.00174.56 O
ATOM 4305 CB VAL B 219 44.464 23.092 19.618 1.00173.91 C
ATOM 4306 CG1 VAL B 219 43.872 24.341 20.255 1.00173.44 C
ATOM 4307 CG2 VAL B 219 45.954 23.277 19.362 1.00173.82 C
ATOM 4308 N ARG B 220 42.345 22.098 22.018 1.00174.09 N
ATOM 4309 CA ARG B 220 40.953 21.999 22.439 1.00173.67 C
ATOM 4310 C ARG B 220 40.202 23.288 22.120 1.00173.22 C
ATOM 4311 O ARG B 220 40.810 24.353 22.017 1.00173.55 O
ATOM 4312 CB ARG B 220 40.877 21.688 23.937 1.00174.50 C
ATOM 4313 CG ARG B 220 41.503 20.356 24.324 1.00175.09 C
ATOM 4314 CD ARG B 220 40.783 19.189 23.670 1.00174.73 C
ATOM 4315 NE ARG B 220 39.377 19.132 24.057 1.00174.59 N
ATOM 4316 CZ ARG B 220 38.553 18.142 23.732 1.00174.18 C
ATOM 4317 NH1 ARG B 220 37.289 18.173 24.132 1.00174.75 N
ATOM 4318 NH2 ARG B 220 38.992 17.121 23.008 1.00173.30 N
ATOM 4319 N PRO B 221 38.873 23.198 21.952 1.00172.91 N
ATOM 4320 CA PRO B 221 38.069 24.380 21.630 1.00173.85 C
ATOM 4321 C PRO B 221 37.975 25.373 22.788 1.00174.20 C
ATOM 4322 O PRO B 221 37.668 24.973 23.910 1.00174.15 O
ATOM 4323 CB PRO B 221 36.695 23.783 21.308 1.00173.50 C
ATOM 4324 CG PRO B 221 36.655 22.511 22.082 1.00173.19 C
ATOM 4325 CD PRO B 221 38.050 21.976 21.976 1.00172.60 C
ATOM 4326 N PRO B 222 38.255 26.658 22.513 1.00174.36 N
ATOM 4327 CA PRO B 222 38.146 27.754 23.482 1.00174.38 C
ATOM 4328 C PRO B 222 36.787 27.785 24.176 1.00174.59 C
ATOM 4329 O PRO B 222 35.764 27.700 23.496 1.00174.04 O
ATOM 4330 CB PRO B 222 38.344 29.002 22.616 1.00173.69 C
ATOM 4331 CG PRO B 222 39.203 28.530 21.498 1.00173.64 C
ATOM 4332 CD PRO B 222 38.721 27.140 21.200 1.00174.13 C
ATOM 4333 N GLN B 223 36.797 27.872 25.507 1.00175.11 N
ATOM 4334 CA GLN B 223 35.584 27.951 26.327 1.00175.01 C
ATOM 4335 C GLN B 223 34.490 28.828 25.721 1.00175.56 C
ATOM 4336 O GLN B 223 33.331 28.421 25.644 1.00176.05 O
ATOM 4337 CB GLN B 223 35.930 28.465 27.728 1.00174.02 C
ATOM 4338 CG GLN B 223 34.748 28.507 28.685 1.00173.23 C
ATOM 4339 CD GLN B 223 34.545 29.877 29.301 1.00173.41 C
ATOM 4340 OE1 GLN B 223 34.111 30.816 28.632 1.00172.58 O
ATOM 4341 NE2 GLN B 223 34.855 29.998 30.587 1.00173.96 N
ATOM 4342 N ARG B 224 34.872 30.036 25.313 1.00175.42 N
ATOM 4343 CA ARG B 224 33.964 30.973 24.656 1.00174.76 C
ATOM 4344 C ARG B 224 33.200 30.328 23.498 1.00174.34 C
ATOM 4345 O ARG B 224 31.981 30.469 23.391 1.00173.91 O
ATOM 4346 CB ARG B 224 34.741 32.190 24.149 1.00174.30 C
ATOM 4347 CG ARG B 224 35.591 32.873 25.212 1.00174.14 C
ATOM 4348 CD ARG B 224 34.741 33.580 26.259 1.00174.73 C
ATOM 4349 NE ARG B 224 34.172 34.825 25.747 1.00175.24 N
ATOM 4350 CZ ARG B 224 33.512 35.709 26.489 1.00175.27 C
ATOM 4351 NH1 ARG B 224 33.335 35.492 27.785 1.00176.20 N
ATOM 4352 NH2 ARG B 224 33.030 36.813 25.936 1.00173.63 N
ATOM 4353 N LEU B 225 33.925 29.611 22.644 1.00174.33 N
ATOM 4354 CA LEU B 225 33.335 28.965 21.473 1.00174.17 C
ATOM 4355 C LEU B 225 32.474 27.758 21.843 1.00173.75 C
ATOM 4356 O LEU B 225 31.336 27.639 21.387 1.00173.36 O
ATOM 4357 CB LEU B 225 34.432 28.542 20.491 1.00174.21 C
ATOM 4358 CG LEU B 225 35.278 29.672 19.901 1.00173.93 C
ATOM 4359 CD1 LEU B 225 36.308 29.118 18.932 1.00173.71 C
ATOM 4360 CD2 LEU B 225 34.395 30.707 19.218 1.00173.37 C
ATOM 4361 N TYR B 226 33.035 26.862 22.655 1.00173.62 N
ATOM 4362 CA TYR B 226 32.325 25.681 23.147 1.00173.74 C
ATOM 4363 C TYR B 226 30.962 26.044 23.738 1.00173.85 C
ATOM 4364 O TYR B 226 29.995 25.299 23.593 1.00174.02 O
ATOM 4365 CB TYR B 226 33.178 24.955 24.193 1.00174.27 C
ATOM 4366 CG TYR B 226 32.702 23.559 24.545 1.00174.95 C
ATOM 4367 CD1 TYR B 226 33.284 22.442 23.959 1.00175.58 C
ATOM 4368 CD2 TYR B 226 31.683 23.358 25.470 1.00174.62 C
ATOM 4369 CE1 TYR B 226 32.860 21.162 24.278 1.00175.58 C
ATOM 4370 CE2 TYR B 226 31.253 22.080 25.794 1.00174.96 C
ATOM 4371 CZ TYR B 226 31.846 20.988 25.194 1.00175.04 C
ATOM 4372 OH TYR B 226 31.426 19.715 25.508 1.00174.20 O
ATOM 4373 N LYS B 227 30.897 27.197 24.398 1.00173.98 N
ATOM 4374 CA LYS B 227 29.650 27.694 24.968 1.00173.52 C
ATOM 4375 C LYS B 227 28.767 28.305 23.889 1.00173.75 C
ATOM 4376 O LYS B 227 27.575 28.011 23.807 1.00174.10 O
ATOM 4377 CB LYS B 227 29.930 28.728 26.061 1.00173.62 C
ATOM 4378 CG LYS B 227 30.595 28.164 27.307 1.00174.37 C
ATOM 4379 CD LYS B 227 31.020 29.281 28.245 1.00174.38 C
ATOM 4380 CE LYS B 227 29.828 30.113 28.690 1.00173.41 C
ATOM 4381 NZ LYS B 227 30.249 31.260 29.540 1.00172.56 N
ATOM 4382 N ALA B 228 29.368 29.161 23.067 1.00173.49 N
ATOM 4383 CA ALA B 228 28.664 29.832 21.979 1.00173.88 C
ATOM 4384 C ALA B 228 28.016 28.847 21.012 1.00173.95 C
ATOM 4385 O ALA B 228 26.794 28.818 20.871 1.00174.40 O
ATOM 4386 CB ALA B 228 29.616 30.752 21.229 1.00173.69 C
ATOM 4387 N LEU B 229 28.836 28.039 20.346 1.00173.58 N
ATOM 4388 CA LEU B 229 28.332 27.110 19.339 1.00173.90 C
ATOM 4389 C LEU B 229 27.796 25.812 19.932 1.00173.71 C
ATOM 4390 O LEU B 229 27.796 24.781 19.257 1.00173.67 O
ATOM 4391 CB LEU B 229 29.428 26.787 18.321 1.00174.44 C
ATOM 4392 CG LEU B 229 29.987 27.985 17.550 1.00175.27 C
ATOM 4393 CD1 LEU B 229 31.098 27.549 16.602 1.00174.74 C
ATOM 4394 CD2 LEU B 229 28.878 28.696 16.795 1.00174.96 C
ATOM 4395 N ARG B 230 27.326 25.883 21.178 1.00174.17 N
ATOM 4396 CA ARG B 230 26.793 24.738 21.928 1.00175.15 C
ATOM 4397 C ARG B 230 27.438 23.393 21.589 1.00175.16 C
ATOM 4398 O ARG B 230 26.746 22.434 21.255 1.00174.75 O
ATOM 4399 CB ARG B 230 25.274 24.637 21.725 1.00174.02 C
ATOM 4400 CG ARG B 230 24.440 25.465 22.698 1.00173.17 C
ATOM 4401 CD ARG B 230 24.634 26.960 22.506 1.00173.44 C
ATOM 4402 NE ARG B 230 23.561 27.734 23.124 1.00173.77 N
ATOM 4403 CZ ARG B 230 23.475 29.060 23.080 1.00174.52 C
ATOM 4404 NH1 ARG B 230 24.400 29.766 22.444 1.00174.63 N
ATOM 4405 NH2 ARG B 230 22.464 29.681 23.671 1.00174.50 N
ATOM 4406 N MET B 231 28.764 23.333 21.665 1.00174.82 N
ATOM 4407 CA MET B 231 29.482 22.087 21.422 1.00174.29 C
ATOM 4408 C MET B 231 29.133 21.045 22.480 1.00174.23 C
ATOM 4409 O MET B 231 28.532 21.364 23.506 1.00174.24 O
ATOM 4410 CB MET B 231 30.992 22.333 21.394 1.00174.10 C
ATOM 4411 CG MET B 231 31.444 23.318 20.327 1.00173.51 C
ATOM 4412 SD MET B 231 33.238 23.487 20.267 1.00171.95 S
ATOM 4413 CE MET B 231 33.396 25.094 19.497 1.00173.67 C
ATOM 4414 N GLY B 232 29.519 19.797 22.231 1.00174.04 N
ATOM 4415 CA GLY B 232 29.097 18.695 23.074 1.00174.93 C
ATOM 4416 C GLY B 232 27.600 18.468 22.960 1.00175.92 C
ATOM 4417 O GLY B 232 26.981 17.846 23.822 1.00176.85 O
ATOM 4418 N ASN B 233 27.021 18.981 21.881 1.00175.19 N
ATOM 4419 CA ASN B 233 25.612 18.780 21.572 1.00174.81 C
ATOM 4420 C ASN B 233 25.490 18.459 20.089 1.00174.52 C
ATOM 4421 O ASN B 233 25.497 19.358 19.253 1.00174.26 O
ATOM 4422 CB ASN B 233 24.790 20.018 21.943 1.00173.76 C
ATOM 4423 CG ASN B 233 23.340 19.917 21.506 1.00173.58 C
ATOM 4424 OD1 ASN B 233 22.810 18.825 21.304 1.00173.72 O
ATOM 4425 ND2 ASN B 233 22.689 21.066 21.355 1.00173.50 N
ATOM 4426 N ILE B 234 25.384 17.171 19.776 1.00174.62 N
ATOM 4427 CA ILE B 234 25.479 16.668 18.405 1.00174.15 C
ATOM 4428 C ILE B 234 24.537 17.353 17.407 1.00174.13 C
ATOM 4429 O ILE B 234 24.796 17.354 16.202 1.00174.23 O
ATOM 4430 CB ILE B 234 25.224 15.141 18.369 1.00174.26 C
ATOM 4431 CG1 ILE B 234 25.777 14.527 17.080 1.00173.95 C
ATOM 4432 CG2 ILE B 234 23.745 14.825 18.570 1.00173.70 C
ATOM 4433 CD1 ILE B 234 25.712 13.024 17.049 1.00174.06 C
ATOM 4434 N GLU B 235 23.457 17.950 17.902 1.00174.28 N
ATOM 4435 CA GLU B 235 22.512 18.634 17.025 1.00174.45 C
ATOM 4436 C GLU B 235 23.028 20.010 16.590 1.00173.45 C
ATOM 4437 O GLU B 235 22.280 20.812 16.030 1.00173.05 O
ATOM 4438 CB GLU B 235 21.153 18.771 17.715 1.00175.02 C
ATOM 4439 CG GLU B 235 19.983 18.892 16.750 1.00174.27 C
ATOM 4440 CD GLU B 235 18.674 19.176 17.451 1.00173.98 C
ATOM 4441 OE1 GLU B 235 18.388 18.517 18.474 1.00174.29 O
ATOM 4442 OE2 GLU B 235 17.928 20.058 16.977 1.00172.99 O
ATOM 4443 N THR B 236 24.305 20.280 16.842 1.00173.31 N
ATOM 4444 CA THR B 236 24.930 21.509 16.363 1.00173.23 C
ATOM 4445 C THR B 236 25.944 21.153 15.288 1.00173.17 C
ATOM 4446 O THR B 236 26.316 21.990 14.463 1.00173.13 O
ATOM 4447 CB THR B 236 25.616 22.304 17.497 1.00173.79 C
ATOM 4448 OG1 THR B 236 25.759 23.674 17.104 1.00173.72 O
ATOM 4449 CG2 THR B 236 26.991 21.734 17.823 1.00174.23 C
ATOM 4450 N VAL B 237 26.387 19.899 15.304 1.00172.98 N
ATOM 4451 CA VAL B 237 27.238 19.373 14.250 1.00173.36 C
ATOM 4452 C VAL B 237 26.402 19.262 12.985 1.00173.55 C
ATOM 4453 O VAL B 237 26.884 19.501 11.878 1.00173.75 O
ATOM 4454 CB VAL B 237 27.826 17.999 14.620 1.00173.29 C
ATOM 4455 CG1 VAL B 237 28.665 17.453 13.480 1.00173.65 C
ATOM 4456 CG2 VAL B 237 28.653 18.098 15.888 1.00173.37 C
ATOM 4457 N LEU B 238 25.135 18.906 13.171 1.00173.13 N
ATOM 4458 CA LEU B 238 24.186 18.773 12.075 1.00173.18 C
ATOM 4459 C LEU B 238 23.931 20.120 11.414 1.00173.89 C
ATOM 4460 O LEU B 238 23.997 20.243 10.191 1.00174.32 O
ATOM 4461 CB LEU B 238 22.874 18.169 12.579 1.00172.41 C
ATOM 4462 CG LEU B 238 21.821 17.836 11.524 1.00172.93 C
ATOM 4463 CD1 LEU B 238 22.343 16.784 10.561 1.00173.25 C
ATOM 4464 CD2 LEU B 238 20.541 17.363 12.189 1.00173.31 C
ATOM 4465 N SER B 239 23.644 21.126 12.234 1.00173.99 N
ATOM 4466 CA SER B 239 23.380 22.482 11.759 1.00173.35 C
ATOM 4467 C SER B 239 24.512 23.025 10.894 1.00173.06 C
ATOM 4468 O SER B 239 24.270 23.692 9.889 1.00173.38 O
ATOM 4469 CB SER B 239 23.145 23.419 12.943 1.00173.89 C
ATOM 4470 OG SER B 239 22.156 22.901 13.812 1.00175.51 O
ATOM 4471 N SER B 240 25.747 22.738 11.293 1.00173.54 N
ATOM 4472 CA SER B 240 26.921 23.204 10.563 1.00174.08 C
ATOM 4473 C SER B 240 27.191 22.348 9.329 1.00174.43 C
ATOM 4474 O SER B 240 27.534 22.870 8.267 1.00174.81 O
ATOM 4475 CB SER B 240 28.148 23.212 11.476 1.00174.08 C
ATOM 4476 OG SER B 240 28.427 21.913 11.966 1.00174.31 O
ATOM 4477 N SER B 241 27.048 21.034 9.478 1.00173.98 N
ATOM 4478 CA SER B 241 27.237 20.108 8.366 1.00173.30 C
ATOM 4479 C SER B 241 26.261 20.393 7.231 1.00173.52 C
ATOM 4480 O SER B 241 26.664 20.511 6.075 1.00173.28 O
ATOM 4481 CB SER B 241 27.079 18.661 8.837 1.00172.33 C
ATOM 4482 OG SER B 241 28.112 18.306 9.738 1.00172.44 O
ATOM 4483 N ILE B 242 24.979 20.505 7.573 1.00173.72 N
ATOM 4484 CA ILE B 242 23.940 20.860 6.612 1.00173.40 C
ATOM 4485 C ILE B 242 24.279 22.166 5.902 1.00173.37 C
ATOM 4486 O ILE B 242 24.110 22.289 4.687 1.00173.24 O
ATOM 4487 CB ILE B 242 22.562 20.993 7.298 1.00173.81 C
ATOM 4488 CG1 ILE B 242 22.049 19.621 7.736 1.00174.64 C
ATOM 4489 CG2 ILE B 242 21.558 21.672 6.378 1.00173.63 C
ATOM 4490 CD1 ILE B 242 20.687 19.657 8.396 1.00174.50 C
ATOM 4491 N ALA B 243 24.776 23.131 6.670 1.00173.80 N
ATOM 4492 CA ALA B 243 25.173 24.425 6.126 1.00173.99 C
ATOM 4493 C ALA B 243 26.263 24.263 5.073 1.00173.69 C
ATOM 4494 O ALA B 243 26.237 24.916 4.032 1.00173.74 O
ATOM 4495 CB ALA B 243 25.643 25.350 7.238 1.00174.11 C
ATOM 4496 N ALA B 244 27.215 23.380 5.351 1.00173.35 N
ATOM 4497 CA ALA B 244 28.292 23.103 4.412 1.00173.12 C
ATOM 4498 C ALA B 244 27.775 22.276 3.242 1.00173.21 C
ATOM 4499 O ALA B 244 28.188 22.472 2.098 1.00173.98 O
ATOM 4500 CB ALA B 244 29.436 22.384 5.111 1.00173.21 C
ATOM 4501 N VAL B 245 26.867 21.353 3.541 1.00172.37 N
ATOM 4502 CA VAL B 245 26.298 20.467 2.532 1.00172.41 C
ATOM 4503 C VAL B 245 25.555 21.225 1.426 1.00173.39 C
ATOM 4504 O VAL B 245 25.773 20.962 0.241 1.00173.91 O
ATOM 4505 CB VAL B 245 25.345 19.439 3.181 1.00172.01 C
ATOM 4506 CG1 VAL B 245 24.390 18.865 2.157 1.00172.08 C
ATOM 4507 CG2 VAL B 245 26.143 18.327 3.836 1.00172.88 C
ATOM 4508 N PHE B 246 24.696 22.171 1.799 1.00173.36 N
ATOM 4509 CA PHE B 246 23.926 22.902 0.795 1.00173.34 C
ATOM 4510 C PHE B 246 24.805 23.952 0.120 1.00172.81 C
ATOM 4511 O PHE B 246 24.509 24.403 -0.986 1.00172.60 O
ATOM 4512 CB PHE B 246 22.663 23.531 1.412 1.00173.54 C
ATOM 4513 CG PHE B 246 22.869 24.899 2.013 1.00173.08 C
ATOM 4514 CD1 PHE B 246 22.807 26.041 1.226 1.00173.34 C
ATOM 4515 CD2 PHE B 246 23.094 25.044 3.370 1.00173.60 C
ATOM 4516 CE1 PHE B 246 22.989 27.292 1.779 1.00173.55 C
ATOM 4517 CE2 PHE B 246 23.273 26.297 3.927 1.00173.91 C
ATOM 4518 CZ PHE B 246 23.222 27.420 3.130 1.00173.68 C
ATOM 4519 N PHE B 247 25.887 24.335 0.789 1.00172.53 N
ATOM 4520 CA PHE B 247 26.867 25.234 0.191 1.00172.56 C
ATOM 4521 C PHE B 247 27.540 24.537 -0.980 1.00172.80 C
ATOM 4522 O PHE B 247 27.619 25.080 -2.080 1.00173.86 O
ATOM 4523 CB PHE B 247 27.913 25.675 1.215 1.00172.90 C
ATOM 4524 CG PHE B 247 29.126 26.319 0.601 1.00173.30 C
ATOM 4525 CD1 PHE B 247 29.006 27.466 -0.167 1.00173.58 C
ATOM 4526 CD2 PHE B 247 30.385 25.769 0.781 1.00173.50 C
ATOM 4527 CE1 PHE B 247 30.121 28.056 -0.737 1.00173.57 C
ATOM 4528 CE2 PHE B 247 31.502 26.354 0.213 1.00173.34 C
ATOM 4529 CZ PHE B 247 31.370 27.499 -0.546 1.00173.12 C
ATOM 4530 N ALA B 248 28.019 23.324 -0.729 1.00172.26 N
ATOM 4531 CA ALA B 248 28.615 22.490 -1.764 1.00172.80 C
ATOM 4532 C ALA B 248 27.613 22.198 -2.877 1.00173.42 C
ATOM 4533 O ALA B 248 27.969 22.163 -4.055 1.00174.19 O
ATOM 4534 CB ALA B 248 29.135 21.194 -1.163 1.00173.07 C
ATOM 4535 N ALA B 249 26.361 21.980 -2.491 1.00172.97 N
ATOM 4536 CA ALA B 249 25.291 21.693 -3.442 1.00173.11 C
ATOM 4537 C ALA B 249 25.061 22.842 -4.424 1.00173.40 C
ATOM 4538 O ALA B 249 24.925 22.619 -5.627 1.00173.69 O
ATOM 4539 CB ALA B 249 24.008 21.373 -2.701 1.00173.00 C
ATOM 4540 N PHE B 250 25.001 24.066 -3.909 1.00172.96 N
ATOM 4541 CA PHE B 250 24.833 25.244 -4.756 1.00173.09 C
ATOM 4542 C PHE B 250 25.998 25.414 -5.730 1.00172.73 C
ATOM 4543 O PHE B 250 25.834 25.980 -6.809 1.00173.06 O
ATOM 4544 CB PHE B 250 24.679 26.507 -3.903 1.00173.52 C
ATOM 4545 CG PHE B 250 23.250 26.884 -3.628 1.00173.92 C
ATOM 4546 CD1 PHE B 250 22.406 27.251 -4.663 1.00174.35 C
ATOM 4547 CD2 PHE B 250 22.752 26.879 -2.335 1.00174.45 C
ATOM 4548 CE1 PHE B 250 21.091 27.601 -4.415 1.00174.39 C
ATOM 4549 CE2 PHE B 250 21.437 27.229 -2.082 1.00174.39 C
ATOM 4550 CZ PHE B 250 20.606 27.590 -3.123 1.00173.38 C
ATOM 4551 N VAL B 251 27.170 24.918 -5.349 1.00172.63 N
ATOM 4552 CA VAL B 251 28.357 25.047 -6.188 1.00172.54 C
ATOM 4553 C VAL B 251 28.344 24.051 -7.343 1.00173.06 C
ATOM 4554 O VAL B 251 28.564 24.429 -8.493 1.00174.06 O
ATOM 4555 CB VAL B 251 29.649 24.855 -5.368 1.00173.59 C
ATOM 4556 CG1 VAL B 251 30.864 24.816 -6.284 1.00173.39 C
ATOM 4557 CG2 VAL B 251 29.791 25.960 -4.333 1.00174.37 C
ATOM 4558 N VAL B 252 28.076 22.785 -7.039 1.00173.11 N
ATOM 4559 CA VAL B 252 28.074 21.746 -8.065 1.00173.66 C
ATOM 4560 C VAL B 252 26.940 21.959 -9.061 1.00173.44 C
ATOM 4561 O VAL B 252 27.042 21.563 -10.223 1.00173.35 O
ATOM 4562 CB VAL B 252 27.963 20.331 -7.454 1.00174.17 C
ATOM 4563 CG1 VAL B 252 29.242 19.972 -6.722 1.00174.14 C
ATOM 4564 CG2 VAL B 252 26.774 20.236 -6.517 1.00174.39 C
ATOM 4565 N ALA B 253 25.859 22.582 -8.605 1.00173.19 N
ATOM 4566 CA ALA B 253 24.748 22.924 -9.483 1.00173.40 C
ATOM 4567 C ALA B 253 25.162 24.016 -10.461 1.00173.40 C
ATOM 4568 O ALA B 253 24.680 24.070 -11.593 1.00173.22 O
ATOM 4569 CB ALA B 253 23.542 23.365 -8.670 1.00173.85 C
ATOM 4570 N GLY B 254 26.056 24.891 -10.010 1.00173.60 N
ATOM 4571 CA GLY B 254 26.560 25.970 -10.840 1.00173.42 C
ATOM 4572 C GLY B 254 27.604 25.499 -11.836 1.00173.98 C
ATOM 4573 O GLY B 254 27.568 25.873 -13.007 1.00174.14 O
ATOM 4574 N THR B 255 28.532 24.668 -11.372 1.00174.62 N
ATOM 4575 CA THR B 255 29.596 24.154 -12.230 1.00174.65 C
ATOM 4576 C THR B 255 29.042 23.191 -13.274 1.00174.43 C
ATOM 4577 O THR B 255 29.679 22.937 -14.296 1.00174.45 O
ATOM 4578 CB THR B 255 30.691 23.435 -11.416 1.00174.70 C
ATOM 4579 OG1 THR B 255 30.127 22.302 -10.745 1.00174.30 O
ATOM 4580 CG2 THR B 255 31.304 24.379 -10.390 1.00175.14 C
ATOM 4581 N MET B 256 27.854 22.656 -13.009 1.00174.13 N
ATOM 4582 CA MET B 256 27.184 21.769 -13.950 1.00173.83 C
ATOM 4583 C MET B 256 26.499 22.577 -15.046 1.00174.46 C
ATOM 4584 O MET B 256 26.535 22.207 -16.219 1.00174.40 O
ATOM 4585 CB MET B 256 26.168 20.884 -13.225 1.00172.64 C
ATOM 4586 CG MET B 256 25.436 19.903 -14.128 1.00172.54 C
ATOM 4587 SD MET B 256 26.541 18.759 -14.976 1.00170.43 S
ATOM 4588 CE MET B 256 26.784 17.522 -13.708 1.00173.18 C
ATOM 4589 N TRP B 257 25.887 23.692 -14.659 1.00174.79 N
ATOM 4590 CA TRP B 257 25.134 24.512 -15.602 1.00174.10 C
ATOM 4591 C TRP B 257 26.042 25.378 -16.474 1.00173.95 C
ATOM 4592 O TRP B 257 25.829 25.484 -17.681 1.00174.13 O
ATOM 4593 CB TRP B 257 24.131 25.394 -14.858 1.00173.66 C
ATOM 4594 CG TRP B 257 23.099 25.993 -15.757 1.00172.70 C
ATOM 4595 CD1 TRP B 257 22.933 27.314 -16.051 1.00173.28 C
ATOM 4596 CD2 TRP B 257 22.094 25.288 -16.494 1.00171.87 C
ATOM 4597 NE1 TRP B 257 21.881 27.477 -16.918 1.00172.98 N
ATOM 4598 CE2 TRP B 257 21.349 26.248 -17.206 1.00172.63 C
ATOM 4599 CE3 TRP B 257 21.748 23.938 -16.616 1.00171.96 C
ATOM 4600 CZ2 TRP B 257 20.280 25.902 -18.030 1.00173.24 C
ATOM 4601 CZ3 TRP B 257 20.687 23.597 -17.434 1.00172.15 C
ATOM 4602 CH2 TRP B 257 19.966 24.574 -18.130 1.00173.10 C
ATOM 4603 N TYR B 258 27.050 25.995 -15.865 1.00174.01 N
ATOM 4604 CA TYR B 258 27.969 26.849 -16.610 1.00173.92 C
ATOM 4605 C TYR B 258 29.079 26.028 -17.252 1.00174.69 C
ATOM 4606 O TYR B 258 29.732 26.477 -18.194 1.00175.06 O
ATOM 4607 CB TYR B 258 28.575 27.925 -15.707 1.00173.32 C
ATOM 4608 CG TYR B 258 27.553 28.818 -15.043 1.00173.15 C
ATOM 4609 CD1 TYR B 258 26.754 29.667 -15.796 1.00172.95 C
ATOM 4610 CD2 TYR B 258 27.395 28.823 -13.665 1.00174.04 C
ATOM 4611 CE1 TYR B 258 25.821 30.487 -15.197 1.00173.27 C
ATOM 4612 CE2 TYR B 258 26.463 29.640 -13.055 1.00174.12 C
ATOM 4613 CZ TYR B 258 25.680 30.472 -13.827 1.00173.36 C
ATOM 4614 OH TYR B 258 24.749 31.290 -13.230 1.00173.03 O
ATOM 4615 N GLY B 259 29.290 24.823 -16.737 1.00174.20 N
ATOM 4616 CA GLY B 259 30.302 23.938 -17.280 1.00174.23 C
ATOM 4617 C GLY B 259 31.661 24.131 -16.638 1.00173.84 C
ATOM 4618 O GLY B 259 31.978 25.212 -16.140 1.00174.32 O
ATOM 4619 N SER B 260 32.465 23.072 -16.660 1.00172.91 N
ATOM 4620 CA SER B 260 33.813 23.102 -16.106 1.00172.46 C
ATOM 4621 C SER B 260 34.571 21.850 -16.519 1.00172.38 C
ATOM 4622 O SER B 260 34.015 20.971 -17.178 1.00172.51 O
ATOM 4623 CB SER B 260 33.775 23.216 -14.580 1.00173.01 C
ATOM 4624 OG SER B 260 33.544 21.956 -13.974 1.00174.09 O
ATOM 4625 N ALA B 261 35.839 21.768 -16.128 1.00172.29 N
ATOM 4626 CA ALA B 261 36.642 20.577 -16.385 1.00173.40 C
ATOM 4627 C ALA B 261 36.097 19.371 -15.623 1.00173.35 C
ATOM 4628 O ALA B 261 36.483 18.232 -15.882 1.00172.73 O
ATOM 4629 CB ALA B 261 38.096 20.825 -16.013 1.00173.94 C
ATOM 4630 N THR B 262 35.193 19.636 -14.685 1.00173.46 N
ATOM 4631 CA THR B 262 34.588 18.593 -13.867 1.00173.30 C
ATOM 4632 C THR B 262 33.305 18.096 -14.533 1.00173.48 C
ATOM 4633 O THR B 262 32.861 16.972 -14.299 1.00173.61 O
ATOM 4634 CB THR B 262 34.310 19.109 -12.426 1.00172.89 C
ATOM 4635 OG1 THR B 262 35.081 18.353 -11.486 1.00173.96 O
ATOM 4636 CG2 THR B 262 32.832 19.018 -12.057 1.00172.49 C
ATOM 4637 N THR B 263 32.732 18.929 -15.395 1.00173.61 N
ATOM 4638 CA THR B 263 31.531 18.557 -16.140 1.00173.49 C
ATOM 4639 C THR B 263 31.749 18.640 -17.650 1.00173.74 C
ATOM 4640 O THR B 263 31.272 19.571 -18.298 1.00173.85 O
ATOM 4641 CB THR B 263 30.336 19.451 -15.761 1.00173.65 C
ATOM 4642 OG1 THR B 263 30.658 20.823 -16.020 1.00173.61 O
ATOM 4643 CG2 THR B 263 29.992 19.283 -14.292 1.00174.29 C
ATOM 4644 N PRO B 264 32.478 17.666 -18.216 1.00173.98 N
ATOM 4645 CA PRO B 264 32.777 17.660 -19.652 1.00174.26 C
ATOM 4646 C PRO B 264 31.537 17.417 -20.513 1.00173.77 C
ATOM 4647 O PRO B 264 30.682 16.610 -20.149 1.00174.03 O
ATOM 4648 CB PRO B 264 33.772 16.505 -19.790 1.00174.31 C
ATOM 4649 CG PRO B 264 33.409 15.583 -18.681 1.00173.60 C
ATOM 4650 CD PRO B 264 33.039 16.483 -17.540 1.00173.62 C
ATOM 4651 N ILE B 265 31.450 18.116 -21.640 1.00172.71 N
ATOM 4652 CA ILE B 265 30.289 18.032 -22.522 1.00172.52 C
ATOM 4653 C ILE B 265 30.092 16.649 -23.145 1.00172.88 C
ATOM 4654 O ILE B 265 28.972 16.280 -23.495 1.00173.02 O
ATOM 4655 CB ILE B 265 30.372 19.082 -23.653 1.00173.15 C
ATOM 4656 CG1 ILE B 265 31.503 18.747 -24.625 1.00174.16 C
ATOM 4657 CG2 ILE B 265 30.579 20.473 -23.069 1.00173.31 C
ATOM 4658 CD1 ILE B 265 31.549 19.649 -25.839 1.00174.16 C
ATOM 4659 N GLU B 266 31.169 15.884 -23.288 1.00172.94 N
ATOM 4660 CA GLU B 266 31.070 14.549 -23.877 1.00173.79 C
ATOM 4661 C GLU B 266 30.425 13.528 -22.937 1.00174.42 C
ATOM 4662 O GLU B 266 30.158 12.397 -23.338 1.00174.57 O
ATOM 4663 CB GLU B 266 32.451 14.044 -24.302 1.00173.69 C
ATOM 4664 CG GLU B 266 33.077 14.795 -25.463 1.00173.28 C
ATOM 4665 CD GLU B 266 34.134 13.968 -26.167 1.00173.79 C
ATOM 4666 OE1 GLU B 266 34.879 13.246 -25.474 1.00173.91 O
ATOM 4667 OE2 GLU B 266 34.216 14.028 -27.411 1.00174.15 O
ATOM 4668 N LEU B 267 30.170 13.925 -21.694 1.00174.26 N
ATOM 4669 CA LEU B 267 29.609 13.004 -20.711 1.00173.63 C
ATOM 4670 C LEU B 267 28.291 13.513 -20.145 1.00173.55 C
ATOM 4671 O LEU B 267 27.456 12.728 -19.695 1.00173.60 O
ATOM 4672 CB LEU B 267 30.600 12.763 -19.571 1.00173.12 C
ATOM 4673 CG LEU B 267 31.953 12.164 -19.960 1.00173.73 C
ATOM 4674 CD1 LEU B 267 32.855 12.023 -18.743 1.00174.19 C
ATOM 4675 CD2 LEU B 267 31.767 10.823 -20.649 1.00173.52 C
ATOM 4676 N PHE B 268 28.105 14.827 -20.172 1.00173.97 N
ATOM 4677 CA PHE B 268 26.911 15.428 -19.598 1.00174.56 C
ATOM 4678 C PHE B 268 26.091 16.197 -20.632 1.00174.82 C
ATOM 4679 O PHE B 268 24.933 16.533 -20.387 1.00174.60 O
ATOM 4680 CB PHE B 268 27.291 16.350 -18.439 1.00174.30 C
ATOM 4681 CG PHE B 268 27.873 15.627 -17.259 1.00172.94 C
ATOM 4682 CD1 PHE B 268 27.062 14.896 -16.408 1.00173.33 C
ATOM 4683 CD2 PHE B 268 29.233 15.674 -17.004 1.00172.53 C
ATOM 4684 CE1 PHE B 268 27.594 14.228 -15.324 1.00173.35 C
ATOM 4685 CE2 PHE B 268 29.772 15.008 -15.921 1.00173.23 C
ATOM 4686 CZ PHE B 268 28.951 14.284 -15.079 1.00173.87 C
ATOM 4687 N GLY B 269 26.687 16.471 -21.788 1.00174.38 N
ATOM 4688 CA GLY B 269 25.994 17.197 -22.838 1.00173.67 C
ATOM 4689 C GLY B 269 26.438 18.643 -22.945 1.00173.39 C
ATOM 4690 O GLY B 269 27.169 19.133 -22.087 1.00173.80 O
ATOM 4691 N PRO B 270 26.001 19.334 -24.009 1.00173.03 N
ATOM 4692 CA PRO B 270 26.336 20.738 -24.263 1.00172.97 C
ATOM 4693 C PRO B 270 25.831 21.684 -23.179 1.00172.34 C
ATOM 4694 O PRO B 270 25.107 21.271 -22.278 1.00172.38 O
ATOM 4695 CB PRO B 270 25.631 21.024 -25.594 1.00173.71 C
ATOM 4696 CG PRO B 270 25.525 19.693 -26.250 1.00174.36 C
ATOM 4697 CD PRO B 270 25.229 18.755 -25.121 1.00173.55 C
ATOM 4698 N THR B 271 26.218 22.950 -23.280 1.00172.45 N
ATOM 4699 CA THR B 271 25.810 23.963 -22.318 1.00171.99 C
ATOM 4700 C THR B 271 24.916 24.975 -23.027 1.00172.59 C
ATOM 4701 O THR B 271 25.153 25.301 -24.188 1.00173.97 O
ATOM 4702 CB THR B 271 27.037 24.658 -21.692 1.00172.52 C
ATOM 4703 OG1 THR B 271 27.652 23.778 -20.745 1.00173.73 O
ATOM 4704 CG2 THR B 271 26.654 25.952 -20.998 1.00172.92 C
ATOM 4705 N ARG B 272 23.892 25.471 -22.336 1.00172.17 N
ATOM 4706 CA ARG B 272 22.939 26.399 -22.940 1.00173.30 C
ATOM 4707 C ARG B 272 23.610 27.687 -23.408 1.00172.95 C
ATOM 4708 O ARG B 272 23.136 28.342 -24.337 1.00172.63 O
ATOM 4709 CB ARG B 272 21.812 26.730 -21.958 1.00173.33 C
ATOM 4710 CG ARG B 272 22.223 27.618 -20.797 1.00173.81 C
ATOM 4711 CD ARG B 272 21.108 28.583 -20.436 1.00173.78 C
ATOM 4712 NE ARG B 272 20.869 29.547 -21.506 1.00173.41 N
ATOM 4713 CZ ARG B 272 19.857 30.406 -21.528 1.00173.62 C
ATOM 4714 NH1 ARG B 272 18.977 30.425 -20.536 1.00173.00 N
ATOM 4715 NH2 ARG B 272 19.720 31.246 -22.545 1.00174.52 N
ATOM 4716 N TYR B 273 24.718 28.040 -22.766 1.00172.65 N
ATOM 4717 CA TYR B 273 25.434 29.263 -23.096 1.00173.08 C
ATOM 4718 C TYR B 273 26.273 29.080 -24.352 1.00173.95 C
ATOM 4719 O TYR B 273 26.648 30.054 -25.004 1.00174.93 O
ATOM 4720 CB TYR B 273 26.306 29.700 -21.921 1.00173.61 C
ATOM 4721 CG TYR B 273 25.509 29.933 -20.661 1.00174.12 C
ATOM 4722 CD1 TYR B 273 24.798 31.111 -20.476 1.00174.12 C
ATOM 4723 CD2 TYR B 273 25.450 28.969 -19.664 1.00174.57 C
ATOM 4724 CE1 TYR B 273 24.060 31.325 -19.330 1.00174.48 C
ATOM 4725 CE2 TYR B 273 24.715 29.173 -18.514 1.00174.63 C
ATOM 4726 CZ TYR B 273 24.022 30.353 -18.351 1.00174.84 C
ATOM 4727 OH TYR B 273 23.290 30.557 -17.205 1.00174.76 O
ATOM 4728 N GLN B 274 26.564 27.829 -24.690 1.00173.55 N
ATOM 4729 CA GLN B 274 27.274 27.526 -25.926 1.00174.12 C
ATOM 4730 C GLN B 274 26.368 27.790 -27.125 1.00174.03 C
ATOM 4731 O GLN B 274 26.819 28.249 -28.174 1.00174.12 O
ATOM 4732 CB GLN B 274 27.762 26.078 -25.930 1.00173.13 C
ATOM 4733 CG GLN B 274 28.700 25.743 -24.785 1.00172.73 C
ATOM 4734 CD GLN B 274 29.192 24.314 -24.841 1.00173.37 C
ATOM 4735 OE1 GLN B 274 28.421 23.371 -24.659 1.00173.99 O
ATOM 4736 NE2 GLN B 274 30.484 24.142 -25.098 1.00173.62 N
ATOM 4737 N TRP B 275 25.085 27.495 -26.956 1.00173.04 N
ATOM 4738 CA TRP B 275 24.091 27.784 -27.980 1.00172.65 C
ATOM 4739 C TRP B 275 23.819 29.284 -28.057 1.00173.14 C
ATOM 4740 O TRP B 275 23.634 29.834 -29.143 1.00173.39 O
ATOM 4741 CB TRP B 275 22.797 27.019 -27.703 1.00171.89 C
ATOM 4742 CG TRP B 275 21.659 27.420 -28.588 1.00172.48 C
ATOM 4743 CD1 TRP B 275 20.654 28.289 -28.285 1.00173.03 C
ATOM 4744 CD2 TRP B 275 21.413 26.971 -29.926 1.00172.89 C
ATOM 4745 NE1 TRP B 275 19.793 28.406 -29.350 1.00173.10 N
ATOM 4746 CE2 TRP B 275 20.238 27.608 -30.369 1.00172.96 C
ATOM 4747 CE3 TRP B 275 22.072 26.091 -30.791 1.00173.36 C
ATOM 4748 CZ2 TRP B 275 19.708 27.395 -31.640 1.00173.34 C
ATOM 4749 CZ3 TRP B 275 21.543 25.881 -32.051 1.00173.29 C
ATOM 4750 CH2 TRP B 275 20.373 26.530 -32.463 1.00173.51 C
ATOM 4751 N ASP B 276 23.792 29.935 -26.897 1.00173.36 N
ATOM 4752 CA ASP B 276 23.562 31.375 -26.816 1.00173.66 C
ATOM 4753 C ASP B 276 24.597 32.171 -27.609 1.00173.45 C
ATOM 4754 O ASP B 276 24.246 33.051 -28.394 1.00173.15 O
ATOM 4755 CB ASP B 276 23.569 31.837 -25.357 1.00173.38 C
ATOM 4756 CG ASP B 276 22.427 31.249 -24.554 1.00172.85 C
ATOM 4757 OD1 ASP B 276 21.342 31.032 -25.130 1.00172.93 O
ATOM 4758 OD2 ASP B 276 22.616 31.005 -23.343 1.00172.75 O
ATOM 4759 N SER B 277 25.871 31.853 -27.401 1.00173.39 N
ATOM 4760 CA SER B 277 26.952 32.586 -28.047 1.00173.27 C
ATOM 4761 C SER B 277 27.335 31.968 -29.385 1.00173.41 C
ATOM 4762 O SER B 277 28.345 32.347 -29.979 1.00174.63 O
ATOM 4763 CB SER B 277 28.178 32.644 -27.135 1.00174.00 C
ATOM 4764 OG SER B 277 28.632 31.341 -26.813 1.00174.63 O
ATOM 4765 N SER B 278 26.519 31.025 -29.852 1.00173.08 N
ATOM 4766 CA SER B 278 26.777 30.310 -31.101 1.00173.87 C
ATOM 4767 C SER B 278 28.184 29.717 -31.126 1.00173.11 C
ATOM 4768 O SER B 278 28.851 29.726 -32.161 1.00173.61 O
ATOM 4769 CB SER B 278 26.572 31.239 -32.300 1.00175.38 C
ATOM 4770 OG SER B 278 25.232 31.698 -32.370 1.00175.28 O
ATOM 4771 N TYR B 279 28.616 29.214 -29.973 1.00172.53 N
ATOM 4772 CA TYR B 279 29.953 28.654 -29.781 1.00172.97 C
ATOM 4773 C TYR B 279 30.398 27.719 -30.900 1.00172.84 C
ATOM 4774 O TYR B 279 31.375 27.992 -31.595 1.00173.26 O
ATOM 4775 CB TYR B 279 30.016 27.914 -28.445 1.00174.26 C
ATOM 4776 CG TYR B 279 31.392 27.409 -28.081 1.00174.09 C
ATOM 4777 CD1 TYR B 279 32.482 28.267 -28.049 1.00173.30 C
ATOM 4778 CD2 TYR B 279 31.597 26.075 -27.749 1.00174.55 C
ATOM 4779 CE1 TYR B 279 33.742 27.808 -27.713 1.00174.08 C
ATOM 4780 CE2 TYR B 279 32.850 25.608 -27.409 1.00174.98 C
ATOM 4781 CZ TYR B 279 33.919 26.478 -27.391 1.00175.22 C
ATOM 4782 OH TYR B 279 35.170 26.012 -27.054 1.00175.35 O
ATOM 4783 N PHE B 280 29.677 26.618 -31.069 1.00172.51 N
ATOM 4784 CA PHE B 280 30.053 25.618 -32.059 1.00172.72 C
ATOM 4785 C PHE B 280 29.856 26.117 -33.487 1.00173.06 C
ATOM 4786 O PHE B 280 30.552 25.679 -34.398 1.00173.52 O
ATOM 4787 CB PHE B 280 29.264 24.329 -31.835 1.00172.80 C
ATOM 4788 CG PHE B 280 29.585 23.645 -30.539 1.00173.33 C
ATOM 4789 CD1 PHE B 280 30.679 22.800 -30.440 1.00174.05 C
ATOM 4790 CD2 PHE B 280 28.795 23.844 -29.420 1.00173.09 C
ATOM 4791 CE1 PHE B 280 30.980 22.167 -29.247 1.00173.95 C
ATOM 4792 CE2 PHE B 280 29.090 23.214 -28.224 1.00173.12 C
ATOM 4793 CZ PHE B 280 30.184 22.374 -28.138 1.00173.37 C
ATOM 4794 N GLN B 281 28.915 27.036 -33.677 1.00172.63 N
ATOM 4795 CA GLN B 281 28.656 27.588 -35.003 1.00173.02 C
ATOM 4796 C GLN B 281 29.875 28.335 -35.539 1.00173.05 C
ATOM 4797 O GLN B 281 30.210 28.229 -36.721 1.00173.21 O
ATOM 4798 CB GLN B 281 27.444 28.522 -34.973 1.00173.18 C
ATOM 4799 CG GLN B 281 27.384 29.492 -36.143 1.00173.54 C
ATOM 4800 CD GLN B 281 26.077 30.256 -36.210 1.00173.31 C
ATOM 4801 OE1 GLN B 281 25.056 29.723 -36.641 1.00172.99 O
ATOM 4802 NE2 GLN B 281 26.104 31.513 -35.785 1.00173.29 N
ATOM 4803 N GLN B 282 30.543 29.074 -34.661 1.00173.11 N
ATOM 4804 CA GLN B 282 31.717 29.848 -35.048 1.00173.07 C
ATOM 4805 C GLN B 282 32.887 28.943 -35.414 1.00173.13 C
ATOM 4806 O GLN B 282 33.622 29.224 -36.361 1.00173.43 O
ATOM 4807 CB GLN B 282 32.124 30.806 -33.926 1.00173.43 C
ATOM 4808 CG GLN B 282 31.076 31.856 -33.596 1.00174.04 C
ATOM 4809 CD GLN B 282 31.481 32.735 -32.429 1.00174.92 C
ATOM 4810 OE1 GLN B 282 32.525 33.387 -32.461 1.00174.39 O
ATOM 4811 NE2 GLN B 282 30.656 32.757 -31.390 1.00175.87 N
ATOM 4812 N GLU B 283 33.054 27.860 -34.663 1.00173.65 N
ATOM 4813 CA GLU B 283 34.112 26.894 -34.935 1.00174.07 C
ATOM 4814 C GLU B 283 33.907 26.214 -36.284 1.00174.38 C
ATOM 4815 O GLU B 283 34.870 25.920 -36.991 1.00174.82 O
ATOM 4816 CB GLU B 283 34.185 25.843 -33.824 1.00174.20 C
ATOM 4817 CG GLU B 283 35.301 24.815 -33.998 1.00173.39 C
ATOM 4818 CD GLU B 283 36.677 25.448 -34.118 1.00172.85 C
ATOM 4819 OE1 GLU B 283 36.898 26.529 -33.531 1.00172.75 O
ATOM 4820 OE2 GLU B 283 37.539 24.864 -34.810 1.00172.37 O
ATOM 4821 N ILE B 284 32.648 25.964 -36.633 1.00173.98 N
ATOM 4822 CA ILE B 284 32.320 25.346 -37.912 1.00173.34 C
ATOM 4823 C ILE B 284 32.720 26.251 -39.072 1.00173.30 C
ATOM 4824 O ILE B 284 33.498 25.855 -39.942 1.00173.21 O
ATOM 4825 CB ILE B 284 30.822 25.023 -38.025 1.00172.60 C
ATOM 4826 CG1 ILE B 284 30.414 23.988 -36.977 1.00172.30 C
ATOM 4827 CG2 ILE B 284 30.511 24.483 -39.398 1.00173.32 C
ATOM 4828 CD1 ILE B 284 28.937 23.656 -36.987 1.00172.48 C
ATOM 4829 N ASN B 285 32.166 27.461 -39.080 1.00172.93 N
ATOM 4830 CA ASN B 285 32.497 28.466 -40.083 1.00172.98 C
ATOM 4831 C ASN B 285 34.000 28.683 -40.215 1.00173.16 C
ATOM 4832 O ASN B 285 34.532 28.724 -41.323 1.00172.79 O
ATOM 4833 CB ASN B 285 31.806 29.788 -39.751 1.00172.72 C
ATOM 4834 CG ASN B 285 30.370 29.829 -40.233 1.00172.94 C
ATOM 4835 OD1 ASN B 285 30.111 29.868 -41.435 1.00172.38 O
ATOM 4836 ND2 ASN B 285 29.427 29.823 -39.296 1.00173.71 N
ATOM 4837 N ARG B 286 34.671 28.828 -39.074 1.00173.96 N
ATOM 4838 CA ARG B 286 36.126 28.952 -39.033 1.00174.49 C
ATOM 4839 C ARG B 286 36.816 27.834 -39.808 1.00174.30 C
ATOM 4840 O ARG B 286 37.741 28.081 -40.581 1.00174.68 O
ATOM 4841 CB ARG B 286 36.619 28.957 -37.584 1.00174.73 C
ATOM 4842 CG ARG B 286 38.015 29.533 -37.405 1.00174.12 C
ATOM 4843 CD ARG B 286 38.606 29.107 -36.071 1.00173.73 C
ATOM 4844 NE ARG B 286 38.760 27.655 -35.972 1.00173.73 N
ATOM 4845 CZ ARG B 286 39.603 26.929 -36.702 1.00174.01 C
ATOM 4846 NH1 ARG B 286 40.408 27.508 -37.581 1.00174.63 N
ATOM 4847 NH2 ARG B 286 39.654 25.615 -36.533 1.00173.32 N
ATOM 4848 N ARG B 287 36.360 26.604 -39.595 1.00174.02 N
ATOM 4849 CA ARG B 287 36.905 25.449 -40.300 1.00173.49 C
ATOM 4850 C ARG B 287 36.556 25.492 -41.781 1.00173.06 C
ATOM 4851 O ARG B 287 37.407 25.254 -42.638 1.00173.48 O
ATOM 4852 CB ARG B 287 36.389 24.148 -39.685 1.00173.02 C
ATOM 4853 CG ARG B 287 36.999 23.794 -38.339 1.00173.19 C
ATOM 4854 CD ARG B 287 36.652 22.362 -37.959 1.00173.62 C
ATOM 4855 NE ARG B 287 37.310 21.932 -36.729 1.00173.01 N
ATOM 4856 CZ ARG B 287 37.521 20.660 -36.404 1.00172.60 C
ATOM 4857 NH1 ARG B 287 37.124 19.692 -37.219 1.00172.75 N
ATOM 4858 NH2 ARG B 287 38.128 20.355 -35.266 1.00171.75 N
ATOM 4859 N VAL B 288 35.294 25.789 -42.074 1.00172.53 N
ATOM 4860 CA VAL B 288 34.808 25.810 -43.449 1.00172.74 C
ATOM 4861 C VAL B 288 35.530 26.872 -44.272 1.00173.32 C
ATOM 4862 O VAL B 288 35.986 26.602 -45.384 1.00173.80 O
ATOM 4863 CB VAL B 288 33.290 26.063 -43.502 1.00173.35 C
ATOM 4864 CG1 VAL B 288 32.840 26.312 -44.932 1.00174.11 C
ATOM 4865 CG2 VAL B 288 32.539 24.885 -42.903 1.00173.38 C
ATOM 4866 N GLN B 289 35.642 28.075 -43.715 1.00173.30 N
ATOM 4867 CA GLN B 289 36.313 29.176 -44.398 1.00173.51 C
ATOM 4868 C GLN B 289 37.799 28.890 -44.595 1.00173.43 C
ATOM 4869 O GLN B 289 38.402 29.340 -45.568 1.00174.02 O
ATOM 4870 CB GLN B 289 36.129 30.484 -43.621 1.00173.62 C
ATOM 4871 CG GLN B 289 34.695 31.013 -43.562 1.00173.80 C
ATOM 4872 CD GLN B 289 34.126 31.384 -44.923 1.00174.27 C
ATOM 4873 OE1 GLN B 289 33.909 30.526 -45.780 1.00174.79 O
ATOM 4874 NE2 GLN B 289 33.885 32.673 -45.128 1.00174.16 N
ATOM 4875 N ALA B 290 38.381 28.138 -43.666 1.00173.45 N
ATOM 4876 CA ALA B 290 39.783 27.748 -43.759 1.00173.94 C
ATOM 4877 C ALA B 290 39.997 26.796 -44.929 1.00173.84 C
ATOM 4878 O ALA B 290 40.973 26.912 -45.669 1.00174.20 O
ATOM 4879 CB ALA B 290 40.248 27.107 -42.460 1.00174.81 C
ATOM 4880 N SER B 291 39.080 25.844 -45.076 1.00173.63 N
ATOM 4881 CA SER B 291 39.129 24.887 -46.174 1.00174.44 C
ATOM 4882 C SER B 291 39.004 25.578 -47.531 1.00175.10 C
ATOM 4883 O SER B 291 39.695 25.217 -48.484 1.00175.36 O
ATOM 4884 CB SER B 291 38.025 23.840 -46.012 1.00174.42 C
ATOM 4885 OG SER B 291 38.267 23.021 -44.882 1.00173.21 O
ATOM 4886 N LEU B 292 38.126 26.574 -47.610 1.00174.60 N
ATOM 4887 CA LEU B 292 37.917 27.324 -48.845 1.00173.48 C
ATOM 4888 C LEU B 292 39.165 28.110 -49.229 1.00173.76 C
ATOM 4889 O LEU B 292 39.444 28.316 -50.410 1.00173.11 O
ATOM 4890 CB LEU B 292 36.720 28.266 -48.704 1.00173.05 C
ATOM 4891 CG LEU B 292 35.344 27.608 -48.563 1.00172.66 C
ATOM 4892 CD1 LEU B 292 34.246 28.662 -48.556 1.00172.78 C
ATOM 4893 CD2 LEU B 292 35.110 26.588 -49.668 1.00172.01 C
ATOM 4894 N ALA B 293 39.913 28.550 -48.221 1.00174.17 N
ATOM 4895 CA ALA B 293 41.168 29.255 -48.442 1.00174.00 C
ATOM 4896 C ALA B 293 42.196 28.327 -49.082 1.00175.20 C
ATOM 4897 O ALA B 293 42.965 28.742 -49.950 1.00175.68 O
ATOM 4898 CB ALA B 293 41.701 29.822 -47.133 1.00173.33 C
ATOM 4899 N SER B 294 42.201 27.069 -48.648 1.00175.56 N
ATOM 4900 CA SER B 294 43.101 26.060 -49.206 1.00175.39 C
ATOM 4901 C SER B 294 42.590 25.495 -50.535 1.00175.25 C
ATOM 4902 O SER B 294 42.889 24.354 -50.889 1.00175.63 O
ATOM 4903 CB SER B 294 43.310 24.919 -48.202 1.00174.50 C
ATOM 4904 OG SER B 294 42.085 24.283 -47.879 1.00174.26 O
ATOM 4905 N GLY B 295 41.823 26.300 -51.264 1.00174.81 N
ATOM 4906 CA GLY B 295 41.340 25.927 -52.581 1.00174.33 C
ATOM 4907 C GLY B 295 40.436 24.708 -52.625 1.00173.76 C
ATOM 4908 O GLY B 295 40.517 23.905 -53.555 1.00174.80 O
ATOM 4909 N ALA B 296 39.573 24.565 -51.625 1.00172.91 N
ATOM 4910 CA ALA B 296 38.583 23.494 -51.633 1.00173.23 C
ATOM 4911 C ALA B 296 37.226 24.038 -52.055 1.00172.72 C
ATOM 4912 O ALA B 296 36.976 25.240 -51.957 1.00172.54 O
ATOM 4913 CB ALA B 296 38.492 22.834 -50.268 1.00174.14 C
ATOM 4914 N THR B 297 36.350 23.154 -52.519 1.00172.92 N
ATOM 4915 CA THR B 297 35.011 23.559 -52.930 1.00173.03 C
ATOM 4916 C THR B 297 34.083 23.621 -51.726 1.00172.80 C
ATOM 4917 O THR B 297 34.439 23.177 -50.635 1.00173.20 O
ATOM 4918 CB THR B 297 34.418 22.598 -53.978 1.00173.22 C
ATOM 4919 OG1 THR B 297 34.261 21.295 -53.401 1.00172.87 O
ATOM 4920 CG2 THR B 297 35.326 22.509 -55.196 1.00173.95 C
ATOM 4921 N LEU B 298 32.896 24.184 -51.929 1.00172.50 N
ATOM 4922 CA LEU B 298 31.899 24.273 -50.870 1.00172.44 C
ATOM 4923 C LEU B 298 31.496 22.880 -50.397 1.00172.92 C
ATOM 4924 O LEU B 298 31.223 22.668 -49.216 1.00173.32 O
ATOM 4925 CB LEU B 298 30.676 25.055 -51.351 1.00172.07 C
ATOM 4926 CG LEU B 298 29.804 25.658 -50.250 1.00172.57 C
ATOM 4927 CD1 LEU B 298 30.662 26.422 -49.250 1.00173.00 C
ATOM 4928 CD2 LEU B 298 28.750 26.571 -50.849 1.00173.66 C
ATOM 4929 N GLU B 299 31.459 21.937 -51.333 1.00172.86 N
ATOM 4930 CA GLU B 299 31.202 20.537 -51.014 1.00173.26 C
ATOM 4931 C GLU B 299 32.266 19.978 -50.078 1.00172.74 C
ATOM 4932 O GLU B 299 31.960 19.507 -48.984 1.00172.66 O
ATOM 4933 CB GLU B 299 31.150 19.699 -52.293 1.00173.82 C
ATOM 4934 CG GLU B 299 29.963 19.991 -53.193 1.00174.67 C
ATOM 4935 CD GLU B 299 29.545 18.776 -53.997 1.00175.32 C
ATOM 4936 OE1 GLU B 299 30.438 18.030 -54.454 1.00175.12 O
ATOM 4937 OE2 GLU B 299 28.327 18.566 -54.171 1.00176.14 O
ATOM 4938 N GLU B 300 33.517 20.052 -50.521 1.00172.69 N
ATOM 4939 CA GLU B 300 34.648 19.507 -49.779 1.00173.03 C
ATOM 4940 C GLU B 300 34.782 20.136 -48.396 1.00173.77 C
ATOM 4941 O GLU B 300 35.031 19.439 -47.411 1.00174.38 O
ATOM 4942 CB GLU B 300 35.941 19.709 -50.570 1.00173.15 C
ATOM 4943 CG GLU B 300 35.944 19.026 -51.927 1.00173.24 C
ATOM 4944 CD GLU B 300 37.149 19.403 -52.760 1.00174.06 C
ATOM 4945 OE1 GLU B 300 37.396 20.615 -52.932 1.00173.70 O
ATOM 4946 OE2 GLU B 300 37.849 18.491 -53.244 1.00175.52 O
ATOM 4947 N ALA B 301 34.614 21.453 -48.333 1.00174.30 N
ATOM 4948 CA ALA B 301 34.711 22.195 -47.079 1.00174.43 C
ATOM 4949 C ALA B 301 33.750 21.661 -46.020 1.00173.25 C
ATOM 4950 O ALA B 301 34.169 21.238 -44.946 1.00173.68 O
ATOM 4951 CB ALA B 301 34.451 23.676 -47.324 1.00174.66 C
ATOM 4952 N TRP B 302 32.459 21.692 -46.331 1.00172.14 N
ATOM 4953 CA TRP B 302 31.434 21.226 -45.406 1.00172.05 C
ATOM 4954 C TRP B 302 31.530 19.729 -45.133 1.00172.42 C
ATOM 4955 O TRP B 302 31.193 19.271 -44.042 1.00172.73 O
ATOM 4956 CB TRP B 302 30.048 21.579 -45.941 1.00171.98 C
ATOM 4957 CG TRP B 302 29.736 23.024 -45.768 1.00172.66 C
ATOM 4958 CD1 TRP B 302 29.775 23.992 -46.727 1.00174.07 C
ATOM 4959 CD2 TRP B 302 29.354 23.677 -44.553 1.00172.66 C
ATOM 4960 NE1 TRP B 302 29.434 25.208 -46.186 1.00175.16 N
ATOM 4961 CE2 TRP B 302 29.170 25.041 -44.853 1.00174.13 C
ATOM 4962 CE3 TRP B 302 29.146 23.240 -43.243 1.00172.82 C
ATOM 4963 CZ2 TRP B 302 28.789 25.972 -43.888 1.00173.93 C
ATOM 4964 CZ3 TRP B 302 28.762 24.163 -42.291 1.00173.37 C
ATOM 4965 CH2 TRP B 302 28.591 25.512 -42.616 1.00173.15 C
ATOM 4966 N SER B 303 31.985 18.970 -46.124 1.00172.17 N
ATOM 4967 CA SER B 303 32.153 17.530 -45.961 1.00172.40 C
ATOM 4968 C SER B 303 33.245 17.211 -44.946 1.00172.84 C
ATOM 4969 O SER B 303 33.231 16.152 -44.319 1.00173.38 O
ATOM 4970 CB SER B 303 32.482 16.872 -47.301 1.00173.60 C
ATOM 4971 OG SER B 303 31.415 17.034 -48.220 1.00174.87 O
ATOM 4972 N ALA B 304 34.186 18.135 -44.786 1.00173.41 N
ATOM 4973 CA ALA B 304 35.295 17.950 -43.856 1.00174.15 C
ATOM 4974 C ALA B 304 34.845 18.099 -42.405 1.00174.37 C
ATOM 4975 O ALA B 304 35.478 17.567 -41.493 1.00174.44 O
ATOM 4976 CB ALA B 304 36.410 18.935 -44.165 1.00174.23 C
ATOM 4977 N ILE B 305 33.750 18.824 -42.200 1.00174.08 N
ATOM 4978 CA ILE B 305 33.202 19.031 -40.864 1.00173.03 C
ATOM 4979 C ILE B 305 32.725 17.716 -40.257 1.00173.00 C
ATOM 4980 O ILE B 305 31.784 17.102 -40.758 1.00173.58 O
ATOM 4981 CB ILE B 305 32.033 20.032 -40.884 1.00172.74 C
ATOM 4982 CG1 ILE B 305 32.513 21.401 -41.368 1.00173.54 C
ATOM 4983 CG2 ILE B 305 31.406 20.151 -39.503 1.00172.97 C
ATOM 4984 CD1 ILE B 305 33.418 22.115 -40.390 1.00173.14 C
ATOM 4985 N PRO B 306 33.386 17.272 -39.178 1.00172.47 N
ATOM 4986 CA PRO B 306 33.018 16.037 -38.479 1.00172.34 C
ATOM 4987 C PRO B 306 31.599 16.094 -37.923 1.00172.10 C
ATOM 4988 O PRO B 306 31.209 17.111 -37.350 1.00172.35 O
ATOM 4989 CB PRO B 306 34.049 15.958 -37.349 1.00174.21 C
ATOM 4990 CG PRO B 306 34.459 17.378 -37.126 1.00174.26 C
ATOM 4991 CD PRO B 306 34.487 17.973 -38.496 1.00172.98 C
ATOM 4992 N GLU B 307 30.844 15.014 -38.106 1.00171.67 N
ATOM 4993 CA GLU B 307 29.449 14.940 -37.677 1.00172.37 C
ATOM 4994 C GLU B 307 29.240 15.329 -36.216 1.00171.85 C
ATOM 4995 O GLU B 307 28.330 16.096 -35.898 1.00171.73 O
ATOM 4996 CB GLU B 307 28.899 13.532 -37.913 1.00173.15 C
ATOM 4997 CG GLU B 307 28.708 13.178 -39.378 1.00173.35 C
ATOM 4998 CD GLU B 307 27.724 12.042 -39.574 1.00173.14 C
ATOM 4999 OE1 GLU B 307 27.979 10.936 -39.053 1.00173.89 O
ATOM 5000 OE2 GLU B 307 26.692 12.255 -40.245 1.00172.09 O
ATOM 5001 N LYS B 308 30.078 14.790 -35.335 1.00171.75 N
ATOM 5002 CA LYS B 308 29.999 15.080 -33.907 1.00172.87 C
ATOM 5003 C LYS B 308 30.009 16.581 -33.632 1.00172.93 C
ATOM 5004 O LYS B 308 29.221 17.078 -32.829 1.00173.49 O
ATOM 5005 CB LYS B 308 31.154 14.407 -33.164 1.00173.84 C
ATOM 5006 CG LYS B 308 31.160 14.663 -31.667 1.00173.44 C
ATOM 5007 CD LYS B 308 31.211 13.360 -30.888 1.00173.71 C
ATOM 5008 CE LYS B 308 32.484 13.262 -30.063 1.00173.48 C
ATOM 5009 NZ LYS B 308 32.502 12.044 -29.205 1.00173.15 N
ATOM 5010 N LEU B 309 30.899 17.292 -34.315 1.00172.66 N
ATOM 5011 CA LEU B 309 31.040 18.734 -34.142 1.00173.02 C
ATOM 5012 C LEU B 309 29.761 19.454 -34.563 1.00172.67 C
ATOM 5013 O LEU B 309 29.313 20.388 -33.898 1.00172.82 O
ATOM 5014 CB LEU B 309 32.240 19.250 -34.942 1.00173.57 C
ATOM 5015 CG LEU B 309 32.929 20.555 -34.524 1.00173.90 C
ATOM 5016 CD1 LEU B 309 32.717 21.640 -35.567 1.00174.04 C
ATOM 5017 CD2 LEU B 309 32.469 21.032 -33.149 1.00174.70 C
ATOM 5018 N ALA B 310 29.180 19.010 -35.672 1.00172.26 N
ATOM 5019 CA ALA B 310 27.930 19.571 -36.168 1.00172.83 C
ATOM 5020 C ALA B 310 26.774 19.308 -35.208 1.00172.05 C
ATOM 5021 O ALA B 310 25.884 20.143 -35.048 1.00172.32 O
ATOM 5022 CB ALA B 310 27.611 19.010 -37.546 1.00173.89 C
ATOM 5023 N PHE B 311 26.794 18.140 -34.571 1.00171.73 N
ATOM 5024 CA PHE B 311 25.722 17.739 -33.665 1.00172.29 C
ATOM 5025 C PHE B 311 25.573 18.691 -32.481 1.00172.62 C
ATOM 5026 O PHE B 311 24.464 18.918 -31.998 1.00172.68 O
ATOM 5027 CB PHE B 311 25.957 16.315 -33.161 1.00173.39 C
ATOM 5028 CG PHE B 311 24.721 15.649 -32.632 1.00173.40 C
ATOM 5029 CD1 PHE B 311 23.507 15.798 -33.281 1.00172.94 C
ATOM 5030 CD2 PHE B 311 24.771 14.871 -31.487 1.00173.81 C
ATOM 5031 CE1 PHE B 311 22.366 15.186 -32.796 1.00172.90 C
ATOM 5032 CE2 PHE B 311 23.634 14.257 -30.998 1.00173.10 C
ATOM 5033 CZ PHE B 311 22.430 14.414 -31.654 1.00172.40 C
ATOM 5034 N TYR B 312 26.688 19.246 -32.017 1.00172.71 N
ATOM 5035 CA TYR B 312 26.659 20.189 -30.903 1.00172.69 C
ATOM 5036 C TYR B 312 25.964 21.492 -31.288 1.00173.16 C
ATOM 5037 O TYR B 312 25.497 22.232 -30.423 1.00173.63 O
ATOM 5038 CB TYR B 312 28.074 20.493 -30.409 1.00172.95 C
ATOM 5039 CG TYR B 312 28.763 19.342 -29.711 1.00173.57 C
ATOM 5040 CD1 TYR B 312 29.834 18.689 -30.303 1.00173.99 C
ATOM 5041 CD2 TYR B 312 28.350 18.917 -28.455 1.00174.03 C
ATOM 5042 CE1 TYR B 312 30.474 17.640 -29.669 1.00173.46 C
ATOM 5043 CE2 TYR B 312 28.983 17.868 -27.812 1.00174.19 C
ATOM 5044 CZ TYR B 312 30.044 17.234 -28.425 1.00173.66 C
ATOM 5045 OH TYR B 312 30.678 16.190 -27.791 1.00173.93 O
ATOM 5046 N ASP B 313 25.902 21.769 -32.586 1.00173.28 N
ATOM 5047 CA ASP B 313 25.282 22.993 -33.078 1.00173.41 C
ATOM 5048 C ASP B 313 23.804 22.759 -33.378 1.00173.03 C
ATOM 5049 O ASP B 313 23.278 23.224 -34.388 1.00173.32 O
ATOM 5050 CB ASP B 313 26.012 23.501 -34.326 1.00173.87 C
ATOM 5051 CG ASP B 313 25.699 24.953 -34.639 1.00173.71 C
ATOM 5052 OD1 ASP B 313 25.521 25.745 -33.689 1.00173.58 O
ATOM 5053 OD2 ASP B 313 25.631 25.303 -35.836 1.00173.64 O
ATOM 5054 N TYR B 314 23.143 22.026 -32.489 1.00173.29 N
ATOM 5055 CA TYR B 314 21.728 21.708 -32.638 1.00173.82 C
ATOM 5056 C TYR B 314 20.991 21.967 -31.325 1.00174.01 C
ATOM 5057 O TYR B 314 21.357 21.423 -30.283 1.00174.42 O
ATOM 5058 CB TYR B 314 21.554 20.253 -33.088 1.00173.86 C
ATOM 5059 CG TYR B 314 20.137 19.728 -33.008 1.00173.52 C
ATOM 5060 CD1 TYR B 314 19.080 20.426 -33.577 1.00173.56 C
ATOM 5061 CD2 TYR B 314 19.860 18.519 -32.383 1.00173.46 C
ATOM 5062 CE1 TYR B 314 17.785 19.944 -33.510 1.00173.33 C
ATOM 5063 CE2 TYR B 314 18.572 18.027 -32.314 1.00173.46 C
ATOM 5064 CZ TYR B 314 17.538 18.743 -32.877 1.00173.16 C
ATOM 5065 OH TYR B 314 16.254 18.255 -32.808 1.00173.37 O
ATOM 5066 N ILE B 315 19.954 22.800 -31.384 1.00173.89 N
ATOM 5067 CA ILE B 315 19.218 23.218 -30.191 1.00174.01 C
ATOM 5068 C ILE B 315 18.575 22.052 -29.437 1.00174.08 C
ATOM 5069 O ILE B 315 18.171 22.201 -28.284 1.00174.51 O
ATOM 5070 CB ILE B 315 18.118 24.247 -30.541 1.00173.65 C
ATOM 5071 CG1 ILE B 315 17.840 25.165 -29.349 1.00173.51 C
ATOM 5072 CG2 ILE B 315 16.843 23.547 -30.982 1.00173.78 C
ATOM 5073 CD1 ILE B 315 16.936 26.325 -29.676 1.00173.34 C
ATOM 5074 N GLY B 316 18.486 20.892 -30.080 1.00173.67 N
ATOM 5075 CA GLY B 316 17.904 19.723 -29.444 1.00173.43 C
ATOM 5076 C GLY B 316 18.852 19.077 -28.454 1.00172.75 C
ATOM 5077 O GLY B 316 18.553 18.031 -27.878 1.00172.51 O
ATOM 5078 N ASN B 317 20.004 19.708 -28.260 1.00172.21 N
ATOM 5079 CA ASN B 317 20.983 19.251 -27.290 1.00172.17 C
ATOM 5080 C ASN B 317 21.207 20.337 -26.250 1.00171.96 C
ATOM 5081 O ASN B 317 22.060 20.214 -25.372 1.00172.25 O
ATOM 5082 CB ASN B 317 22.296 18.881 -27.979 1.00173.22 C
ATOM 5083 CG ASN B 317 22.128 17.765 -28.994 1.00173.72 C
ATOM 5084 OD1 ASN B 317 21.812 16.630 -28.636 1.00173.30 O
ATOM 5085 ND2 ASN B 317 22.342 18.082 -30.264 1.00174.02 N
ATOM 5086 N ASN B 318 20.431 21.408 -26.372 1.00171.90 N
ATOM 5087 CA ASN B 318 20.456 22.507 -25.417 1.00173.27 C
ATOM 5088 C ASN B 318 19.639 22.153 -24.179 1.00172.95 C
ATOM 5089 O ASN B 318 18.440 21.894 -24.276 1.00173.19 O
ATOM 5090 CB ASN B 318 19.924 23.790 -26.072 1.00174.88 C
ATOM 5091 CG ASN B 318 20.115 25.025 -25.205 1.00175.31 C
ATOM 5092 OD1 ASN B 318 20.206 24.938 -23.982 1.00174.88 O
ATOM 5093 ND2 ASN B 318 20.168 26.188 -25.843 1.00175.01 N
ATOM 5094 N PRO B 319 20.291 22.136 -23.007 1.00172.80 N
ATOM 5095 CA PRO B 319 19.637 21.808 -21.735 1.00173.10 C
ATOM 5096 C PRO B 319 18.531 22.788 -21.354 1.00172.99 C
ATOM 5097 O PRO B 319 17.686 22.463 -20.520 1.00172.95 O
ATOM 5098 CB PRO B 319 20.789 21.880 -20.727 1.00174.06 C
ATOM 5099 CG PRO B 319 22.012 21.633 -21.542 1.00173.99 C
ATOM 5100 CD PRO B 319 21.740 22.332 -22.835 1.00173.07 C
ATOM 5101 N ALA B 320 18.536 23.968 -21.964 1.00173.08 N
ATOM 5102 CA ALA B 320 17.537 24.986 -21.663 1.00173.63 C
ATOM 5103 C ALA B 320 16.221 24.703 -22.382 1.00173.68 C
ATOM 5104 O ALA B 320 15.241 25.425 -22.205 1.00173.65 O
ATOM 5105 CB ALA B 320 18.060 26.367 -22.035 1.00173.85 C
ATOM 5106 N LYS B 321 16.204 23.655 -23.198 1.00173.87 N
ATOM 5107 CA LYS B 321 14.974 23.210 -23.840 1.00173.99 C
ATOM 5108 C LYS B 321 14.396 22.013 -23.092 1.00173.68 C
ATOM 5109 O LYS B 321 15.137 21.206 -22.530 1.00173.71 O
ATOM 5110 CB LYS B 321 15.227 22.856 -25.308 1.00174.61 C
ATOM 5111 CG LYS B 321 15.774 24.007 -26.139 1.00173.92 C
ATOM 5112 CD LYS B 321 14.755 25.129 -26.275 1.00172.84 C
ATOM 5113 CE LYS B 321 13.557 24.688 -27.099 1.00172.81 C
ATOM 5114 NZ LYS B 321 12.496 25.732 -27.146 1.00173.22 N
ATOM 5115 N GLY B 322 13.073 21.901 -23.081 1.00173.26 N
ATOM 5116 CA GLY B 322 12.421 20.804 -22.391 1.00173.76 C
ATOM 5117 C GLY B 322 11.396 21.264 -21.374 1.00174.58 C
ATOM 5118 O GLY B 322 11.052 22.445 -21.312 1.00174.93 O
ATOM 5119 N GLY B 323 10.908 20.323 -20.573 1.00174.77 N
ATOM 5120 CA GLY B 323 9.894 20.614 -19.577 1.00174.23 C
ATOM 5121 C GLY B 323 10.039 19.762 -18.332 1.00173.56 C
ATOM 5122 O GLY B 323 10.705 18.726 -18.350 1.00173.85 O
ATOM 5123 N LEU B 324 9.407 20.198 -17.247 1.00173.21 N
ATOM 5124 CA LEU B 324 9.536 19.530 -15.956 1.00173.39 C
ATOM 5125 C LEU B 324 8.983 18.108 -15.972 1.00173.13 C
ATOM 5126 O LEU B 324 9.538 17.212 -15.337 1.00172.95 O
ATOM 5127 CB LEU B 324 8.833 20.342 -14.866 1.00173.77 C
ATOM 5128 CG LEU B 324 8.920 19.780 -13.445 1.00173.29 C
ATOM 5129 CD1 LEU B 324 10.365 19.707 -12.976 1.00173.85 C
ATOM 5130 CD2 LEU B 324 8.084 20.612 -12.484 1.00173.48 C
ATOM 5131 N PHE B 325 7.893 17.904 -16.702 1.00172.80 N
ATOM 5132 CA PHE B 325 7.255 16.595 -16.753 1.00172.49 C
ATOM 5133 C PHE B 325 7.434 15.939 -18.112 1.00172.10 C
ATOM 5134 O PHE B 325 6.695 15.026 -18.478 1.00171.67 O
ATOM 5135 CB PHE B 325 5.772 16.716 -16.416 1.00172.89 C
ATOM 5136 CG PHE B 325 5.510 17.182 -15.014 1.00173.12 C
ATOM 5137 CD1 PHE B 325 5.618 16.303 -13.951 1.00173.66 C
ATOM 5138 CD2 PHE B 325 5.159 18.497 -14.760 1.00173.37 C
ATOM 5139 CE1 PHE B 325 5.379 16.727 -12.659 1.00173.98 C
ATOM 5140 CE2 PHE B 325 4.918 18.927 -13.470 1.00172.79 C
ATOM 5141 CZ PHE B 325 5.028 18.040 -12.418 1.00173.68 C
ATOM 5142 N ARG B 326 8.427 16.412 -18.855 1.00172.44 N
ATOM 5143 CA ARG B 326 8.801 15.792 -20.116 1.00172.94 C
ATOM 5144 C ARG B 326 9.839 14.717 -19.827 1.00173.02 C
ATOM 5145 O ARG B 326 11.028 14.886 -20.101 1.00173.84 O
ATOM 5146 CB ARG B 326 9.339 16.833 -21.097 1.00173.42 C
ATOM 5147 CG ARG B 326 8.259 17.733 -21.686 1.00174.26 C
ATOM 5148 CD ARG B 326 8.835 18.720 -22.692 1.00174.31 C
ATOM 5149 NE ARG B 326 7.878 19.768 -23.043 1.00173.09 N
ATOM 5150 CZ ARG B 326 8.195 20.874 -23.708 1.00172.44 C
ATOM 5151 NH1 ARG B 326 9.445 21.079 -24.101 1.00173.14 N
ATOM 5152 NH2 ARG B 326 7.264 21.777 -23.981 1.00171.82 N
ATOM 5153 N THR B 327 9.371 13.606 -19.272 1.00172.36 N
ATOM 5154 CA THR B 327 10.248 12.575 -18.735 1.00172.82 C
ATOM 5155 C THR B 327 10.976 11.781 -19.814 1.00173.84 C
ATOM 5156 O THR B 327 10.655 11.876 -20.998 1.00174.35 O
ATOM 5157 CB THR B 327 9.459 11.596 -17.854 1.00172.79 C
ATOM 5158 OG1 THR B 327 8.393 11.015 -18.616 1.00172.04 O
ATOM 5159 CG2 THR B 327 8.878 12.323 -16.656 1.00173.04 C
ATOM 5160 N GLY B 328 11.957 10.992 -19.383 1.00174.10 N
ATOM 5161 CA GLY B 328 12.719 10.134 -20.275 1.00174.16 C
ATOM 5162 C GLY B 328 13.949 10.802 -20.861 1.00174.39 C
ATOM 5163 O GLY B 328 14.260 11.945 -20.525 1.00174.50 O
ATOM 5164 N PRO B 329 14.661 10.088 -21.748 1.00174.10 N
ATOM 5165 CA PRO B 329 15.877 10.587 -22.393 1.00173.93 C
ATOM 5166 C PRO B 329 15.568 11.621 -23.468 1.00173.49 C
ATOM 5167 O PRO B 329 14.402 11.851 -23.779 1.00173.59 O
ATOM 5168 CB PRO B 329 16.475 9.325 -23.013 1.00174.14 C
ATOM 5169 CG PRO B 329 15.279 8.517 -23.367 1.00174.10 C
ATOM 5170 CD PRO B 329 14.310 8.739 -22.229 1.00173.74 C
ATOM 5171 N MET B 330 16.603 12.232 -24.029 1.00173.32 N
ATOM 5172 CA MET B 330 16.417 13.213 -25.087 1.00173.90 C
ATOM 5173 C MET B 330 15.931 12.546 -26.370 1.00173.88 C
ATOM 5174 O MET B 330 15.374 13.202 -27.250 1.00174.20 O
ATOM 5175 CB MET B 330 17.718 13.972 -25.343 1.00174.90 C
ATOM 5176 CG MET B 330 18.179 14.809 -24.165 1.00175.04 C
ATOM 5177 SD MET B 330 19.732 15.663 -24.491 1.00179.58 S
ATOM 5178 CE MET B 330 19.156 17.344 -24.712 1.00175.08 C
ATOM 5179 N ASN B 331 16.144 11.238 -26.465 1.00173.54 N
ATOM 5180 CA ASN B 331 15.749 10.474 -27.644 1.00173.55 C
ATOM 5181 C ASN B 331 14.244 10.234 -27.718 1.00173.22 C
ATOM 5182 O ASN B 331 13.715 9.902 -28.777 1.00173.43 O
ATOM 5183 CB ASN B 331 16.490 9.138 -27.678 1.00173.61 C
ATOM 5184 CG ASN B 331 17.963 9.298 -27.985 1.00173.81 C
ATOM 5185 OD1 ASN B 331 18.361 10.204 -28.718 1.00173.96 O
ATOM 5186 ND2 ASN B 331 18.784 8.419 -27.425 1.00174.11 N
ATOM 5187 N LYS B 332 13.556 10.394 -26.593 1.00172.66 N
ATOM 5188 CA LYS B 332 12.103 10.280 -26.582 1.00172.44 C
ATOM 5189 C LYS B 332 11.498 11.535 -27.202 1.00172.95 C
ATOM 5190 O LYS B 332 10.315 11.574 -27.542 1.00173.40 O
ATOM 5191 CB LYS B 332 11.585 10.070 -25.156 1.00173.47 C
ATOM 5192 CG LYS B 332 10.093 9.785 -25.052 1.00173.84 C
ATOM 5193 CD LYS B 332 9.721 8.497 -25.766 1.00174.03 C
ATOM 5194 CE LYS B 332 8.321 8.034 -25.384 1.00173.59 C
ATOM 5195 NZ LYS B 332 7.274 9.022 -25.774 1.00173.19 N
ATOM 5196 N GLY B 333 12.333 12.556 -27.363 1.00173.00 N
ATOM 5197 CA GLY B 333 11.910 13.801 -27.971 1.00173.35 C
ATOM 5198 C GLY B 333 12.040 13.783 -29.479 1.00173.32 C
ATOM 5199 O GLY B 333 11.178 13.252 -30.176 1.00173.35 O
ATOM 5200 N ASP B 334 13.130 14.354 -29.984 1.00172.92 N
ATOM 5201 CA ASP B 334 13.342 14.457 -31.422 1.00172.93 C
ATOM 5202 C ASP B 334 13.667 13.109 -32.058 1.00173.18 C
ATOM 5203 O ASP B 334 13.591 12.957 -33.276 1.00173.63 O
ATOM 5204 CB ASP B 334 14.460 15.457 -31.720 1.00173.01 C
ATOM 5205 CG ASP B 334 15.632 15.322 -30.770 1.00172.87 C
ATOM 5206 OD1 ASP B 334 15.763 14.256 -30.133 1.00172.68 O
ATOM 5207 OD2 ASP B 334 16.416 16.286 -30.654 1.00173.03 O
ATOM 5208 N GLY B 335 14.026 12.132 -31.232 1.00173.04 N
ATOM 5209 CA GLY B 335 14.349 10.807 -31.724 1.00173.06 C
ATOM 5210 C GLY B 335 15.838 10.525 -31.722 1.00172.37 C
ATOM 5211 O GLY B 335 16.647 11.422 -31.489 1.00172.34 O
ATOM 5212 N ILE B 336 16.197 9.272 -31.978 1.00172.36 N
ATOM 5213 CA ILE B 336 17.597 8.874 -32.034 1.00172.89 C
ATOM 5214 C ILE B 336 18.259 9.410 -33.299 1.00172.88 C
ATOM 5215 O ILE B 336 17.836 9.096 -34.411 1.00172.93 O
ATOM 5216 CB ILE B 336 17.756 7.341 -31.992 1.00173.66 C
ATOM 5217 CG1 ILE B 336 17.019 6.757 -30.787 1.00173.78 C
ATOM 5218 CG2 ILE B 336 19.228 6.962 -31.947 1.00174.01 C
ATOM 5219 CD1 ILE B 336 16.945 5.243 -30.794 1.00173.87 C
ATOM 5220 N ALA B 337 19.289 10.231 -33.118 1.00172.74 N
ATOM 5221 CA ALA B 337 20.023 10.804 -34.240 1.00172.73 C
ATOM 5222 C ALA B 337 20.713 9.718 -35.060 1.00173.65 C
ATOM 5223 O ALA B 337 21.453 8.897 -34.518 1.00174.53 O
ATOM 5224 CB ALA B 337 21.038 11.818 -33.745 1.00172.98 C
ATOM 5225 N GLN B 338 20.470 9.718 -36.366 1.00173.81 N
ATOM 5226 CA GLN B 338 21.037 8.703 -37.244 1.00173.96 C
ATOM 5227 C GLN B 338 22.197 9.247 -38.073 1.00173.61 C
ATOM 5228 O GLN B 338 23.257 8.627 -38.148 1.00173.89 O
ATOM 5229 CB GLN B 338 19.959 8.132 -38.170 1.00174.22 C
ATOM 5230 CG GLN B 338 18.816 7.444 -37.444 1.00173.96 C
ATOM 5231 CD GLN B 338 19.274 6.226 -36.664 1.00173.92 C
ATOM 5232 OE1 GLN B 338 19.727 5.238 -37.242 1.00173.41 O
ATOM 5233 NE2 GLN B 338 19.151 6.290 -35.343 1.00174.35 N
ATOM 5234 N ALA B 339 21.996 10.409 -38.685 1.00172.36 N
ATOM 5235 CA ALA B 339 23.010 10.989 -39.557 1.00172.24 C
ATOM 5236 C ALA B 339 22.799 12.485 -39.760 1.00172.34 C
ATOM 5237 O ALA B 339 21.717 13.012 -39.507 1.00172.18 O
ATOM 5238 CB ALA B 339 23.021 10.275 -40.900 1.00173.31 C
ATOM 5239 N TRP B 340 23.849 13.158 -40.217 1.00172.76 N
ATOM 5240 CA TRP B 340 23.785 14.582 -40.517 1.00173.59 C
ATOM 5241 C TRP B 340 23.323 14.801 -41.954 1.00173.74 C
ATOM 5242 O TRP B 340 24.028 14.448 -42.900 1.00173.54 O
ATOM 5243 CB TRP B 340 25.149 15.241 -40.286 1.00173.66 C
ATOM 5244 CG TRP B 340 25.180 16.714 -40.573 1.00174.06 C
ATOM 5245 CD1 TRP B 340 24.169 17.612 -40.378 1.00174.00 C
ATOM 5246 CD2 TRP B 340 26.283 17.462 -41.100 1.00174.03 C
ATOM 5247 NE1 TRP B 340 24.574 18.870 -40.755 1.00173.36 N
ATOM 5248 CE2 TRP B 340 25.868 18.805 -41.200 1.00173.67 C
ATOM 5249 CE3 TRP B 340 27.580 17.126 -41.498 1.00174.44 C
ATOM 5250 CZ2 TRP B 340 26.702 19.811 -41.685 1.00174.15 C
ATOM 5251 CZ3 TRP B 340 28.408 18.126 -41.977 1.00174.56 C
ATOM 5252 CH2 TRP B 340 27.966 19.452 -42.066 1.00174.52 C
ATOM 5253 N LYS B 341 22.133 15.375 -42.111 1.00173.58 N
ATOM 5254 CA LYS B 341 21.589 15.656 -43.435 1.00173.29 C
ATOM 5255 C LYS B 341 22.485 16.623 -44.198 1.00173.65 C
ATOM 5256 O LYS B 341 22.547 16.588 -45.428 1.00174.20 O
ATOM 5257 CB LYS B 341 20.172 16.225 -43.334 1.00173.47 C
ATOM 5258 CG LYS B 341 19.093 15.178 -43.123 1.00173.65 C
ATOM 5259 CD LYS B 341 17.752 15.820 -42.803 1.00173.46 C
ATOM 5260 CE LYS B 341 16.640 14.782 -42.754 1.00173.22 C
ATOM 5261 NZ LYS B 341 16.309 14.258 -44.108 1.00172.79 N
ATOM 5262 N GLY B 342 23.178 17.484 -43.462 1.00173.32 N
ATOM 5263 CA GLY B 342 24.107 18.420 -44.064 1.00173.43 C
ATOM 5264 C GLY B 342 23.748 19.873 -43.839 1.00173.42 C
ATOM 5265 O GLY B 342 22.642 20.191 -43.402 1.00173.34 O
ATOM 5266 N HIS B 343 24.694 20.757 -44.137 1.00173.73 N
ATOM 5267 CA HIS B 343 24.476 22.190 -43.989 1.00173.97 C
ATOM 5268 C HIS B 343 23.531 22.699 -45.067 1.00174.31 C
ATOM 5269 O HIS B 343 23.728 22.431 -46.252 1.00174.33 O
ATOM 5270 CB HIS B 343 25.798 22.951 -44.057 1.00173.45 C
ATOM 5271 CG HIS B 343 25.646 24.429 -43.883 1.00173.55 C
ATOM 5272 ND1 HIS B 343 25.370 25.010 -42.664 1.00172.90 N
ATOM 5273 CD2 HIS B 343 25.707 25.444 -44.776 1.00174.35 C
ATOM 5274 CE1 HIS B 343 25.282 26.320 -42.812 1.00172.91 C
ATOM 5275 NE2 HIS B 343 25.483 26.609 -44.084 1.00174.03 N
ATOM 5276 N ALA B 344 22.508 23.438 -44.653 1.00174.03 N
ATOM 5277 CA ALA B 344 21.522 23.962 -45.588 1.00174.14 C
ATOM 5278 C ALA B 344 21.816 25.413 -45.954 1.00173.93 C
ATOM 5279 O ALA B 344 21.883 26.281 -45.085 1.00173.33 O
ATOM 5280 CB ALA B 344 20.123 23.837 -45.004 1.00173.79 C
ATOM 5281 N VAL B 345 21.993 25.666 -47.247 1.00173.69 N
ATOM 5282 CA VAL B 345 22.210 27.019 -47.739 1.00173.05 C
ATOM 5283 C VAL B 345 20.985 27.490 -48.508 1.00172.56 C
ATOM 5284 O VAL B 345 20.594 26.883 -49.504 1.00172.89 O
ATOM 5285 CB VAL B 345 23.450 27.107 -48.645 1.00174.08 C
ATOM 5286 CG1 VAL B 345 23.540 28.484 -49.288 1.00174.70 C
ATOM 5287 CG2 VAL B 345 24.711 26.799 -47.851 1.00174.34 C
ATOM 5288 N PHE B 346 20.374 28.569 -48.036 1.00171.56 N
ATOM 5289 CA PHE B 346 19.159 29.077 -48.652 1.00172.52 C
ATOM 5290 C PHE B 346 19.449 30.251 -49.575 1.00173.74 C
ATOM 5291 O PHE B 346 20.191 31.165 -49.219 1.00173.76 O
ATOM 5292 CB PHE B 346 18.152 29.481 -47.577 1.00172.44 C
ATOM 5293 CG PHE B 346 17.726 28.345 -46.697 1.00172.70 C
ATOM 5294 CD1 PHE B 346 16.570 27.636 -46.974 1.00173.11 C
ATOM 5295 CD2 PHE B 346 18.487 27.975 -45.600 1.00173.72 C
ATOM 5296 CE1 PHE B 346 16.176 26.587 -46.170 1.00173.56 C
ATOM 5297 CE2 PHE B 346 18.099 26.925 -44.793 1.00174.62 C
ATOM 5298 CZ PHE B 346 16.941 26.231 -45.079 1.00174.43 C
ATOM 5299 N ARG B 347 18.854 30.218 -50.763 1.00174.25 N
ATOM 5300 CA ARG B 347 19.039 31.272 -51.749 1.00174.54 C
ATOM 5301 C ARG B 347 17.712 31.670 -52.383 1.00173.94 C
ATOM 5302 O ARG B 347 16.763 30.887 -52.395 1.00173.46 O
ATOM 5303 CB ARG B 347 20.021 30.834 -52.841 1.00174.70 C
ATOM 5304 CG ARG B 347 21.426 30.497 -52.353 1.00174.18 C
ATOM 5305 CD ARG B 347 22.385 30.334 -53.526 1.00173.39 C
ATOM 5306 NE ARG B 347 23.762 30.098 -53.098 1.00171.63 N
ATOM 5307 CZ ARG B 347 24.296 28.894 -52.926 1.00171.14 C
ATOM 5308 NH1 ARG B 347 23.570 27.808 -53.151 1.00170.96 N
ATOM 5309 NH2 ARG B 347 25.557 28.774 -52.537 1.00170.92 N
ATOM 5310 N ASN B 348 17.658 32.887 -52.917 1.00174.14 N
ATOM 5311 CA ASN B 348 16.475 33.368 -53.621 1.00173.94 C
ATOM 5312 C ASN B 348 16.787 33.604 -55.094 1.00173.88 C
ATOM 5313 O ASN B 348 17.949 33.549 -55.496 1.00174.11 O
ATOM 5314 CB ASN B 348 15.938 34.649 -52.977 1.00173.79 C
ATOM 5315 CG ASN B 348 16.732 35.881 -53.370 1.00173.77 C
ATOM 5316 OD1 ASN B 348 17.960 35.845 -53.459 1.00173.37 O
ATOM 5317 ND2 ASN B 348 16.029 36.983 -53.606 1.00173.34 N
ATOM 5318 N LYS B 349 15.742 33.836 -55.888 1.00173.47 N
ATOM 5319 CA LYS B 349 15.854 34.053 -57.335 1.00174.09 C
ATOM 5320 C LYS B 349 17.071 34.874 -57.781 1.00174.24 C
ATOM 5321 O LYS B 349 17.700 34.557 -58.790 1.00174.43 O
ATOM 5322 CB LYS B 349 14.576 34.718 -57.862 1.00174.64 C
ATOM 5323 CG LYS B 349 14.050 35.858 -57.005 1.00174.43 C
ATOM 5324 CD LYS B 349 12.993 36.663 -57.750 1.00173.98 C
ATOM 5325 CE LYS B 349 11.869 35.777 -58.267 1.00173.27 C
ATOM 5326 NZ LYS B 349 11.132 35.099 -57.164 1.00173.74 N
ATOM 5327 N GLU B 350 17.401 35.922 -57.031 1.00174.29 N
ATOM 5328 CA GLU B 350 18.552 36.759 -57.366 1.00174.95 C
ATOM 5329 C GLU B 350 19.889 36.079 -57.061 1.00175.11 C
ATOM 5330 O GLU B 350 20.948 36.611 -57.395 1.00176.67 O
ATOM 5331 CB GLU B 350 18.481 38.101 -56.625 1.00174.70 C
ATOM 5332 CG GLU B 350 17.655 39.173 -57.324 1.00173.87 C
ATOM 5333 CD GLU B 350 16.201 38.786 -57.477 1.00173.90 C
ATOM 5334 OE1 GLU B 350 15.515 38.636 -56.444 1.00173.96 O
ATOM 5335 OE2 GLU B 350 15.745 38.631 -58.630 1.00173.91 O
ATOM 5336 N GLY B 351 19.845 34.911 -56.429 1.00173.95 N
ATOM 5337 CA GLY B 351 21.061 34.194 -56.092 1.00173.54 C
ATOM 5338 C GLY B 351 21.598 34.542 -54.717 1.00172.87 C
ATOM 5339 O GLY B 351 22.481 33.857 -54.200 1.00173.40 O
ATOM 5340 N GLU B 352 21.075 35.618 -54.133 1.00172.11 N
ATOM 5341 CA GLU B 352 21.474 36.050 -52.798 1.00172.03 C
ATOM 5342 C GLU B 352 21.327 34.923 -51.785 1.00173.28 C
ATOM 5343 O GLU B 352 20.337 34.195 -51.802 1.00173.72 O
ATOM 5344 CB GLU B 352 20.641 37.250 -52.348 1.00171.73 C
ATOM 5345 CG GLU B 352 20.727 38.453 -53.262 1.00173.09 C
ATOM 5346 CD GLU B 352 19.799 39.568 -52.826 1.00174.36 C
ATOM 5347 OE1 GLU B 352 19.893 39.996 -51.657 1.00174.19 O
ATOM 5348 OE2 GLU B 352 18.974 40.013 -53.652 1.00175.44 O
ATOM 5349 N GLU B 353 22.310 34.784 -50.903 1.00173.86 N
ATOM 5350 CA GLU B 353 22.248 33.773 -49.856 1.00173.75 C
ATOM 5351 C GLU B 353 21.517 34.314 -48.632 1.00174.00 C
ATOM 5352 O GLU B 353 21.877 35.366 -48.102 1.00174.10 O
ATOM 5353 CB GLU B 353 23.650 33.310 -49.466 1.00173.00 C
ATOM 5354 CG GLU B 353 23.728 32.661 -48.092 1.00173.84 C
ATOM 5355 CD GLU B 353 25.035 31.927 -47.866 1.00174.03 C
ATOM 5356 OE1 GLU B 353 26.068 32.370 -48.409 1.00173.59 O
ATOM 5357 OE2 GLU B 353 25.028 30.907 -47.145 1.00174.08 O
ATOM 5358 N LEU B 354 20.492 33.595 -48.188 1.00173.51 N
ATOM 5359 CA LEU B 354 19.732 34.001 -47.010 1.00173.23 C
ATOM 5360 C LEU B 354 20.160 33.210 -45.783 1.00173.13 C
ATOM 5361 O LEU B 354 20.840 32.189 -45.894 1.00173.04 O
ATOM 5362 CB LEU B 354 18.227 33.828 -47.243 1.00173.53 C
ATOM 5363 CG LEU B 354 17.566 34.657 -48.348 1.00173.76 C
ATOM 5364 CD1 LEU B 354 18.226 36.022 -48.472 1.00174.32 C
ATOM 5365 CD2 LEU B 354 17.582 33.923 -49.679 1.00174.03 C
ATOM 5366 N PHE B 355 19.748 33.687 -44.614 1.00173.40 N
ATOM 5367 CA PHE B 355 20.103 33.043 -43.357 1.00173.54 C
ATOM 5368 C PHE B 355 18.891 32.917 -42.442 1.00173.50 C
ATOM 5369 O PHE B 355 18.123 33.866 -42.275 1.00173.29 O
ATOM 5370 CB PHE B 355 21.215 33.821 -42.652 1.00173.88 C
ATOM 5371 CG PHE B 355 22.497 33.883 -43.433 1.00173.96 C
ATOM 5372 CD1 PHE B 355 23.413 32.847 -43.367 1.00173.97 C
ATOM 5373 CD2 PHE B 355 22.783 34.976 -44.235 1.00174.26 C
ATOM 5374 CE1 PHE B 355 24.593 32.899 -44.085 1.00174.20 C
ATOM 5375 CE2 PHE B 355 23.961 35.034 -44.955 1.00174.98 C
ATOM 5376 CZ PHE B 355 24.867 33.994 -44.880 1.00175.21 C
ATOM 5377 N VAL B 356 18.726 31.740 -41.854 1.00173.39 N
ATOM 5378 CA VAL B 356 17.589 31.468 -40.988 1.00173.28 C
ATOM 5379 C VAL B 356 17.847 31.962 -39.570 1.00173.38 C
ATOM 5380 O VAL B 356 18.829 31.573 -38.937 1.00173.27 O
ATOM 5381 CB VAL B 356 17.265 29.967 -40.943 1.00173.67 C
ATOM 5382 CG1 VAL B 356 15.897 29.742 -40.319 1.00174.53 C
ATOM 5383 CG2 VAL B 356 17.325 29.373 -42.338 1.00173.67 C
ATOM 5384 N ARG B 357 16.964 32.825 -39.076 1.00173.30 N
ATOM 5385 CA ARG B 357 17.065 33.315 -37.708 1.00173.04 C
ATOM 5386 C ARG B 357 16.822 32.169 -36.731 1.00173.00 C
ATOM 5387 O ARG B 357 15.732 31.598 -36.692 1.00173.39 O
ATOM 5388 CB ARG B 357 16.067 34.446 -37.465 1.00173.41 C
ATOM 5389 CG ARG B 357 16.170 35.091 -36.091 1.00172.99 C
ATOM 5390 CD ARG B 357 17.529 35.740 -35.887 1.00171.82 C
ATOM 5391 NE ARG B 357 17.554 36.607 -34.713 1.00171.75 N
ATOM 5392 CZ ARG B 357 17.789 36.183 -33.475 1.00172.99 C
ATOM 5393 NH1 ARG B 357 18.021 34.899 -33.246 1.00174.09 N
ATOM 5394 NH2 ARG B 357 17.794 37.044 -32.467 1.00173.30 N
ATOM 5395 N ARG B 358 17.842 31.838 -35.946 1.00172.76 N
ATOM 5396 CA ARG B 358 17.773 30.695 -35.040 1.00173.37 C
ATOM 5397 C ARG B 358 16.825 30.940 -33.869 1.00173.42 C
ATOM 5398 O ARG B 358 16.473 32.079 -33.565 1.00173.80 O
ATOM 5399 CB ARG B 358 19.170 30.348 -34.517 1.00174.27 C
ATOM 5400 CG ARG B 358 20.092 29.742 -35.567 1.00174.98 C
ATOM 5401 CD ARG B 358 21.294 29.063 -34.925 1.00175.32 C
ATOM 5402 NE ARG B 358 22.112 28.351 -35.905 1.00175.02 N
ATOM 5403 CZ ARG B 358 23.191 27.637 -35.603 1.00174.39 C
ATOM 5404 NH1 ARG B 358 23.591 27.535 -34.342 1.00174.35 N
ATOM 5405 NH2 ARG B 358 23.873 27.025 -36.561 1.00173.92 N
ATOM 5406 N MET B 359 16.414 29.855 -33.221 1.00173.21 N
ATOM 5407 CA MET B 359 15.488 29.929 -32.098 1.00172.88 C
ATOM 5408 C MET B 359 16.214 30.164 -30.783 1.00173.02 C
ATOM 5409 O MET B 359 17.112 29.406 -30.421 1.00173.08 O
ATOM 5410 CB MET B 359 14.663 28.646 -31.998 1.00172.93 C
ATOM 5411 CG MET B 359 13.950 28.465 -30.669 1.00172.39 C
ATOM 5412 SD MET B 359 13.147 26.858 -30.530 1.00170.21 S
ATOM 5413 CE MET B 359 11.595 27.171 -31.364 1.00172.89 C
ATOM 5414 N PRO B 360 15.833 31.226 -30.064 1.00173.47 N
ATOM 5415 CA PRO B 360 16.322 31.420 -28.699 1.00174.10 C
ATOM 5416 C PRO B 360 15.714 30.385 -27.757 1.00173.97 C
ATOM 5417 O PRO B 360 14.540 30.047 -27.916 1.00173.62 O
ATOM 5418 CB PRO B 360 15.845 32.835 -28.353 1.00174.25 C
ATOM 5419 CG PRO B 360 15.633 33.498 -29.684 1.00174.02 C
ATOM 5420 CD PRO B 360 15.098 32.404 -30.551 1.00173.84 C
ATOM 5421 N ALA B 361 16.505 29.887 -26.810 1.00174.38 N
ATOM 5422 CA ALA B 361 16.058 28.869 -25.858 1.00173.69 C
ATOM 5423 C ALA B 361 14.743 29.231 -25.173 1.00172.89 C
ATOM 5424 O ALA B 361 13.949 28.354 -24.831 1.00172.97 O
ATOM 5425 CB ALA B 361 17.138 28.626 -24.813 1.00173.55 C
ATOM 5426 N PHE B 362 14.524 30.527 -24.975 1.00172.02 N
ATOM 5427 CA PHE B 362 13.311 31.032 -24.340 1.00172.30 C
ATOM 5428 C PHE B 362 12.029 30.604 -25.047 1.00172.78 C
ATOM 5429 O PHE B 362 11.013 30.344 -24.401 1.00172.68 O
ATOM 5430 CB PHE B 362 13.360 32.559 -24.268 1.00172.68 C
ATOM 5431 CG PHE B 362 13.663 33.090 -22.901 1.00172.62 C
ATOM 5432 CD1 PHE B 362 13.268 32.395 -21.772 1.00173.12 C
ATOM 5433 CD2 PHE B 362 14.343 34.285 -22.744 1.00173.29 C
ATOM 5434 CE1 PHE B 362 13.545 32.883 -20.510 1.00173.62 C
ATOM 5435 CE2 PHE B 362 14.623 34.776 -21.486 1.00173.94 C
ATOM 5436 CZ PHE B 362 14.223 34.075 -20.367 1.00173.91 C
ATOM 5437 N PHE B 363 12.080 30.530 -26.373 1.00173.31 N
ATOM 5438 CA PHE B 363 10.877 30.316 -27.173 1.00174.03 C
ATOM 5439 C PHE B 363 10.559 28.842 -27.397 1.00173.91 C
ATOM 5440 O PHE B 363 11.397 28.077 -27.877 1.00174.03 O
ATOM 5441 CB PHE B 363 11.008 31.017 -28.527 1.00174.39 C
ATOM 5442 CG PHE B 363 11.124 32.511 -28.429 1.00174.16 C
ATOM 5443 CD1 PHE B 363 10.004 33.317 -28.554 1.00173.66 C
ATOM 5444 CD2 PHE B 363 12.352 33.110 -28.209 1.00173.95 C
ATOM 5445 CE1 PHE B 363 10.110 34.692 -28.463 1.00173.24 C
ATOM 5446 CE2 PHE B 363 12.466 34.483 -28.118 1.00173.90 C
ATOM 5447 CZ PHE B 363 11.342 35.274 -28.245 1.00173.57 C
ATOM 5448 N GLU B 364 9.339 28.453 -27.041 1.00173.77 N
ATOM 5449 CA GLU B 364 8.835 27.122 -27.355 1.00173.78 C
ATOM 5450 C GLU B 364 8.633 26.995 -28.860 1.00173.17 C
ATOM 5451 O GLU B 364 8.975 25.978 -29.462 1.00173.28 O
ATOM 5452 CB GLU B 364 7.522 26.845 -26.617 1.00174.43 C
ATOM 5453 CG GLU B 364 7.675 26.583 -25.125 1.00174.61 C
ATOM 5454 CD GLU B 364 8.446 25.310 -24.827 1.00173.85 C
ATOM 5455 OE1 GLU B 364 8.262 24.314 -25.560 1.00173.76 O
ATOM 5456 OE2 GLU B 364 9.229 25.301 -23.854 1.00173.78 O
ATOM 5457 N SER B 365 8.078 28.043 -29.459 1.00172.78 N
ATOM 5458 CA SER B 365 7.873 28.098 -30.902 1.00173.02 C
ATOM 5459 C SER B 365 8.435 29.397 -31.464 1.00172.90 C
ATOM 5460 O SER B 365 8.395 30.436 -30.805 1.00172.97 O
ATOM 5461 CB SER B 365 6.388 27.970 -31.243 1.00173.44 C
ATOM 5462 OG SER B 365 5.665 29.101 -30.787 1.00173.97 O
ATOM 5463 N PHE B 366 8.956 29.336 -32.685 1.00172.88 N
ATOM 5464 CA PHE B 366 9.606 30.491 -33.292 1.00173.14 C
ATOM 5465 C PHE B 366 9.274 30.569 -34.778 1.00173.18 C
ATOM 5466 O PHE B 366 9.207 29.544 -35.452 1.00173.46 O
ATOM 5467 CB PHE B 366 11.121 30.411 -33.080 1.00174.06 C
ATOM 5468 CG PHE B 366 11.839 31.715 -33.285 1.00173.81 C
ATOM 5469 CD1 PHE B 366 11.775 32.713 -32.327 1.00173.44 C
ATOM 5470 CD2 PHE B 366 12.589 31.936 -34.427 1.00174.12 C
ATOM 5471 CE1 PHE B 366 12.438 33.911 -32.507 1.00172.25 C
ATOM 5472 CE2 PHE B 366 13.254 33.134 -34.613 1.00174.17 C
ATOM 5473 CZ PHE B 366 13.178 34.122 -33.651 1.00172.93 C
ATOM 5474 N PRO B 367 9.064 31.790 -35.293 1.00173.16 N
ATOM 5475 CA PRO B 367 8.715 31.986 -36.704 1.00173.28 C
ATOM 5476 C PRO B 367 9.911 31.827 -37.641 1.00173.23 C
ATOM 5477 O PRO B 367 11.054 32.027 -37.230 1.00173.60 O
ATOM 5478 CB PRO B 367 8.195 33.423 -36.726 1.00173.20 C
ATOM 5479 CG PRO B 367 8.953 34.092 -35.633 1.00173.42 C
ATOM 5480 CD PRO B 367 9.021 33.058 -34.544 1.00172.81 C
ATOM 5481 N VAL B 368 9.638 31.474 -38.893 1.00172.76 N
ATOM 5482 CA VAL B 368 10.691 31.287 -39.884 1.00173.00 C
ATOM 5483 C VAL B 368 10.969 32.588 -40.627 1.00173.72 C
ATOM 5484 O VAL B 368 10.126 33.075 -41.379 1.00174.66 O
ATOM 5485 CB VAL B 368 10.319 30.192 -40.903 1.00173.76 C
ATOM 5486 CG1 VAL B 368 11.414 30.047 -41.943 1.00174.74 C
ATOM 5487 CG2 VAL B 368 10.078 28.869 -40.197 1.00173.48 C
ATOM 5488 N ILE B 369 12.151 33.156 -40.406 1.00172.88 N
ATOM 5489 CA ILE B 369 12.522 34.413 -41.047 1.00173.50 C
ATOM 5490 C ILE B 369 13.899 34.319 -41.701 1.00173.79 C
ATOM 5491 O ILE B 369 14.846 33.802 -41.107 1.00172.95 O
ATOM 5492 CB ILE B 369 12.511 35.579 -40.036 1.00172.90 C
ATOM 5493 CG1 ILE B 369 11.109 35.757 -39.450 1.00173.19 C
ATOM 5494 CG2 ILE B 369 12.975 36.871 -40.690 1.00173.35 C
ATOM 5495 CD1 ILE B 369 10.989 36.919 -38.502 1.00173.50 C
ATOM 5496 N LEU B 370 14.000 34.819 -42.929 1.00174.68 N
ATOM 5497 CA LEU B 370 15.247 34.771 -43.683 1.00174.74 C
ATOM 5498 C LEU B 370 15.796 36.170 -43.947 1.00174.70 C
ATOM 5499 O LEU B 370 15.083 37.045 -44.440 1.00174.89 O
ATOM 5500 CB LEU B 370 15.043 34.039 -45.011 1.00174.63 C
ATOM 5501 CG LEU B 370 14.512 32.607 -44.950 1.00173.42 C
ATOM 5502 CD1 LEU B 370 14.637 31.934 -46.308 1.00173.80 C
ATOM 5503 CD2 LEU B 370 15.240 31.811 -43.885 1.00172.97 C
ATOM 5504 N THR B 371 17.067 36.375 -43.614 1.00173.86 N
ATOM 5505 CA THR B 371 17.729 37.650 -43.865 1.00173.21 C
ATOM 5506 C THR B 371 19.055 37.443 -44.588 1.00173.34 C
ATOM 5507 O THR B 371 19.605 36.341 -44.591 1.00173.33 O
ATOM 5508 CB THR B 371 17.986 38.426 -42.559 1.00172.86 C
ATOM 5509 OG1 THR B 371 18.856 37.664 -41.712 1.00173.00 O
ATOM 5510 CG2 THR B 371 16.681 38.696 -41.826 1.00173.07 C
ATOM 5511 N ASP B 372 19.567 38.506 -45.198 1.00173.47 N
ATOM 5512 CA ASP B 372 20.866 38.451 -45.856 1.00173.62 C
ATOM 5513 C ASP B 372 21.986 38.706 -44.851 1.00173.45 C
ATOM 5514 O ASP B 372 21.768 38.643 -43.642 1.00173.24 O
ATOM 5515 CB ASP B 372 20.937 39.456 -47.012 1.00174.12 C
ATOM 5516 CG ASP B 372 20.537 40.863 -46.597 1.00174.15 C
ATOM 5517 OD1 ASP B 372 20.470 41.143 -45.382 1.00174.18 O
ATOM 5518 OD2 ASP B 372 20.299 41.698 -47.497 1.00173.64 O
ATOM 5519 N LYS B 373 23.184 38.988 -45.358 1.00173.70 N
ATOM 5520 CA LYS B 373 24.327 39.283 -44.501 1.00173.84 C
ATOM 5521 C LYS B 373 24.076 40.521 -43.638 1.00173.96 C
ATOM 5522 O LYS B 373 24.432 40.549 -42.460 1.00174.49 O
ATOM 5523 CB LYS B 373 25.595 39.471 -45.341 1.00173.89 C
ATOM 5524 CG LYS B 373 25.438 40.418 -46.522 1.00174.08 C
ATOM 5525 CD LYS B 373 26.789 40.864 -47.058 1.00173.67 C
ATOM 5526 CE LYS B 373 27.617 39.678 -47.525 1.00173.20 C
ATOM 5527 NZ LYS B 373 29.018 40.066 -47.843 1.00172.67 N
ATOM 5528 N ASN B 374 23.457 41.538 -44.227 1.00173.74 N
ATOM 5529 CA ASN B 374 23.194 42.786 -43.517 1.00173.13 C
ATOM 5530 C ASN B 374 21.998 42.695 -42.568 1.00172.76 C
ATOM 5531 O ASN B 374 21.654 43.669 -41.902 1.00172.53 O
ATOM 5532 CB ASN B 374 22.975 43.920 -44.520 1.00173.72 C
ATOM 5533 CG ASN B 374 24.047 43.965 -45.591 1.00173.63 C
ATOM 5534 OD1 ASN B 374 25.240 43.902 -45.294 1.00173.29 O
ATOM 5535 ND2 ASN B 374 23.625 44.073 -46.846 1.00173.12 N
ATOM 5536 N GLY B 375 21.372 41.525 -42.509 1.00172.89 N
ATOM 5537 CA GLY B 375 20.250 41.310 -41.615 1.00173.32 C
ATOM 5538 C GLY B 375 18.934 41.854 -42.140 1.00173.75 C
ATOM 5539 O GLY B 375 17.964 41.983 -41.393 1.00174.35 O
ATOM 5540 N VAL B 376 18.897 42.175 -43.428 1.00173.61 N
ATOM 5541 CA VAL B 376 17.677 42.670 -44.057 1.00173.37 C
ATOM 5542 C VAL B 376 16.739 41.519 -44.398 1.00173.18 C
ATOM 5543 O VAL B 376 17.137 40.562 -45.060 1.00173.67 O
ATOM 5544 CB VAL B 376 17.983 43.467 -45.339 1.00173.82 C
ATOM 5545 CG1 VAL B 376 16.702 44.044 -45.924 1.00173.96 C
ATOM 5546 CG2 VAL B 376 18.988 44.571 -45.050 1.00174.36 C
ATOM 5547 N VAL B 377 15.495 41.614 -43.939 1.00172.31 N
ATOM 5548 CA VAL B 377 14.503 40.573 -44.188 1.00172.73 C
ATOM 5549 C VAL B 377 14.194 40.432 -45.674 1.00173.54 C
ATOM 5550 O VAL B 377 13.698 41.365 -46.306 1.00173.75 O
ATOM 5551 CB VAL B 377 13.195 40.852 -43.435 1.00172.75 C
ATOM 5552 CG1 VAL B 377 12.148 39.808 -43.789 1.00173.43 C
ATOM 5553 CG2 VAL B 377 13.447 40.875 -41.937 1.00173.73 C
ATOM 5554 N LYS B 378 14.486 39.256 -46.224 1.00173.84 N
ATOM 5555 CA LYS B 378 14.271 38.999 -47.643 1.00174.09 C
ATOM 5556 C LYS B 378 13.145 37.996 -47.875 1.00173.52 C
ATOM 5557 O LYS B 378 12.428 38.078 -48.872 1.00174.39 O
ATOM 5558 CB LYS B 378 15.563 38.495 -48.295 1.00174.51 C
ATOM 5559 CG LYS B 378 16.765 39.423 -48.138 1.00174.66 C
ATOM 5560 CD LYS B 378 17.021 40.265 -49.389 1.00173.42 C
ATOM 5561 CE LYS B 378 16.014 41.394 -49.550 1.00172.10 C
ATOM 5562 NZ LYS B 378 16.333 42.251 -50.725 1.00171.68 N
ATOM 5563 N ALA B 379 12.994 37.050 -46.953 1.00172.61 N
ATOM 5564 CA ALA B 379 11.962 36.026 -47.081 1.00173.12 C
ATOM 5565 C ALA B 379 11.504 35.502 -45.724 1.00173.69 C
ATOM 5566 O ALA B 379 12.215 35.629 -44.727 1.00174.06 O
ATOM 5567 CB ALA B 379 12.463 34.880 -47.942 1.00173.69 C
ATOM 5568 N ASP B 380 10.312 34.911 -45.702 1.00173.93 N
ATOM 5569 CA ASP B 380 9.749 34.334 -44.486 1.00173.89 C
ATOM 5570 C ASP B 380 8.542 33.444 -44.785 1.00173.81 C
ATOM 5571 O ASP B 380 8.125 33.309 -45.937 1.00174.17 O
ATOM 5572 CB ASP B 380 9.359 35.440 -43.492 1.00173.94 C
ATOM 5573 CG ASP B 380 8.321 36.410 -44.048 1.00174.49 C
ATOM 5574 OD1 ASP B 380 7.304 35.966 -44.622 1.00174.27 O
ATOM 5575 OD2 ASP B 380 8.520 37.634 -43.899 1.00175.44 O
ATOM 5576 N ILE B 381 7.985 32.844 -43.739 1.00173.26 N
ATOM 5577 CA ILE B 381 6.747 32.084 -43.860 1.00172.86 C
ATOM 5578 C ILE B 381 5.624 32.846 -43.167 1.00172.61 C
ATOM 5579 O ILE B 381 5.535 32.851 -41.940 1.00173.17 O
ATOM 5580 CB ILE B 381 6.878 30.675 -43.259 1.00173.16 C
ATOM 5581 CG1 ILE B 381 8.017 29.912 -43.938 1.00173.58 C
ATOM 5582 CG2 ILE B 381 5.572 29.912 -43.409 1.00173.77 C
ATOM 5583 CD1 ILE B 381 8.158 28.481 -43.470 1.00173.65 C
ATOM 5584 N PRO B 382 4.763 33.500 -43.960 1.00172.97 N
ATOM 5585 CA PRO B 382 3.723 34.411 -43.472 1.00173.07 C
ATOM 5586 C PRO B 382 2.617 33.724 -42.680 1.00172.50 C
ATOM 5587 O PRO B 382 2.307 32.558 -42.924 1.00172.20 O
ATOM 5588 CB PRO B 382 3.161 35.006 -44.764 1.00174.46 C
ATOM 5589 CG PRO B 382 3.369 33.930 -45.771 1.00175.27 C
ATOM 5590 CD PRO B 382 4.715 33.363 -45.425 1.00174.65 C
ATOM 5591 N PHE B 383 2.029 34.460 -41.743 1.00172.64 N
ATOM 5592 CA PHE B 383 0.857 33.997 -41.014 1.00173.33 C
ATOM 5593 C PHE B 383 -0.375 34.340 -41.843 1.00173.64 C
ATOM 5594 O PHE B 383 -1.066 33.455 -42.339 1.00174.26 O
ATOM 5595 CB PHE B 383 0.786 34.642 -39.626 1.00173.38 C
ATOM 5596 CG PHE B 383 -0.093 33.906 -38.652 1.00173.48 C
ATOM 5597 CD1 PHE B 383 0.407 32.845 -37.914 1.00173.46 C
ATOM 5598 CD2 PHE B 383 -1.412 34.287 -38.458 1.00173.28 C
ATOM 5599 CE1 PHE B 383 -0.392 32.170 -37.011 1.00172.89 C
ATOM 5600 CE2 PHE B 383 -2.216 33.615 -37.555 1.00172.64 C
ATOM 5601 CZ PHE B 383 -1.705 32.557 -36.829 1.00172.76 C
ATOM 5602 N ARG B 384 -0.631 35.636 -42.001 1.00173.49 N
ATOM 5603 CA ARG B 384 -1.675 36.110 -42.900 1.00173.75 C
ATOM 5604 C ARG B 384 -1.148 36.206 -44.329 1.00174.13 C
ATOM 5605 O ARG B 384 -0.262 37.012 -44.617 1.00174.79 O
ATOM 5606 CB ARG B 384 -2.203 37.474 -42.450 1.00173.00 C
ATOM 5607 CG ARG B 384 -3.071 37.446 -41.206 1.00172.19 C
ATOM 5608 CD ARG B 384 -3.635 38.828 -40.920 1.00171.87 C
ATOM 5609 NE ARG B 384 -4.507 38.842 -39.750 1.00172.79 N
ATOM 5610 CZ ARG B 384 -5.141 39.922 -39.306 1.00173.41 C
ATOM 5611 NH1 ARG B 384 -5.001 41.080 -39.936 1.00172.54 N
ATOM 5612 NH2 ARG B 384 -5.916 39.845 -38.232 1.00173.82 N
ATOM 5613 N ARG B 385 -1.691 35.386 -45.223 1.00173.51 N
ATOM 5614 CA ARG B 385 -1.251 35.377 -46.617 1.00173.69 C
ATOM 5615 C ARG B 385 -1.800 36.567 -47.400 1.00173.30 C
ATOM 5616 O ARG B 385 -1.243 36.946 -48.431 1.00173.78 O
ATOM 5617 CB ARG B 385 -1.661 34.076 -47.314 1.00173.76 C
ATOM 5618 CG ARG B 385 -0.789 32.867 -47.000 1.00174.10 C
ATOM 5619 CD ARG B 385 -1.076 32.287 -45.627 1.00173.54 C
ATOM 5620 NE ARG B 385 -0.717 30.873 -45.561 1.00174.35 N
ATOM 5621 CZ ARG B 385 -0.697 30.156 -44.443 1.00174.95 C
ATOM 5622 NH1 ARG B 385 -1.014 30.721 -43.287 1.00175.37 N
ATOM 5623 NH2 ARG B 385 -0.359 28.875 -44.481 1.00175.19 N
ATOM 5624 N ALA B 386 -2.904 37.127 -46.909 1.00172.66 N
ATOM 5625 CA ALA B 386 -3.610 38.232 -47.560 1.00173.52 C
ATOM 5626 C ALA B 386 -2.698 39.323 -48.130 1.00173.34 C
ATOM 5627 O ALA B 386 -2.929 39.817 -49.234 1.00173.24 O
ATOM 5628 CB ALA B 386 -4.598 38.850 -46.579 1.00173.94 C
ATOM 5629 N GLU B 387 -1.666 39.694 -47.380 1.00172.79 N
ATOM 5630 CA GLU B 387 -0.753 40.749 -47.816 1.00172.42 C
ATOM 5631 C GLU B 387 0.707 40.353 -47.613 1.00172.75 C
ATOM 5632 O GLU B 387 1.535 41.183 -47.238 1.00173.11 O
ATOM 5633 CB GLU B 387 -1.041 42.057 -47.067 1.00172.34 C
ATOM 5634 CG GLU B 387 -2.499 42.506 -47.103 1.00172.59 C
ATOM 5635 CD GLU B 387 -2.759 43.729 -46.237 1.00172.54 C
ATOM 5636 OE1 GLU B 387 -2.082 43.884 -45.198 1.00171.19 O
ATOM 5637 OE2 GLU B 387 -3.644 44.534 -46.596 1.00173.06 O
ATOM 5638 N SER B 388 1.018 39.084 -47.858 1.00172.69 N
ATOM 5639 CA SER B 388 2.378 38.581 -47.686 1.00172.40 C
ATOM 5640 C SER B 388 3.305 39.120 -48.767 1.00172.42 C
ATOM 5641 O SER B 388 2.978 39.081 -49.952 1.00173.33 O
ATOM 5642 CB SER B 388 2.394 37.053 -47.704 1.00172.70 C
ATOM 5643 OG SER B 388 1.950 36.557 -48.955 1.00172.00 O
ATOM 5644 N LYS B 389 4.463 39.623 -48.355 1.00172.17 N
ATOM 5645 CA LYS B 389 5.426 40.183 -49.294 1.00172.61 C
ATOM 5646 C LYS B 389 6.683 39.331 -49.406 1.00173.07 C
ATOM 5647 O LYS B 389 7.421 39.429 -50.386 1.00173.43 O
ATOM 5648 CB LYS B 389 5.808 41.607 -48.883 1.00173.10 C
ATOM 5649 CG LYS B 389 4.655 42.593 -48.904 1.00173.55 C
ATOM 5650 CD LYS B 389 5.077 43.941 -48.338 1.00174.16 C
ATOM 5651 CE LYS B 389 3.894 44.890 -48.222 1.00174.51 C
ATOM 5652 NZ LYS B 389 4.249 46.135 -47.487 1.00174.42 N
ATOM 5653 N TYR B 390 6.925 38.494 -48.401 1.00173.03 N
ATOM 5654 CA TYR B 390 8.167 37.732 -48.332 1.00173.37 C
ATOM 5655 C TYR B 390 7.965 36.217 -48.331 1.00173.68 C
ATOM 5656 O TYR B 390 8.847 35.478 -47.893 1.00173.94 O
ATOM 5657 CB TYR B 390 8.960 38.132 -47.085 1.00173.36 C
ATOM 5658 CG TYR B 390 9.172 39.621 -46.930 1.00173.43 C
ATOM 5659 CD1 TYR B 390 10.217 40.265 -47.578 1.00173.74 C
ATOM 5660 CD2 TYR B 390 8.330 40.383 -46.130 1.00173.68 C
ATOM 5661 CE1 TYR B 390 10.417 41.626 -47.437 1.00173.61 C
ATOM 5662 CE2 TYR B 390 8.521 41.744 -45.982 1.00173.01 C
ATOM 5663 CZ TYR B 390 9.566 42.359 -46.639 1.00172.83 C
ATOM 5664 OH TYR B 390 9.761 43.714 -46.495 1.00172.35 O
ATOM 5665 N SER B 391 6.810 35.755 -48.802 1.00173.47 N
ATOM 5666 CA SER B 391 6.550 34.319 -48.872 1.00173.06 C
ATOM 5667 C SER B 391 7.569 33.638 -49.781 1.00172.75 C
ATOM 5668 O SER B 391 8.008 34.219 -50.773 1.00173.40 O
ATOM 5669 CB SER B 391 5.128 34.043 -49.367 1.00173.04 C
ATOM 5670 OG SER B 391 4.950 34.506 -50.692 1.00173.23 O
ATOM 5671 N PHE B 392 7.938 32.408 -49.433 1.00172.08 N
ATOM 5672 CA PHE B 392 8.931 31.638 -50.182 1.00173.10 C
ATOM 5673 C PHE B 392 8.612 31.544 -51.673 1.00173.57 C
ATOM 5674 O PHE B 392 9.515 31.486 -52.508 1.00173.73 O
ATOM 5675 CB PHE B 392 9.057 30.230 -49.596 1.00173.87 C
ATOM 5676 CG PHE B 392 9.983 30.145 -48.414 1.00173.79 C
ATOM 5677 CD1 PHE B 392 9.878 31.043 -47.366 1.00173.58 C
ATOM 5678 CD2 PHE B 392 10.958 29.162 -48.353 1.00173.71 C
ATOM 5679 CE1 PHE B 392 10.729 30.965 -46.281 1.00173.52 C
ATOM 5680 CE2 PHE B 392 11.809 29.079 -47.271 1.00173.54 C
ATOM 5681 CZ PHE B 392 11.694 29.981 -46.234 1.00173.66 C
ATOM 5682 N GLU B 393 7.323 31.535 -51.997 1.00173.72 N
ATOM 5683 CA GLU B 393 6.879 31.463 -53.383 1.00173.75 C
ATOM 5684 C GLU B 393 7.230 32.736 -54.148 1.00173.21 C
ATOM 5685 O GLU B 393 7.791 32.676 -55.242 1.00173.17 O
ATOM 5686 CB GLU B 393 5.370 31.206 -53.447 1.00173.93 C
ATOM 5687 CG GLU B 393 4.944 29.839 -52.923 1.00174.55 C
ATOM 5688 CD GLU B 393 4.946 29.758 -51.407 1.00173.94 C
ATOM 5689 OE1 GLU B 393 5.008 30.820 -50.753 1.00173.54 O
ATOM 5690 OE2 GLU B 393 4.887 28.632 -50.868 1.00173.88 O
ATOM 5691 N GLN B 394 6.899 33.884 -53.566 1.00173.02 N
ATOM 5692 CA GLN B 394 7.177 35.175 -54.191 1.00173.22 C
ATOM 5693 C GLN B 394 8.669 35.448 -54.366 1.00173.12 C
ATOM 5694 O GLN B 394 9.063 36.241 -55.218 1.00173.89 O
ATOM 5695 CB GLN B 394 6.550 36.305 -53.374 1.00173.43 C
ATOM 5696 CG GLN B 394 5.038 36.262 -53.301 1.00173.90 C
ATOM 5697 CD GLN B 394 4.481 37.218 -52.265 1.00174.19 C
ATOM 5698 OE1 GLN B 394 4.722 37.065 -51.066 1.00174.14 O
ATOM 5699 NE2 GLN B 394 3.738 38.219 -52.723 1.00174.17 N
ATOM 5700 N GLN B 395 9.494 34.796 -53.555 1.00172.42 N
ATOM 5701 CA GLN B 395 10.923 35.084 -53.549 1.00172.31 C
ATOM 5702 C GLN B 395 11.735 34.000 -54.243 1.00172.82 C
ATOM 5703 O GLN B 395 12.942 34.150 -54.440 1.00172.53 O
ATOM 5704 CB GLN B 395 11.419 35.268 -52.116 1.00172.46 C
ATOM 5705 CG GLN B 395 10.740 36.411 -51.382 1.00172.97 C
ATOM 5706 CD GLN B 395 10.900 37.735 -52.101 1.00172.48 C
ATOM 5707 OE1 GLN B 395 11.985 38.068 -52.580 1.00172.25 O
ATOM 5708 NE2 GLN B 395 9.816 38.498 -52.183 1.00172.92 N
ATOM 5709 N GLY B 396 11.072 32.908 -54.612 1.00173.34 N
ATOM 5710 CA GLY B 396 11.730 31.819 -55.310 1.00174.04 C
ATOM 5711 C GLY B 396 12.832 31.192 -54.481 1.00174.02 C
ATOM 5712 O GLY B 396 13.866 30.788 -55.010 1.00174.51 O
ATOM 5713 N VAL B 397 12.609 31.125 -53.172 1.00173.25 N
ATOM 5714 CA VAL B 397 13.588 30.575 -52.245 1.00172.86 C
ATOM 5715 C VAL B 397 13.929 29.120 -52.559 1.00172.88 C
ATOM 5716 O VAL B 397 13.042 28.299 -52.792 1.00172.57 O
ATOM 5717 CB VAL B 397 13.086 30.666 -50.795 1.00173.28 C
ATOM 5718 CG1 VAL B 397 14.170 30.224 -49.826 1.00174.11 C
ATOM 5719 CG2 VAL B 397 12.641 32.085 -50.485 1.00174.04 C
ATOM 5720 N THR B 398 15.222 28.813 -52.564 1.00172.96 N
ATOM 5721 CA THR B 398 15.702 27.456 -52.798 1.00173.25 C
ATOM 5722 C THR B 398 16.690 27.056 -51.712 1.00172.90 C
ATOM 5723 O THR B 398 17.223 27.910 -51.004 1.00172.54 O
ATOM 5724 CB THR B 398 16.384 27.314 -54.174 1.00174.26 C
ATOM 5725 OG1 THR B 398 17.606 28.064 -54.185 1.00174.33 O
ATOM 5726 CG2 THR B 398 15.474 27.822 -55.284 1.00174.79 C
ATOM 5727 N VAL B 399 16.934 25.758 -51.583 1.00172.82 N
ATOM 5728 CA VAL B 399 17.861 25.260 -50.577 1.00172.55 C
ATOM 5729 C VAL B 399 18.813 24.219 -51.162 1.00173.04 C
ATOM 5730 O VAL B 399 18.405 23.326 -51.906 1.00172.86 O
ATOM 5731 CB VAL B 399 17.104 24.663 -49.367 1.00172.75 C
ATOM 5732 CG1 VAL B 399 16.127 23.582 -49.816 1.00173.43 C
ATOM 5733 CG2 VAL B 399 18.080 24.128 -48.329 1.00173.43 C
ATOM 5734 N SER B 400 20.092 24.356 -50.831 1.00173.52 N
ATOM 5735 CA SER B 400 21.113 23.420 -51.278 1.00173.95 C
ATOM 5736 C SER B 400 21.897 22.890 -50.085 1.00173.69 C
ATOM 5737 O SER B 400 22.100 23.601 -49.101 1.00173.44 O
ATOM 5738 CB SER B 400 22.056 24.087 -52.283 1.00174.84 C
ATOM 5739 OG SER B 400 21.367 24.454 -53.464 1.00174.92 O
ATOM 5740 N PHE B 401 22.337 21.639 -50.173 1.00173.84 N
ATOM 5741 CA PHE B 401 23.071 21.019 -49.078 1.00174.31 C
ATOM 5742 C PHE B 401 24.507 20.695 -49.476 1.00174.24 C
ATOM 5743 O PHE B 401 24.794 20.424 -50.642 1.00174.26 O
ATOM 5744 CB PHE B 401 22.361 19.750 -48.604 1.00174.30 C
ATOM 5745 CG PHE B 401 21.074 20.010 -47.873 1.00174.24 C
ATOM 5746 CD1 PHE B 401 21.045 20.045 -46.489 1.00174.23 C
ATOM 5747 CD2 PHE B 401 19.896 20.224 -48.569 1.00174.57 C
ATOM 5748 CE1 PHE B 401 19.865 20.285 -45.812 1.00174.18 C
ATOM 5749 CE2 PHE B 401 18.711 20.465 -47.898 1.00174.33 C
ATOM 5750 CZ PHE B 401 18.696 20.497 -46.518 1.00173.92 C
ATOM 5751 N TYR B 402 25.402 20.722 -48.493 1.00174.14 N
ATOM 5752 CA TYR B 402 26.818 20.471 -48.728 1.00174.60 C
ATOM 5753 C TYR B 402 27.386 19.575 -47.632 1.00173.95 C
ATOM 5754 O TYR B 402 27.387 19.943 -46.457 1.00173.47 O
ATOM 5755 CB TYR B 402 27.593 21.791 -48.795 1.00174.62 C
ATOM 5756 CG TYR B 402 27.100 22.742 -49.864 1.00174.36 C
ATOM 5757 CD1 TYR B 402 27.534 22.627 -51.179 1.00174.22 C
ATOM 5758 CD2 TYR B 402 26.197 23.753 -49.560 1.00174.13 C
ATOM 5759 CE1 TYR B 402 27.084 23.494 -52.160 1.00174.14 C
ATOM 5760 CE2 TYR B 402 25.741 24.623 -50.534 1.00174.17 C
ATOM 5761 CZ TYR B 402 26.187 24.490 -51.831 1.00173.88 C
ATOM 5762 OH TYR B 402 25.734 25.358 -52.800 1.00172.39 O
ATOM 5763 N GLY B 403 27.865 18.397 -48.022 1.00173.91 N
ATOM 5764 CA GLY B 403 28.367 17.421 -47.071 1.00173.60 C
ATOM 5765 C GLY B 403 27.235 16.751 -46.318 1.00173.42 C
ATOM 5766 O GLY B 403 26.256 17.398 -45.962 1.00173.16 O
ATOM 5767 N GLY B 404 27.353 15.449 -46.082 1.00173.41 N
ATOM 5768 CA GLY B 404 26.328 14.727 -45.352 1.00173.19 C
ATOM 5769 C GLY B 404 25.393 13.942 -46.250 1.00172.89 C
ATOM 5770 O GLY B 404 25.710 13.678 -47.410 1.00174.01 O
ATOM 5771 N GLU B 405 24.244 13.558 -45.700 1.00172.12 N
ATOM 5772 CA GLU B 405 23.230 12.809 -46.438 1.00173.01 C
ATOM 5773 C GLU B 405 22.792 13.509 -47.725 1.00173.92 C
ATOM 5774 O GLU B 405 22.885 12.938 -48.812 1.00174.32 O
ATOM 5775 CB GLU B 405 22.007 12.558 -45.549 1.00172.84 C
ATOM 5776 CG GLU B 405 22.235 11.546 -44.435 1.00173.50 C
ATOM 5777 CD GLU B 405 22.514 10.150 -44.959 1.00173.69 C
ATOM 5778 OE1 GLU B 405 23.701 9.798 -45.121 1.00173.84 O
ATOM 5779 OE2 GLU B 405 21.543 9.401 -45.202 1.00173.02 O
ATOM 5780 N LEU B 406 22.318 14.743 -47.595 1.00174.26 N
ATOM 5781 CA LEU B 406 21.754 15.479 -48.724 1.00174.20 C
ATOM 5782 C LEU B 406 22.803 16.230 -49.546 1.00174.54 C
ATOM 5783 O LEU B 406 22.458 17.111 -50.334 1.00174.67 O
ATOM 5784 CB LEU B 406 20.695 16.464 -48.228 1.00173.48 C
ATOM 5785 CG LEU B 406 19.542 15.867 -47.420 1.00173.58 C
ATOM 5786 CD1 LEU B 406 18.576 16.953 -46.985 1.00173.29 C
ATOM 5787 CD2 LEU B 406 18.822 14.796 -48.225 1.00173.56 C
ATOM 5788 N ASN B 407 24.072 15.881 -49.357 1.00174.43 N
ATOM 5789 CA ASN B 407 25.181 16.548 -50.039 1.00173.72 C
ATOM 5790 C ASN B 407 25.027 16.641 -51.556 1.00173.64 C
ATOM 5791 O ASN B 407 24.746 15.646 -52.223 1.00173.70 O
ATOM 5792 CB ASN B 407 26.494 15.835 -49.718 1.00173.26 C
ATOM 5793 CG ASN B 407 27.646 16.332 -50.568 1.00172.30 C
ATOM 5794 OD1 ASN B 407 28.081 17.474 -50.431 1.00172.24 O
ATOM 5795 ND2 ASN B 407 28.147 15.476 -51.450 1.00172.02 N
ATOM 5796 N GLY B 408 25.221 17.843 -52.092 1.00173.66 N
ATOM 5797 CA GLY B 408 25.171 18.063 -53.527 1.00173.60 C
ATOM 5798 C GLY B 408 23.774 18.199 -54.102 1.00172.38 C
ATOM 5799 O GLY B 408 23.611 18.477 -55.290 1.00171.93 O
ATOM 5800 N GLN B 409 22.763 18.008 -53.264 1.00172.40 N
ATOM 5801 CA GLN B 409 21.382 18.058 -53.725 1.00172.38 C
ATOM 5802 C GLN B 409 20.777 19.445 -53.545 1.00172.25 C
ATOM 5803 O GLN B 409 21.232 20.233 -52.716 1.00172.14 O
ATOM 5804 CB GLN B 409 20.534 17.018 -52.993 1.00173.38 C
ATOM 5805 CG GLN B 409 21.001 15.588 -53.192 1.00174.29 C
ATOM 5806 CD GLN B 409 20.202 14.597 -52.370 1.00174.70 C
ATOM 5807 OE1 GLN B 409 18.972 14.618 -52.377 1.00174.49 O
ATOM 5808 NE2 GLN B 409 20.901 13.721 -51.654 1.00174.81 N
ATOM 5809 N THR B 410 19.749 19.731 -54.336 1.00173.25 N
ATOM 5810 CA THR B 410 19.058 21.011 -54.281 1.00173.54 C
ATOM 5811 C THR B 410 17.546 20.795 -54.328 1.00173.86 C
ATOM 5812 O THR B 410 17.063 19.888 -55.007 1.00175.08 O
ATOM 5813 CB THR B 410 19.490 21.930 -55.444 1.00173.72 C
ATOM 5814 OG1 THR B 410 20.921 21.991 -55.501 1.00173.68 O
ATOM 5815 CG2 THR B 410 18.934 23.335 -55.265 1.00173.33 C
ATOM 5816 N PHE B 411 16.802 21.620 -53.601 1.00173.17 N
ATOM 5817 CA PHE B 411 15.347 21.515 -53.572 1.00173.01 C
ATOM 5818 C PHE B 411 14.717 22.871 -53.863 1.00172.92 C
ATOM 5819 O PHE B 411 15.128 23.886 -53.301 1.00173.25 O
ATOM 5820 CB PHE B 411 14.875 20.982 -52.220 1.00172.69 C
ATOM 5821 CG PHE B 411 15.465 19.651 -51.857 1.00172.34 C
ATOM 5822 CD1 PHE B 411 14.933 18.482 -52.371 1.00172.32 C
ATOM 5823 CD2 PHE B 411 16.558 19.571 -51.012 1.00173.26 C
ATOM 5824 CE1 PHE B 411 15.475 17.254 -52.042 1.00172.09 C
ATOM 5825 CE2 PHE B 411 17.105 18.348 -50.680 1.00174.03 C
ATOM 5826 CZ PHE B 411 16.562 17.187 -51.196 1.00173.22 C
ATOM 5827 N THR B 412 13.723 22.886 -54.747 1.00172.36 N
ATOM 5828 CA THR B 412 13.147 24.144 -55.211 1.00172.92 C
ATOM 5829 C THR B 412 11.639 24.244 -54.999 1.00172.82 C
ATOM 5830 O THR B 412 11.072 25.332 -55.098 1.00172.74 O
ATOM 5831 CB THR B 412 13.437 24.367 -56.707 1.00174.61 C
ATOM 5832 OG1 THR B 412 12.835 23.317 -57.472 1.00175.47 O
ATOM 5833 CG2 THR B 412 14.936 24.380 -56.967 1.00175.43 C
ATOM 5834 N ASP B 413 10.991 23.123 -54.704 1.00173.25 N
ATOM 5835 CA ASP B 413 9.556 23.145 -54.444 1.00173.62 C
ATOM 5836 C ASP B 413 9.272 23.692 -53.046 1.00173.80 C
ATOM 5837 O ASP B 413 9.721 23.122 -52.050 1.00174.09 O
ATOM 5838 CB ASP B 413 8.945 21.748 -54.625 1.00173.85 C
ATOM 5839 CG ASP B 413 9.504 20.729 -53.652 1.00173.66 C
ATOM 5840 OD1 ASP B 413 10.739 20.544 -53.628 1.00173.67 O
ATOM 5841 OD2 ASP B 413 8.707 20.115 -52.909 1.00173.02 O
ATOM 5842 N PRO B 414 8.540 24.820 -52.978 1.00173.32 N
ATOM 5843 CA PRO B 414 8.210 25.571 -51.758 1.00173.23 C
ATOM 5844 C PRO B 414 7.906 24.719 -50.513 1.00173.12 C
ATOM 5845 O PRO B 414 8.455 25.040 -49.461 1.00173.52 O
ATOM 5846 CB PRO B 414 6.985 26.387 -52.179 1.00172.46 C
ATOM 5847 CG PRO B 414 7.206 26.639 -53.619 1.00173.78 C
ATOM 5848 CD PRO B 414 7.918 25.424 -54.170 1.00173.53 C
ATOM 5849 N PRO B 415 7.048 23.681 -50.612 1.00172.30 N
ATOM 5850 CA PRO B 415 6.830 22.877 -49.405 1.00172.64 C
ATOM 5851 C PRO B 415 8.115 22.297 -48.821 1.00172.71 C
ATOM 5852 O PRO B 415 8.367 22.440 -47.625 1.00172.87 O
ATOM 5853 CB PRO B 415 5.916 21.756 -49.903 1.00173.06 C
ATOM 5854 CG PRO B 415 5.176 22.368 -51.025 1.00173.16 C
ATOM 5855 CD PRO B 415 6.216 23.185 -51.726 1.00172.81 C
ATOM 5856 N THR B 416 8.911 21.654 -49.668 1.00172.25 N
ATOM 5857 CA THR B 416 10.152 21.025 -49.234 1.00172.72 C
ATOM 5858 C THR B 416 11.139 22.060 -48.700 1.00173.05 C
ATOM 5859 O THR B 416 11.785 21.843 -47.674 1.00173.66 O
ATOM 5860 CB THR B 416 10.811 20.237 -50.387 1.00173.11 C
ATOM 5861 OG1 THR B 416 9.979 19.129 -50.754 1.00172.90 O
ATOM 5862 CG2 THR B 416 12.187 19.725 -49.984 1.00173.78 C
ATOM 5863 N VAL B 417 11.246 23.187 -49.398 1.00173.37 N
ATOM 5864 CA VAL B 417 12.146 24.262 -48.994 1.00173.75 C
ATOM 5865 C VAL B 417 11.756 24.837 -47.636 1.00173.27 C
ATOM 5866 O VAL B 417 12.605 25.015 -46.762 1.00173.66 O
ATOM 5867 CB VAL B 417 12.171 25.400 -50.035 1.00175.03 C
ATOM 5868 CG1 VAL B 417 13.145 26.490 -49.609 1.00174.55 C
ATOM 5869 CG2 VAL B 417 12.540 24.853 -51.406 1.00175.19 C
ATOM 5870 N LYS B 418 10.470 25.127 -47.466 1.00172.94 N
ATOM 5871 CA LYS B 418 9.963 25.644 -46.201 1.00173.48 C
ATOM 5872 C LYS B 418 10.146 24.632 -45.074 1.00174.21 C
ATOM 5873 O LYS B 418 10.363 25.011 -43.925 1.00174.72 O
ATOM 5874 CB LYS B 418 8.487 26.028 -46.328 1.00173.22 C
ATOM 5875 CG LYS B 418 8.234 27.252 -47.191 1.00172.99 C
ATOM 5876 CD LYS B 418 6.765 27.638 -47.194 1.00173.17 C
ATOM 5877 CE LYS B 418 5.928 26.609 -47.934 1.00173.23 C
ATOM 5878 NZ LYS B 418 4.588 27.145 -48.299 1.00173.84 N
ATOM 5879 N SER B 419 10.050 23.348 -45.407 1.00173.82 N
ATOM 5880 CA SER B 419 10.257 22.276 -44.434 1.00173.84 C
ATOM 5881 C SER B 419 11.643 22.348 -43.797 1.00173.74 C
ATOM 5882 O SER B 419 11.772 22.363 -42.573 1.00173.90 O
ATOM 5883 CB SER B 419 10.055 20.909 -45.093 1.00173.78 C
ATOM 5884 OG SER B 419 10.503 19.863 -44.249 1.00173.59 O
ATOM 5885 N TYR B 420 12.676 22.385 -44.634 1.00173.45 N
ATOM 5886 CA TYR B 420 14.051 22.483 -44.154 1.00173.55 C
ATOM 5887 C TYR B 420 14.315 23.828 -43.483 1.00174.48 C
ATOM 5888 O TYR B 420 15.084 23.910 -42.525 1.00175.37 O
ATOM 5889 CB TYR B 420 15.036 22.261 -45.302 1.00172.78 C
ATOM 5890 CG TYR B 420 15.107 20.823 -45.761 1.00172.01 C
ATOM 5891 CD1 TYR B 420 15.618 19.836 -44.930 1.00171.90 C
ATOM 5892 CD2 TYR B 420 14.659 20.453 -47.021 1.00173.26 C
ATOM 5893 CE1 TYR B 420 15.682 18.520 -45.342 1.00171.97 C
ATOM 5894 CE2 TYR B 420 14.720 19.140 -47.442 1.00173.15 C
ATOM 5895 CZ TYR B 420 15.232 18.179 -46.599 1.00172.62 C
ATOM 5896 OH TYR B 420 15.293 16.871 -47.018 1.00173.87 O
ATOM 5897 N ALA B 421 13.680 24.879 -43.992 1.00174.42 N
ATOM 5898 CA ALA B 421 13.773 26.203 -43.386 1.00174.14 C
ATOM 5899 C ALA B 421 13.181 26.171 -41.982 1.00173.63 C
ATOM 5900 O ALA B 421 13.705 26.791 -41.056 1.00173.64 O
ATOM 5901 CB ALA B 421 13.064 27.238 -44.247 1.00174.31 C
ATOM 5902 N ARG B 422 12.076 25.447 -41.844 1.00173.43 N
ATOM 5903 CA ARG B 422 11.434 25.231 -40.554 1.00173.88 C
ATOM 5904 C ARG B 422 12.344 24.450 -39.603 1.00173.40 C
ATOM 5905 O ARG B 422 12.196 24.528 -38.383 1.00172.79 O
ATOM 5906 CB ARG B 422 10.111 24.488 -40.751 1.00174.53 C
ATOM 5907 CG ARG B 422 9.125 24.597 -39.601 1.00175.13 C
ATOM 5908 CD ARG B 422 7.787 25.137 -40.093 1.00174.81 C
ATOM 5909 NE ARG B 422 7.514 24.755 -41.478 1.00174.32 N
ATOM 5910 CZ ARG B 422 6.920 23.622 -41.843 1.00173.52 C
ATOM 5911 NH1 ARG B 422 6.533 22.747 -40.927 1.00173.63 N
ATOM 5912 NH2 ARG B 422 6.716 23.364 -43.128 1.00173.25 N
ATOM 5913 N LYS B 423 13.281 23.697 -40.172 1.00173.64 N
ATOM 5914 CA LYS B 423 14.202 22.872 -39.393 1.00173.59 C
ATOM 5915 C LYS B 423 15.501 23.602 -39.058 1.00174.04 C
ATOM 5916 O LYS B 423 16.059 23.424 -37.975 1.00174.11 O
ATOM 5917 CB LYS B 423 14.524 21.579 -40.145 1.00173.33 C
ATOM 5918 CG LYS B 423 13.907 20.333 -39.533 1.00172.89 C
ATOM 5919 CD LYS B 423 12.413 20.509 -39.325 1.00173.57 C
ATOM 5920 CE LYS B 423 11.822 19.320 -38.590 1.00174.76 C
ATOM 5921 NZ LYS B 423 10.356 19.473 -38.384 1.00175.44 N
ATOM 5922 N ALA B 424 15.984 24.407 -40.002 1.00174.62 N
ATOM 5923 CA ALA B 424 17.222 25.167 -39.829 1.00174.97 C
ATOM 5924 C ALA B 424 17.173 26.085 -38.608 1.00174.82 C
ATOM 5925 O ALA B 424 18.212 26.457 -38.062 1.00174.88 O
ATOM 5926 CB ALA B 424 17.518 25.975 -41.082 1.00175.08 C
ATOM 5927 N ILE B 425 15.959 26.454 -38.203 1.00174.22 N
ATOM 5928 CA ILE B 425 15.729 27.232 -36.989 1.00173.36 C
ATOM 5929 C ILE B 425 16.437 26.609 -35.784 1.00173.69 C
ATOM 5930 O ILE B 425 16.962 27.314 -34.920 1.00173.75 O
ATOM 5931 CB ILE B 425 14.210 27.360 -36.707 1.00172.77 C
ATOM 5932 CG1 ILE B 425 13.639 28.586 -37.418 1.00173.51 C
ATOM 5933 CG2 ILE B 425 13.921 27.445 -35.221 1.00173.17 C
ATOM 5934 CD1 ILE B 425 12.158 28.785 -37.186 1.00174.37 C
ATOM 5935 N PHE B 426 16.480 25.282 -35.757 1.00174.06 N
ATOM 5936 CA PHE B 426 17.086 24.548 -34.653 1.00174.01 C
ATOM 5937 C PHE B 426 18.585 24.355 -34.854 1.00173.86 C
ATOM 5938 O PHE B 426 19.247 23.703 -34.047 1.00174.15 O
ATOM 5939 CB PHE B 426 16.406 23.189 -34.488 1.00173.98 C
ATOM 5940 CG PHE B 426 14.914 23.275 -34.346 1.00174.17 C
ATOM 5941 CD1 PHE B 426 14.339 24.182 -33.471 1.00174.05 C
ATOM 5942 CD2 PHE B 426 14.085 22.453 -35.089 1.00174.39 C
ATOM 5943 CE1 PHE B 426 12.966 24.266 -33.338 1.00174.07 C
ATOM 5944 CE2 PHE B 426 12.711 22.532 -34.962 1.00174.63 C
ATOM 5945 CZ PHE B 426 12.151 23.439 -34.085 1.00174.63 C
ATOM 5946 N GLY B 427 19.118 24.923 -35.931 1.00173.42 N
ATOM 5947 CA GLY B 427 20.520 24.753 -36.259 1.00173.59 C
ATOM 5948 C GLY B 427 20.729 23.693 -37.320 1.00173.00 C
ATOM 5949 O GLY B 427 19.909 23.547 -38.229 1.00173.01 O
ATOM 5950 N GLU B 428 21.835 22.961 -37.210 1.00172.74 N
ATOM 5951 CA GLU B 428 22.148 21.887 -38.145 1.00172.21 C
ATOM 5952 C GLU B 428 21.029 20.857 -38.203 1.00172.22 C
ATOM 5953 O GLU B 428 20.561 20.374 -37.173 1.00172.94 O
ATOM 5954 CB GLU B 428 23.465 21.208 -37.762 1.00172.87 C
ATOM 5955 CG GLU B 428 24.688 22.090 -37.926 1.00173.05 C
ATOM 5956 CD GLU B 428 24.843 22.602 -39.342 1.00172.68 C
ATOM 5957 OE1 GLU B 428 24.693 21.796 -40.285 1.00172.36 O
ATOM 5958 OE2 GLU B 428 25.121 23.808 -39.515 1.00173.54 O
ATOM 5959 N ILE B 429 20.601 20.531 -39.417 1.00172.14 N
ATOM 5960 CA ILE B 429 19.495 19.607 -39.618 1.00173.11 C
ATOM 5961 C ILE B 429 19.981 18.161 -39.627 1.00173.38 C
ATOM 5962 O ILE B 429 20.933 17.823 -40.329 1.00173.58 O
ATOM 5963 CB ILE B 429 18.754 19.910 -40.929 1.00174.40 C
ATOM 5964 CG1 ILE B 429 18.415 21.400 -41.011 1.00174.10 C
ATOM 5965 CG2 ILE B 429 17.504 19.049 -41.049 1.00174.80 C
ATOM 5966 CD1 ILE B 429 17.717 21.803 -42.292 1.00174.79 C
ATOM 5967 N PHE B 430 19.324 17.312 -38.844 1.00173.04 N
ATOM 5968 CA PHE B 430 19.720 15.912 -38.728 1.00172.92 C
ATOM 5969 C PHE B 430 18.596 14.943 -39.082 1.00173.29 C
ATOM 5970 O PHE B 430 17.437 15.333 -39.212 1.00173.68 O
ATOM 5971 CB PHE B 430 20.223 15.622 -37.314 1.00173.06 C
ATOM 5972 CG PHE B 430 21.650 16.027 -37.084 1.00173.68 C
ATOM 5973 CD1 PHE B 430 22.671 15.100 -37.205 1.00173.66 C
ATOM 5974 CD2 PHE B 430 21.970 17.330 -36.745 1.00174.05 C
ATOM 5975 CE1 PHE B 430 23.986 15.465 -36.993 1.00173.31 C
ATOM 5976 CE2 PHE B 430 23.284 17.702 -36.534 1.00173.92 C
ATOM 5977 CZ PHE B 430 24.294 16.767 -36.660 1.00173.47 C
ATOM 5978 N GLU B 431 18.958 13.673 -39.231 1.00173.31 N
ATOM 5979 CA GLU B 431 18.004 12.614 -39.540 1.00173.51 C
ATOM 5980 C GLU B 431 17.770 11.737 -38.315 1.00173.54 C
ATOM 5981 O GLU B 431 18.688 11.065 -37.843 1.00173.87 O
ATOM 5982 CB GLU B 431 18.506 11.770 -40.711 1.00173.65 C
ATOM 5983 CG GLU B 431 17.480 10.804 -41.276 1.00173.97 C
ATOM 5984 CD GLU B 431 18.046 9.947 -42.390 1.00174.70 C
ATOM 5985 OE1 GLU B 431 18.574 10.515 -43.369 1.00174.89 O
ATOM 5986 OE2 GLU B 431 17.963 8.704 -42.288 1.00175.13 O
ATOM 5987 N PHE B 432 16.544 11.747 -37.801 1.00173.26 N
ATOM 5988 CA PHE B 432 16.229 11.034 -36.566 1.00173.46 C
ATOM 5989 C PHE B 432 15.429 9.752 -36.778 1.00173.66 C
ATOM 5990 O PHE B 432 14.682 9.620 -37.746 1.00173.42 O
ATOM 5991 CB PHE B 432 15.462 11.954 -35.616 1.00173.23 C
ATOM 5992 CG PHE B 432 16.249 13.148 -35.167 1.00173.38 C
ATOM 5993 CD1 PHE B 432 17.135 13.049 -34.108 1.00173.72 C
ATOM 5994 CD2 PHE B 432 16.110 14.368 -35.808 1.00173.04 C
ATOM 5995 CE1 PHE B 432 17.865 14.144 -33.692 1.00174.49 C
ATOM 5996 CE2 PHE B 432 16.838 15.468 -35.398 1.00173.43 C
ATOM 5997 CZ PHE B 432 17.716 15.354 -34.339 1.00174.40 C
ATOM 5998 N ASP B 433 15.595 8.814 -35.851 1.00173.94 N
ATOM 5999 CA ASP B 433 14.806 7.590 -35.827 1.00174.20 C
ATOM 6000 C ASP B 433 13.750 7.705 -34.727 1.00174.08 C
ATOM 6001 O ASP B 433 14.053 7.530 -33.549 1.00174.55 O
ATOM 6002 CB ASP B 433 15.707 6.370 -35.602 1.00174.42 C
ATOM 6003 CG ASP B 433 14.924 5.110 -35.276 1.00174.35 C
ATOM 6004 OD1 ASP B 433 13.798 4.953 -35.793 1.00174.37 O
ATOM 6005 OD2 ASP B 433 15.437 4.274 -34.500 1.00173.82 O
ATOM 6006 N THR B 434 12.516 8.012 -35.116 1.00173.20 N
ATOM 6007 CA THR B 434 11.436 8.233 -34.157 1.00172.47 C
ATOM 6008 C THR B 434 10.631 6.968 -33.873 1.00172.86 C
ATOM 6009 O THR B 434 9.885 6.905 -32.895 1.00172.81 O
ATOM 6010 CB THR B 434 10.476 9.326 -34.652 1.00172.78 C
ATOM 6011 OG1 THR B 434 9.733 8.835 -35.774 1.00173.63 O
ATOM 6012 CG2 THR B 434 11.253 10.564 -35.069 1.00173.50 C
ATOM 6013 N GLU B 435 10.775 5.971 -34.742 1.00173.48 N
ATOM 6014 CA GLU B 435 10.038 4.714 -34.620 1.00174.41 C
ATOM 6015 C GLU B 435 10.340 3.951 -33.330 1.00174.45 C
ATOM 6016 O GLU B 435 9.462 3.792 -32.481 1.00174.56 O
ATOM 6017 CB GLU B 435 10.335 3.815 -35.822 1.00175.09 C
ATOM 6018 CG GLU B 435 9.701 4.278 -37.123 1.00175.65 C
ATOM 6019 CD GLU B 435 8.196 4.433 -37.017 1.00176.28 C
ATOM 6020 OE1 GLU B 435 7.530 3.486 -36.544 1.00177.10 O
ATOM 6021 OE2 GLU B 435 7.679 5.499 -37.410 1.00175.77 O
ATOM 6022 N THR B 436 11.579 3.473 -33.215 1.00174.10 N
ATOM 6023 CA THR B 436 12.059 2.674 -32.081 1.00173.10 C
ATOM 6024 C THR B 436 11.458 3.017 -30.715 1.00172.00 C
ATOM 6025 O THR B 436 10.678 2.245 -30.161 1.00171.48 O
ATOM 6026 CB THR B 436 13.590 2.784 -31.951 1.00173.20 C
ATOM 6027 OG1 THR B 436 14.193 2.660 -33.246 1.00173.26 O
ATOM 6028 CG2 THR B 436 14.127 1.693 -31.037 1.00173.29 C
ATOM 6029 N LEU B 437 11.824 4.177 -30.183 1.00172.11 N
ATOM 6030 CA LEU B 437 11.399 4.570 -28.844 1.00172.42 C
ATOM 6031 C LEU B 437 10.035 5.255 -28.833 1.00172.94 C
ATOM 6032 O LEU B 437 9.588 5.733 -27.789 1.00173.59 O
ATOM 6033 CB LEU B 437 12.442 5.489 -28.205 1.00172.57 C
ATOM 6034 CG LEU B 437 13.882 4.970 -28.223 1.00173.11 C
ATOM 6035 CD1 LEU B 437 14.813 5.954 -27.536 1.00173.28 C
ATOM 6036 CD2 LEU B 437 13.971 3.599 -27.571 1.00174.21 C
ATOM 6037 N ASN B 438 9.388 5.306 -29.996 1.00173.25 N
ATOM 6038 CA ASN B 438 8.078 5.936 -30.146 1.00173.17 C
ATOM 6039 C ASN B 438 8.099 7.387 -29.663 1.00173.33 C
ATOM 6040 O ASN B 438 7.368 7.763 -28.746 1.00173.52 O
ATOM 6041 CB ASN B 438 7.005 5.136 -29.398 1.00172.79 C
ATOM 6042 CG ASN B 438 5.600 5.635 -29.674 1.00171.61 C
ATOM 6043 OD1 ASN B 438 5.228 5.881 -30.821 1.00171.08 O
ATOM 6044 ND2 ASN B 438 4.809 5.791 -28.618 1.00171.90 N
ATOM 6045 N SER B 439 8.959 8.191 -30.277 1.00173.54 N
ATOM 6046 CA SER B 439 9.142 9.580 -29.872 1.00173.40 C
ATOM 6047 C SER B 439 7.921 10.437 -30.192 1.00172.54 C
ATOM 6048 O SER B 439 7.113 10.087 -31.053 1.00172.25 O
ATOM 6049 CB SER B 439 10.385 10.169 -30.543 1.00173.72 C
ATOM 6050 OG SER B 439 11.512 9.332 -30.346 1.00174.25 O
ATOM 6051 N ASP B 440 7.793 11.559 -29.491 1.00171.88 N
ATOM 6052 CA ASP B 440 6.651 12.448 -29.668 1.00171.50 C
ATOM 6053 C ASP B 440 7.050 13.758 -30.341 1.00173.56 C
ATOM 6054 O ASP B 440 6.196 14.573 -30.681 1.00175.20 O
ATOM 6055 CB ASP B 440 5.985 12.734 -28.320 1.00171.71 C
ATOM 6056 CG ASP B 440 6.982 13.134 -27.248 1.00173.15 C
ATOM 6057 OD1 ASP B 440 7.907 13.920 -27.544 1.00172.97 O
ATOM 6058 OD2 ASP B 440 6.839 12.661 -26.101 1.00174.40 O
ATOM 6059 N GLY B 441 8.351 13.957 -30.525 1.00173.52 N
ATOM 6060 CA GLY B 441 8.846 15.141 -31.204 1.00173.98 C
ATOM 6061 C GLY B 441 8.866 16.382 -30.332 1.00173.48 C
ATOM 6062 O GLY B 441 8.758 17.500 -30.835 1.00173.72 O
ATOM 6063 N ILE B 442 9.002 16.189 -29.025 1.00172.57 N
ATOM 6064 CA ILE B 442 9.042 17.307 -28.088 1.00172.22 C
ATOM 6065 C ILE B 442 10.337 17.298 -27.284 1.00172.66 C
ATOM 6066 O ILE B 442 10.635 16.326 -26.594 1.00173.36 O
ATOM 6067 CB ILE B 442 7.846 17.275 -27.124 1.00171.69 C
ATOM 6068 CG1 ILE B 442 6.534 17.230 -27.906 1.00172.07 C
ATOM 6069 CG2 ILE B 442 7.878 18.481 -26.202 1.00171.79 C
ATOM 6070 CD1 ILE B 442 5.305 17.207 -27.028 1.00173.29 C
ATOM 6071 N PHE B 443 11.099 18.385 -27.387 1.00172.47 N
ATOM 6072 CA PHE B 443 12.415 18.494 -26.758 1.00172.39 C
ATOM 6073 C PHE B 443 12.437 18.130 -25.278 1.00173.02 C
ATOM 6074 O PHE B 443 11.533 18.485 -24.524 1.00173.33 O
ATOM 6075 CB PHE B 443 12.962 19.912 -26.926 1.00172.67 C
ATOM 6076 CG PHE B 443 13.221 20.297 -28.351 1.00173.64 C
ATOM 6077 CD1 PHE B 443 14.254 19.708 -29.061 1.00173.75 C
ATOM 6078 CD2 PHE B 443 12.439 21.250 -28.979 1.00174.50 C
ATOM 6079 CE1 PHE B 443 14.499 20.059 -30.374 1.00174.35 C
ATOM 6080 CE2 PHE B 443 12.678 21.606 -30.293 1.00175.42 C
ATOM 6081 CZ PHE B 443 13.711 21.010 -30.991 1.00175.26 C
ATOM 6082 N ARG B 444 13.482 17.416 -24.876 1.00173.60 N
ATOM 6083 CA ARG B 444 13.701 17.082 -23.476 1.00174.18 C
ATOM 6084 C ARG B 444 15.120 17.473 -23.080 1.00173.16 C
ATOM 6085 O ARG B 444 16.009 17.530 -23.929 1.00173.14 O
ATOM 6086 CB ARG B 444 13.456 15.593 -23.225 1.00174.85 C
ATOM 6087 CG ARG B 444 11.998 15.166 -23.370 1.00175.01 C
ATOM 6088 CD ARG B 444 11.857 13.651 -23.354 1.00174.46 C
ATOM 6089 NE ARG B 444 10.473 13.201 -23.200 1.00173.48 N
ATOM 6090 CZ ARG B 444 9.536 13.294 -24.139 1.00173.09 C
ATOM 6091 NH1 ARG B 444 9.827 13.803 -25.327 1.00174.05 N
ATOM 6092 NH2 ARG B 444 8.308 12.858 -23.893 1.00172.22 N
ATOM 6093 N THR B 445 15.331 17.735 -21.796 1.00172.43 N
ATOM 6094 CA THR B 445 16.617 18.241 -21.336 1.00171.89 C
ATOM 6095 C THR B 445 17.630 17.128 -21.098 1.00172.39 C
ATOM 6096 O THR B 445 17.271 15.962 -20.929 1.00172.52 O
ATOM 6097 CB THR B 445 16.469 19.064 -20.041 1.00172.18 C
ATOM 6098 OG1 THR B 445 17.726 19.666 -19.712 1.00172.17 O
ATOM 6099 CG2 THR B 445 16.021 18.177 -18.895 1.00173.47 C
ATOM 6100 N SER B 446 18.902 17.509 -21.095 1.00172.92 N
ATOM 6101 CA SER B 446 20.000 16.570 -20.918 1.00173.56 C
ATOM 6102 C SER B 446 20.201 16.249 -19.438 1.00172.66 C
ATOM 6103 O SER B 446 19.643 16.930 -18.577 1.00172.71 O
ATOM 6104 CB SER B 446 21.282 17.153 -21.522 1.00174.25 C
ATOM 6105 OG SER B 446 21.654 18.351 -20.862 1.00174.46 O
ATOM 6106 N PRO B 447 20.983 15.197 -19.137 1.00172.03 N
ATOM 6107 CA PRO B 447 21.345 14.891 -17.751 1.00171.93 C
ATOM 6108 C PRO B 447 21.944 16.089 -17.022 1.00172.15 C
ATOM 6109 O PRO B 447 21.705 16.255 -15.827 1.00172.35 O
ATOM 6110 CB PRO B 447 22.373 13.775 -17.909 1.00172.81 C
ATOM 6111 CG PRO B 447 21.910 13.054 -19.118 1.00172.86 C
ATOM 6112 CD PRO B 447 21.438 14.135 -20.053 1.00172.30 C
ATOM 6113 N ARG B 448 22.715 16.900 -17.741 1.00172.52 N
ATOM 6114 CA ARG B 448 23.245 18.148 -17.202 1.00173.58 C
ATOM 6115 C ARG B 448 22.131 19.015 -16.620 1.00173.85 C
ATOM 6116 O ARG B 448 22.278 19.593 -15.544 1.00174.28 O
ATOM 6117 CB ARG B 448 24.001 18.921 -18.288 1.00174.15 C
ATOM 6118 CG ARG B 448 24.495 20.295 -17.849 1.00174.60 C
ATOM 6119 CD ARG B 448 25.184 21.040 -18.988 1.00174.40 C
ATOM 6120 NE ARG B 448 26.355 20.335 -19.506 1.00174.75 N
ATOM 6121 CZ ARG B 448 27.522 20.240 -18.875 1.00175.13 C
ATOM 6122 NH1 ARG B 448 27.696 20.816 -17.693 1.00174.61 N
ATOM 6123 NH2 ARG B 448 28.523 19.575 -19.434 1.00175.25 N
ATOM 6124 N GLY B 449 21.015 19.091 -17.339 1.00173.65 N
ATOM 6125 CA GLY B 449 19.873 19.868 -16.900 1.00173.58 C
ATOM 6126 C GLY B 449 19.229 19.315 -15.644 1.00173.05 C
ATOM 6127 O GLY B 449 18.950 20.057 -14.701 1.00173.16 O
ATOM 6128 N TRP B 450 18.994 18.008 -15.631 1.00172.20 N
ATOM 6129 CA TRP B 450 18.336 17.362 -14.503 1.00172.81 C
ATOM 6130 C TRP B 450 19.169 17.450 -13.229 1.00173.63 C
ATOM 6131 O TRP B 450 18.643 17.756 -12.159 1.00174.02 O
ATOM 6132 CB TRP B 450 18.030 15.900 -14.827 1.00172.90 C
ATOM 6133 CG TRP B 450 16.842 15.738 -15.715 1.00172.72 C
ATOM 6134 CD1 TRP B 450 16.829 15.245 -16.985 1.00172.80 C
ATOM 6135 CD2 TRP B 450 15.487 16.087 -15.405 1.00173.19 C
ATOM 6136 NE1 TRP B 450 15.549 15.257 -17.484 1.00173.23 N
ATOM 6137 CE2 TRP B 450 14.706 15.771 -16.534 1.00173.34 C
ATOM 6138 CE3 TRP B 450 14.859 16.633 -14.282 1.00173.70 C
ATOM 6139 CZ2 TRP B 450 13.330 15.981 -16.571 1.00173.80 C
ATOM 6140 CZ3 TRP B 450 13.492 16.842 -14.321 1.00173.73 C
ATOM 6141 CH2 TRP B 450 12.742 16.517 -15.458 1.00173.51 C
ATOM 6142 N PHE B 451 20.464 17.171 -13.350 1.00173.82 N
ATOM 6143 CA PHE B 451 21.379 17.260 -12.218 1.00173.63 C
ATOM 6144 C PHE B 451 21.350 18.658 -11.613 1.00173.63 C
ATOM 6145 O PHE B 451 21.299 18.816 -10.393 1.00173.25 O
ATOM 6146 CB PHE B 451 22.805 16.902 -12.651 1.00173.63 C
ATOM 6147 CG PHE B 451 23.800 16.883 -11.523 1.00173.45 C
ATOM 6148 CD1 PHE B 451 24.155 15.687 -10.924 1.00173.49 C
ATOM 6149 CD2 PHE B 451 24.384 18.055 -11.066 1.00173.61 C
ATOM 6150 CE1 PHE B 451 25.069 15.659 -9.892 1.00173.83 C
ATOM 6151 CE2 PHE B 451 25.292 18.032 -10.031 1.00174.04 C
ATOM 6152 CZ PHE B 451 25.632 16.834 -9.442 1.00174.09 C
ATOM 6153 N THR B 452 21.393 19.666 -12.478 1.00173.85 N
ATOM 6154 CA THR B 452 21.389 21.058 -12.047 1.00174.22 C
ATOM 6155 C THR B 452 20.100 21.404 -11.311 1.00174.33 C
ATOM 6156 O THR B 452 20.130 22.041 -10.261 1.00175.33 O
ATOM 6157 CB THR B 452 21.566 22.018 -13.237 1.00173.91 C
ATOM 6158 OG1 THR B 452 22.831 21.779 -13.863 1.00174.45 O
ATOM 6159 CG2 THR B 452 21.501 23.465 -12.773 1.00173.03 C
ATOM 6160 N PHE B 453 18.969 20.974 -11.863 1.00173.35 N
ATOM 6161 CA PHE B 453 17.671 21.264 -11.265 1.00172.72 C
ATOM 6162 C PHE B 453 17.512 20.626 -9.890 1.00173.16 C
ATOM 6163 O PHE B 453 17.140 21.292 -8.927 1.00173.29 O
ATOM 6164 CB PHE B 453 16.543 20.787 -12.175 1.00172.10 C
ATOM 6165 CG PHE B 453 15.208 20.724 -11.492 1.00172.16 C
ATOM 6166 CD1 PHE B 453 14.524 21.882 -11.169 1.00172.64 C
ATOM 6167 CD2 PHE B 453 14.641 19.503 -11.166 1.00172.56 C
ATOM 6168 CE1 PHE B 453 13.298 21.826 -10.536 1.00172.77 C
ATOM 6169 CE2 PHE B 453 13.416 19.441 -10.533 1.00173.09 C
ATOM 6170 CZ PHE B 453 12.743 20.604 -10.218 1.00172.96 C
ATOM 6171 N ALA B 454 17.796 19.331 -9.814 1.00173.36 N
ATOM 6172 CA ALA B 454 17.630 18.568 -8.584 1.00173.53 C
ATOM 6173 C ALA B 454 18.467 19.150 -7.447 1.00173.35 C
ATOM 6174 O ALA B 454 17.969 19.370 -6.342 1.00173.50 O
ATOM 6175 CB ALA B 454 17.995 17.113 -8.817 1.00173.91 C
ATOM 6176 N HIS B 455 19.742 19.394 -7.732 1.00173.15 N
ATOM 6177 CA HIS B 455 20.688 19.848 -6.724 1.00173.33 C
ATOM 6178 C HIS B 455 20.473 21.300 -6.321 1.00173.42 C
ATOM 6179 O HIS B 455 20.822 21.701 -5.212 1.00174.17 O
ATOM 6180 CB HIS B 455 22.110 19.655 -7.243 1.00173.32 C
ATOM 6181 CG HIS B 455 22.549 18.227 -7.246 1.00174.19 C
ATOM 6182 ND1 HIS B 455 22.078 17.307 -8.157 1.00174.49 N
ATOM 6183 CD2 HIS B 455 23.417 17.561 -6.449 1.00174.12 C
ATOM 6184 CE1 HIS B 455 22.631 16.132 -7.915 1.00174.57 C
ATOM 6185 NE2 HIS B 455 23.453 16.261 -6.890 1.00173.97 N
ATOM 6186 N ALA B 456 19.899 22.083 -7.225 1.00173.33 N
ATOM 6187 CA ALA B 456 19.558 23.462 -6.914 1.00173.84 C
ATOM 6188 C ALA B 456 18.370 23.497 -5.964 1.00172.78 C
ATOM 6189 O ALA B 456 18.308 24.331 -5.060 1.00172.57 O
ATOM 6190 CB ALA B 456 19.252 24.241 -8.179 1.00175.03 C
ATOM 6191 N VAL B 457 17.435 22.578 -6.169 1.00172.30 N
ATOM 6192 CA VAL B 457 16.257 22.483 -5.317 1.00173.13 C
ATOM 6193 C VAL B 457 16.629 21.933 -3.944 1.00174.01 C
ATOM 6194 O VAL B 457 16.301 22.535 -2.919 1.00174.43 O
ATOM 6195 CB VAL B 457 15.168 21.595 -5.950 1.00173.39 C
ATOM 6196 CG1 VAL B 457 14.070 21.299 -4.939 1.00174.12 C
ATOM 6197 CG2 VAL B 457 14.588 22.270 -7.185 1.00173.10 C
ATOM 6198 N PHE B 458 17.301 20.785 -3.932 1.00174.07 N
ATOM 6199 CA PHE B 458 17.809 20.183 -2.699 1.00173.58 C
ATOM 6200 C PHE B 458 18.595 21.182 -1.849 1.00173.66 C
ATOM 6201 O PHE B 458 18.406 21.255 -0.636 1.00173.12 O
ATOM 6202 CB PHE B 458 18.687 18.972 -3.022 1.00173.20 C
ATOM 6203 CG PHE B 458 17.920 17.774 -3.497 1.00172.26 C
ATOM 6204 CD1 PHE B 458 16.632 17.536 -3.048 1.00171.60 C
ATOM 6205 CD2 PHE B 458 18.494 16.875 -4.379 1.00172.71 C
ATOM 6206 CE1 PHE B 458 15.928 16.431 -3.483 1.00171.37 C
ATOM 6207 CE2 PHE B 458 17.795 15.768 -4.816 1.00172.23 C
ATOM 6208 CZ PHE B 458 16.510 15.546 -4.366 1.00171.71 C
ATOM 6209 N ALA B 459 19.483 21.934 -2.494 1.00174.09 N
ATOM 6210 CA ALA B 459 20.271 22.962 -1.816 1.00174.12 C
ATOM 6211 C ALA B 459 19.383 23.992 -1.131 1.00173.88 C
ATOM 6212 O ALA B 459 19.519 24.244 0.065 1.00174.11 O
ATOM 6213 CB ALA B 459 21.207 23.651 -2.797 1.00174.18 C
ATOM 6214 N LEU B 460 18.477 24.587 -1.903 1.00173.11 N
ATOM 6215 CA LEU B 460 17.567 25.598 -1.380 1.00172.86 C
ATOM 6216 C LEU B 460 16.699 25.023 -0.264 1.00173.04 C
ATOM 6217 O LEU B 460 16.321 25.729 0.669 1.00173.09 O
ATOM 6218 CB LEU B 460 16.685 26.157 -2.500 1.00172.21 C
ATOM 6219 CG LEU B 460 15.780 27.337 -2.138 1.00171.81 C
ATOM 6220 CD1 LEU B 460 16.602 28.485 -1.576 1.00172.59 C
ATOM 6221 CD2 LEU B 460 14.973 27.792 -3.341 1.00172.07 C
ATOM 6222 N LEU B 461 16.400 23.731 -0.361 1.00172.85 N
ATOM 6223 CA LEU B 461 15.614 23.048 0.657 1.00172.77 C
ATOM 6224 C LEU B 461 16.432 22.827 1.922 1.00173.89 C
ATOM 6225 O LEU B 461 15.932 22.998 3.034 1.00174.98 O
ATOM 6226 CB LEU B 461 15.097 21.710 0.127 1.00172.61 C
ATOM 6227 CG LEU B 461 13.750 21.741 -0.594 1.00172.29 C
ATOM 6228 CD1 LEU B 461 13.328 20.335 -0.989 1.00173.06 C
ATOM 6229 CD2 LEU B 461 12.689 22.406 0.271 1.00172.18 C
ATOM 6230 N PHE B 462 17.694 22.448 1.745 1.00173.69 N
ATOM 6231 CA PHE B 462 18.585 22.190 2.871 1.00173.64 C
ATOM 6232 C PHE B 462 18.904 23.458 3.656 1.00173.69 C
ATOM 6233 O PHE B 462 19.280 23.387 4.826 1.00173.74 O
ATOM 6234 CB PHE B 462 19.878 21.533 2.386 1.00173.76 C
ATOM 6235 CG PHE B 462 19.860 20.036 2.473 1.00173.72 C
ATOM 6236 CD1 PHE B 462 20.719 19.370 3.329 1.00173.91 C
ATOM 6237 CD2 PHE B 462 18.968 19.296 1.717 1.00173.69 C
ATOM 6238 CE1 PHE B 462 20.700 17.994 3.418 1.00173.84 C
ATOM 6239 CE2 PHE B 462 18.942 17.919 1.803 1.00173.77 C
ATOM 6240 CZ PHE B 462 19.809 17.267 2.655 1.00173.47 C
ATOM 6241 N PHE B 463 18.766 24.611 3.006 1.00173.12 N
ATOM 6242 CA PHE B 463 18.916 25.894 3.684 1.00173.01 C
ATOM 6243 C PHE B 463 17.969 25.975 4.878 1.00174.18 C
ATOM 6244 O PHE B 463 18.363 26.387 5.970 1.00174.62 O
ATOM 6245 CB PHE B 463 18.660 27.052 2.714 1.00172.44 C
ATOM 6246 CG PHE B 463 18.484 28.387 3.388 1.00172.47 C
ATOM 6247 CD1 PHE B 463 19.584 29.159 3.723 1.00172.94 C
ATOM 6248 CD2 PHE B 463 17.218 28.877 3.669 1.00172.83 C
ATOM 6249 CE1 PHE B 463 19.426 30.386 4.338 1.00173.33 C
ATOM 6250 CE2 PHE B 463 17.055 30.103 4.284 1.00172.96 C
ATOM 6251 CZ PHE B 463 18.160 30.859 4.619 1.00172.91 C
ATOM 6252 N PHE B 464 16.720 25.575 4.658 1.00174.49 N
ATOM 6253 CA PHE B 464 15.723 25.548 5.723 1.00174.45 C
ATOM 6254 C PHE B 464 16.112 24.593 6.847 1.00173.88 C
ATOM 6255 O PHE B 464 15.879 24.882 8.019 1.00174.21 O
ATOM 6256 CB PHE B 464 14.353 25.156 5.164 1.00174.57 C
ATOM 6257 CG PHE B 464 13.252 25.188 6.183 1.00173.80 C
ATOM 6258 CD1 PHE B 464 12.560 26.360 6.435 1.00174.05 C
ATOM 6259 CD2 PHE B 464 12.902 24.045 6.885 1.00172.98 C
ATOM 6260 CE1 PHE B 464 11.543 26.393 7.369 1.00173.86 C
ATOM 6261 CE2 PHE B 464 11.888 24.072 7.821 1.00173.27 C
ATOM 6262 CZ PHE B 464 11.207 25.247 8.064 1.00173.21 C
ATOM 6263 N GLY B 465 16.708 23.461 6.484 1.00173.59 N
ATOM 6264 CA GLY B 465 17.120 22.475 7.464 1.00174.26 C
ATOM 6265 C GLY B 465 18.190 23.053 8.359 1.00174.19 C
ATOM 6266 O GLY B 465 18.201 22.827 9.572 1.00174.68 O
ATOM 6267 N HIS B 466 19.098 23.799 7.744 1.00172.87 N
ATOM 6268 CA HIS B 466 20.120 24.530 8.470 1.00172.84 C
ATOM 6269 C HIS B 466 19.525 25.538 9.456 1.00173.63 C
ATOM 6270 O HIS B 466 19.856 25.521 10.642 1.00174.34 O
ATOM 6271 CB HIS B 466 21.043 25.253 7.497 1.00172.82 C
ATOM 6272 CG HIS B 466 21.884 26.295 8.154 1.00173.58 C
ATOM 6273 ND1 HIS B 466 22.711 26.017 9.220 1.00174.99 N
ATOM 6274 CD2 HIS B 466 21.999 27.623 7.923 1.00173.20 C
ATOM 6275 CE1 HIS B 466 23.315 27.125 9.606 1.00174.74 C
ATOM 6276 NE2 HIS B 466 22.897 28.114 8.836 1.00173.69 N
ATOM 6277 N ILE B 467 18.665 26.421 8.950 1.00173.44 N
ATOM 6278 CA ILE B 467 17.992 27.430 9.774 1.00174.88 C
ATOM 6279 C ILE B 467 17.195 26.782 10.911 1.00175.53 C
ATOM 6280 O ILE B 467 17.168 27.292 12.035 1.00175.74 O
ATOM 6281 CB ILE B 467 17.058 28.331 8.914 1.00174.59 C
ATOM 6282 CG1 ILE B 467 17.745 29.660 8.580 1.00173.68 C
ATOM 6283 CG2 ILE B 467 15.753 28.641 9.638 1.00174.78 C
ATOM 6284 CD1 ILE B 467 19.111 29.524 7.950 1.00173.42 C
ATOM 6285 N TRP B 468 16.568 25.647 10.620 1.00175.24 N
ATOM 6286 CA TRP B 468 15.721 24.967 11.595 1.00174.26 C
ATOM 6287 C TRP B 468 16.544 24.351 12.722 1.00173.80 C
ATOM 6288 O TRP B 468 16.341 24.674 13.891 1.00174.18 O
ATOM 6289 CB TRP B 468 14.875 23.892 10.909 1.00174.20 C
ATOM 6290 CG TRP B 468 14.219 22.951 11.867 1.00173.45 C
ATOM 6291 CD1 TRP B 468 14.599 21.671 12.151 1.00172.65 C
ATOM 6292 CD2 TRP B 468 13.069 23.217 12.681 1.00173.85 C
ATOM 6293 NE1 TRP B 468 13.755 21.124 13.088 1.00172.84 N
ATOM 6294 CE2 TRP B 468 12.809 22.053 13.430 1.00173.59 C
ATOM 6295 CE3 TRP B 468 12.235 24.327 12.848 1.00174.36 C
ATOM 6296 CZ2 TRP B 468 11.750 21.966 14.330 1.00173.72 C
ATOM 6297 CZ3 TRP B 468 11.184 24.239 13.743 1.00174.12 C
ATOM 6298 CH2 TRP B 468 10.952 23.068 14.473 1.00173.56 C
ATOM 6299 N HIS B 469 17.465 23.461 12.367 1.00173.68 N
ATOM 6300 CA HIS B 469 18.319 22.808 13.354 1.00174.77 C
ATOM 6301 C HIS B 469 19.226 23.784 14.095 1.00175.26 C
ATOM 6302 O HIS B 469 19.526 23.589 15.276 1.00175.25 O
ATOM 6303 CB HIS B 469 19.167 21.732 12.689 1.00174.88 C
ATOM 6304 CG HIS B 469 18.406 20.493 12.354 1.00174.43 C
ATOM 6305 ND1 HIS B 469 17.698 19.777 13.297 1.00174.65 N
ATOM 6306 CD2 HIS B 469 18.244 19.834 11.184 1.00173.80 C
ATOM 6307 CE1 HIS B 469 17.131 18.735 12.721 1.00174.33 C
ATOM 6308 NE2 HIS B 469 17.449 18.746 11.438 1.00173.93 N
ATOM 6309 N GLY B 470 19.669 24.820 13.391 1.00174.73 N
ATOM 6310 CA GLY B 470 20.481 25.862 13.989 1.00174.46 C
ATOM 6311 C GLY B 470 19.717 26.508 15.123 1.00174.59 C
ATOM 6312 O GLY B 470 20.224 26.643 16.238 1.00174.80 O
ATOM 6313 N ALA B 471 18.487 26.911 14.824 1.00174.55 N
ATOM 6314 CA ALA B 471 17.584 27.475 15.819 1.00174.74 C
ATOM 6315 C ALA B 471 17.343 26.523 16.992 1.00175.26 C
ATOM 6316 O ALA B 471 17.448 26.919 18.151 1.00174.78 O
ATOM 6317 CB ALA B 471 16.262 27.846 15.169 1.00173.58 C
ATOM 6318 N ARG B 472 17.042 25.263 16.685 1.00175.39 N
ATOM 6319 CA ARG B 472 16.709 24.276 17.712 1.00174.23 C
ATOM 6320 C ARG B 472 17.897 23.960 18.622 1.00173.75 C
ATOM 6321 O ARG B 472 17.737 23.351 19.679 1.00174.45 O
ATOM 6322 CB ARG B 472 16.189 22.990 17.061 1.00173.85 C
ATOM 6323 CG ARG B 472 15.435 22.078 18.012 1.00173.65 C
ATOM 6324 CD ARG B 472 14.830 20.887 17.292 1.00173.64 C
ATOM 6325 NE ARG B 472 14.096 20.008 18.201 1.00173.94 N
ATOM 6326 CZ ARG B 472 14.664 19.203 19.093 1.00173.94 C
ATOM 6327 NH1 ARG B 472 15.985 19.146 19.199 1.00173.95 N
ATOM 6328 NH2 ARG B 472 13.910 18.447 19.876 1.00174.20 N
ATOM 6329 N THR B 473 19.085 24.393 18.217 1.00173.47 N
ATOM 6330 CA THR B 473 20.288 24.155 19.005 1.00173.92 C
ATOM 6331 C THR B 473 20.538 25.320 19.957 1.00174.57 C
ATOM 6332 O THR B 473 20.837 25.122 21.137 1.00174.87 O
ATOM 6333 CB THR B 473 21.522 23.956 18.108 1.00173.14 C
ATOM 6334 OG1 THR B 473 21.395 22.726 17.383 1.00172.39 O
ATOM 6335 CG2 THR B 473 22.787 23.916 18.946 1.00173.45 C
ATOM 6336 N LEU B 474 20.405 26.536 19.438 1.00174.33 N
ATOM 6337 CA LEU B 474 20.641 27.734 20.231 1.00174.50 C
ATOM 6338 C LEU B 474 19.427 28.085 21.086 1.00174.54 C
ATOM 6339 O LEU B 474 19.507 28.939 21.968 1.00175.26 O
ATOM 6340 CB LEU B 474 20.999 28.911 19.321 1.00174.05 C
ATOM 6341 CG LEU B 474 22.243 28.752 18.445 1.00173.70 C
ATOM 6342 CD1 LEU B 474 22.593 30.073 17.783 1.00173.27 C
ATOM 6343 CD2 LEU B 474 23.415 28.228 19.258 1.00174.39 C
ATOM 6344 N PHE B 475 18.308 27.416 20.825 1.00174.09 N
ATOM 6345 CA PHE B 475 17.065 27.684 21.542 1.00174.70 C
ATOM 6346 C PHE B 475 16.491 26.424 22.187 1.00173.96 C
ATOM 6347 O PHE B 475 15.280 26.322 22.398 1.00173.89 O
ATOM 6348 CB PHE B 475 16.025 28.305 20.604 1.00175.13 C
ATOM 6349 CG PHE B 475 16.363 29.700 20.155 1.00174.67 C
ATOM 6350 CD1 PHE B 475 15.810 30.800 20.792 1.00173.82 C
ATOM 6351 CD2 PHE B 475 17.229 29.914 19.095 1.00174.41 C
ATOM 6352 CE1 PHE B 475 16.115 32.084 20.381 1.00173.40 C
ATOM 6353 CE2 PHE B 475 17.540 31.195 18.682 1.00174.23 C
ATOM 6354 CZ PHE B 475 16.982 32.280 19.326 1.00173.83 C
ATOM 6355 N ARG B 476 17.361 25.462 22.482 1.00173.73 N
ATOM 6356 CA ARG B 476 16.945 24.216 23.121 1.00173.81 C
ATOM 6357 C ARG B 476 16.273 24.457 24.475 1.00174.11 C
ATOM 6358 O ARG B 476 15.310 23.776 24.827 1.00173.48 O
ATOM 6359 CB ARG B 476 18.142 23.277 23.297 1.00173.75 C
ATOM 6360 CG ARG B 476 17.773 21.802 23.244 1.00173.56 C
ATOM 6361 CD ARG B 476 18.896 20.918 23.761 1.00174.73 C
ATOM 6362 NE ARG B 476 19.118 21.101 25.193 1.00176.29 N
ATOM 6363 CZ ARG B 476 19.935 20.353 25.928 1.00175.97 C
ATOM 6364 NH1 ARG B 476 20.612 19.359 25.367 1.00176.35 N
ATOM 6365 NH2 ARG B 476 20.073 20.594 27.224 1.00174.74 N
ATOM 6366 N ASP B 477 16.794 25.420 25.232 1.00174.68 N
ATOM 6367 CA ASP B 477 16.239 25.760 26.542 1.00174.45 C
ATOM 6368 C ASP B 477 14.798 26.276 26.450 1.00174.16 C
ATOM 6369 O ASP B 477 13.921 25.812 27.178 1.00173.87 O
ATOM 6370 CB ASP B 477 17.130 26.789 27.254 1.00174.38 C
ATOM 6371 CG ASP B 477 17.288 28.078 26.471 1.00174.59 C
ATOM 6372 OD1 ASP B 477 17.639 28.011 25.274 1.00174.74 O
ATOM 6373 OD2 ASP B 477 17.061 29.160 27.053 1.00174.60 O
ATOM 6374 N VAL B 478 14.555 27.229 25.553 1.00174.29 N
ATOM 6375 CA VAL B 478 13.228 27.820 25.405 1.00174.13 C
ATOM 6376 C VAL B 478 12.308 26.960 24.543 1.00173.45 C
ATOM 6377 O VAL B 478 11.169 27.340 24.267 1.00172.58 O
ATOM 6378 CB VAL B 478 13.304 29.232 24.799 1.00174.48 C
ATOM 6379 CG1 VAL B 478 13.930 30.200 25.790 1.00174.68 C
ATOM 6380 CG2 VAL B 478 14.095 29.208 23.509 1.00174.68 C
ATOM 6381 N PHE B 479 12.807 25.807 24.111 1.00173.66 N
ATOM 6382 CA PHE B 479 11.973 24.831 23.421 1.00173.93 C
ATOM 6383 C PHE B 479 10.906 24.327 24.388 1.00175.19 C
ATOM 6384 O PHE B 479 11.087 24.409 25.604 1.00176.36 O
ATOM 6385 CB PHE B 479 12.816 23.673 22.888 1.00173.97 C
ATOM 6386 CG PHE B 479 12.163 22.908 21.772 1.00174.04 C
ATOM 6387 CD1 PHE B 479 11.896 23.521 20.561 1.00173.60 C
ATOM 6388 CD2 PHE B 479 11.821 21.574 21.934 1.00174.24 C
ATOM 6389 CE1 PHE B 479 11.297 22.820 19.530 1.00173.70 C
ATOM 6390 CE2 PHE B 479 11.222 20.870 20.907 1.00173.57 C
ATOM 6391 CZ PHE B 479 10.960 21.492 19.705 1.00173.45 C
ATOM 6392 N SER B 480 9.796 23.839 23.836 1.00175.03 N
ATOM 6393 CA SER B 480 8.630 23.378 24.603 1.00175.20 C
ATOM 6394 C SER B 480 7.870 24.531 25.275 1.00174.35 C
ATOM 6395 O SER B 480 6.755 24.341 25.764 1.00173.49 O
ATOM 6396 CB SER B 480 9.030 22.329 25.652 1.00175.30 C
ATOM 6397 OG SER B 480 9.899 21.353 25.099 1.00174.57 O
ATOM 6398 N GLY B 481 8.472 25.718 25.309 1.00174.14 N
ATOM 6399 CA GLY B 481 7.805 26.893 25.845 1.00173.50 C
ATOM 6400 C GLY B 481 8.681 27.817 26.674 1.00173.31 C
ATOM 6401 O GLY B 481 9.883 27.596 26.812 1.00173.43 O
ATOM 6402 N ILE B 482 8.065 28.859 27.228 1.00173.78 N
ATOM 6403 CA ILE B 482 8.761 29.837 28.062 1.00174.19 C
ATOM 6404 C ILE B 482 8.210 29.848 29.491 1.00174.92 C
ATOM 6405 O ILE B 482 7.482 28.938 29.881 1.00175.06 O
ATOM 6406 CB ILE B 482 8.661 31.248 27.458 1.00173.34 C
ATOM 6407 CG1 ILE B 482 7.202 31.706 27.401 1.00173.19 C
ATOM 6408 CG2 ILE B 482 9.254 31.261 26.061 1.00172.23 C
ATOM 6409 CD1 ILE B 482 7.033 33.110 26.879 1.00172.89 C
ATOM 6410 N ASP B 483 8.550 30.877 30.266 1.00174.95 N
ATOM 6411 CA ASP B 483 8.175 30.917 31.678 1.00173.72 C
ATOM 6412 C ASP B 483 8.323 32.324 32.285 1.00173.69 C
ATOM 6413 O ASP B 483 9.272 33.033 31.954 1.00173.73 O
ATOM 6414 CB ASP B 483 9.021 29.902 32.458 1.00172.29 C
ATOM 6415 CG ASP B 483 8.230 28.670 32.849 1.00173.10 C
ATOM 6416 OD1 ASP B 483 8.852 27.661 33.238 1.00173.91 O
ATOM 6417 OD2 ASP B 483 6.985 28.707 32.754 1.00173.10 O
ATOM 6418 N PRO B 484 7.401 32.700 33.205 1.00173.54 N
ATOM 6419 CA PRO B 484 7.089 33.986 33.845 1.00173.52 C
ATOM 6420 C PRO B 484 8.001 35.201 33.630 1.00172.82 C
ATOM 6421 O PRO B 484 8.505 35.441 32.535 1.00171.52 O
ATOM 6422 CB PRO B 484 7.090 33.599 35.326 1.00173.81 C
ATOM 6423 CG PRO B 484 6.559 32.154 35.321 1.00172.75 C
ATOM 6424 CD PRO B 484 6.614 31.654 33.877 1.00173.07 C
ATOM 6425 N GLU B 485 8.136 35.988 34.699 1.00173.91 N
ATOM 6426 CA GLU B 485 8.834 37.281 34.726 1.00173.62 C
ATOM 6427 C GLU B 485 8.187 38.327 33.808 1.00173.30 C
ATOM 6428 O GLU B 485 7.375 37.997 32.944 1.00172.62 O
ATOM 6429 CB GLU B 485 10.320 37.102 34.382 1.00173.57 C
ATOM 6430 CG GLU B 485 10.748 37.621 33.021 1.00173.93 C
ATOM 6431 CD GLU B 485 12.253 37.725 32.893 1.00174.99 C
ATOM 6432 OE1 GLU B 485 12.946 36.756 33.261 1.00175.33 O
ATOM 6433 OE2 GLU B 485 12.741 38.780 32.438 1.00175.37 O
ATOM 6434 N LEU B 486 8.550 39.592 34.012 1.00173.73 N
ATOM 6435 CA LEU B 486 7.928 40.709 33.302 1.00173.96 C
ATOM 6436 C LEU B 486 8.884 41.902 33.240 1.00174.25 C
ATOM 6437 O LEU B 486 8.648 42.933 33.869 1.00174.62 O
ATOM 6438 CB LEU B 486 6.612 41.106 33.982 1.00173.44 C
ATOM 6439 CG LEU B 486 5.576 41.992 33.273 1.00172.83 C
ATOM 6440 CD1 LEU B 486 5.336 43.282 34.052 1.00172.31 C
ATOM 6441 CD2 LEU B 486 5.934 42.295 31.819 1.00173.12 C
ATOM 6442 N SER B 487 9.957 41.748 32.471 1.00174.23 N
ATOM 6443 CA SER B 487 11.004 42.768 32.366 1.00174.54 C
ATOM 6444 C SER B 487 10.884 43.789 31.207 1.00175.28 C
ATOM 6445 O SER B 487 10.845 44.989 31.475 1.00176.09 O
ATOM 6446 CB SER B 487 12.372 42.079 32.285 1.00173.15 C
ATOM 6447 OG SER B 487 12.490 41.275 31.124 1.00171.54 O
ATOM 6448 N PRO B 488 10.790 43.322 29.938 1.00173.96 N
ATOM 6449 CA PRO B 488 11.057 44.095 28.718 1.00173.30 C
ATOM 6450 C PRO B 488 11.600 45.523 28.854 1.00174.64 C
ATOM 6451 O PRO B 488 12.761 45.699 29.224 1.00175.22 O
ATOM 6452 CB PRO B 488 9.680 44.117 28.051 1.00172.28 C
ATOM 6453 CG PRO B 488 9.041 42.790 28.488 1.00172.15 C
ATOM 6454 CD PRO B 488 9.918 42.193 29.579 1.00173.02 C
ATOM 6455 N GLU B 489 10.769 46.518 28.556 1.00175.17 N
ATOM 6456 CA GLU B 489 11.238 47.878 28.269 1.00175.06 C
ATOM 6457 C GLU B 489 11.907 48.628 29.425 1.00175.90 C
ATOM 6458 O GLU B 489 11.480 49.728 29.782 1.00174.50 O
ATOM 6459 CB GLU B 489 10.067 48.718 27.754 1.00173.84 C
ATOM 6460 CG GLU B 489 9.244 48.033 26.679 1.00174.39 C
ATOM 6461 CD GLU B 489 9.950 47.999 25.339 1.00174.02 C
ATOM 6462 OE1 GLU B 489 10.856 48.832 25.124 1.00174.25 O
ATOM 6463 OE2 GLU B 489 9.595 47.146 24.499 1.00172.75 O
ATOM 6464 N GLN B 490 12.964 48.039 29.982 1.00177.13 N
ATOM 6465 CA GLN B 490 13.814 48.706 30.969 1.00176.70 C
ATOM 6466 C GLN B 490 15.108 47.916 31.186 1.00175.75 C
ATOM 6467 O GLN B 490 15.099 46.834 31.774 1.00174.35 O
ATOM 6468 CB GLN B 490 13.071 48.906 32.299 1.00175.35 C
ATOM 6469 CG GLN B 490 12.328 47.686 32.826 1.00174.34 C
ATOM 6470 CD GLN B 490 12.937 47.145 34.105 1.00173.69 C
ATOM 6471 OE1 GLN B 490 12.251 46.992 35.116 1.00174.54 O
ATOM 6472 NE2 GLN B 490 14.230 46.850 34.065 1.00173.84 N
ATOM 6473 N VAL B 491 16.213 48.462 30.678 1.00176.31 N
ATOM 6474 CA VAL B 491 17.532 47.833 30.780 1.00174.98 C
ATOM 6475 C VAL B 491 17.883 47.442 32.216 1.00175.10 C
ATOM 6476 O VAL B 491 17.928 46.259 32.553 1.00175.42 O
ATOM 6477 CB VAL B 491 18.639 48.758 30.233 1.00172.79 C
ATOM 6478 CG1 VAL B 491 18.803 49.981 31.122 1.00172.95 C
ATOM 6479 CG2 VAL B 491 19.953 48.000 30.113 1.00171.53 C
HETATM41743 MG CLA B 601 49.390 30.779 -5.701 1.00175.37 M
HETATM41744 CHA CLA B 601 52.373 29.039 -6.032 1.00175.09 C
HETATM41745 CHB CLA B 601 50.379 32.938 -8.143 1.00175.14 C
HETATM41746 CHC CLA B 601 46.411 32.453 -5.347 1.00175.36 C
HETATM41747 CHD CLA B 601 48.430 28.557 -3.104 1.00174.68 C
HETATM41748 NA CLA B 601 51.107 30.937 -6.888 1.00175.19 N
HETATM41749 C1A CLA B 601 52.246 30.115 -6.875 1.00174.83 C
HETATM41750 C2A CLA B 601 53.277 30.590 -7.904 1.00174.21 C
HETATM41751 C3A CLA B 601 52.647 31.879 -8.485 1.00173.39 C
HETATM41752 C4A CLA B 601 51.273 31.937 -7.812 1.00174.80 C
HETATM41753 CMA CLA B 601 53.479 33.104 -8.196 1.00172.46 C
HETATM41754 CAA CLA B 601 53.476 29.558 -9.003 1.00174.59 C
HETATM41755 CBA CLA B 601 54.810 29.723 -9.704 1.00175.43 C
HETATM41756 CGA CLA B 601 55.699 28.550 -9.409 1.00176.73 C
HETATM41757 O1A CLA B 601 56.158 28.188 -8.323 1.00176.14 O
HETATM41758 O2A CLA B 601 56.009 27.817 -10.523 1.00177.88 O
HETATM41759 NB CLA B 601 48.584 32.432 -6.525 1.00175.52 N
HETATM41760 C1B CLA B 601 49.093 33.100 -7.594 1.00175.50 C
HETATM41761 C2B CLA B 601 48.078 34.055 -8.127 1.00175.64 C
HETATM41762 C3B CLA B 601 46.953 33.925 -7.345 1.00175.19 C
HETATM41763 C4B CLA B 601 47.259 32.889 -6.317 1.00175.21 C
HETATM41764 CMB CLA B 601 48.324 34.919 -9.279 1.00175.21 C
HETATM41765 CAB CLA B 601 45.685 34.606 -7.431 1.00174.61 C
HETATM41766 CBB CLA B 601 44.498 34.012 -7.584 1.00173.82 C
HETATM41767 NC CLA B 601 47.732 30.537 -4.450 1.00175.80 N
HETATM41768 C1C CLA B 601 46.631 31.348 -4.473 1.00176.08 C
HETATM41769 C2C CLA B 601 45.676 30.929 -3.458 1.00176.11 C
HETATM41770 C3C CLA B 601 46.227 29.814 -2.822 1.00175.17 C
HETATM41771 C4C CLA B 601 47.528 29.580 -3.450 1.00175.31 C
HETATM41772 CMC CLA B 601 44.396 31.597 -3.226 1.00175.81 C
HETATM41773 CAC CLA B 601 45.640 29.044 -1.711 1.00173.23 C
HETATM41774 CBC CLA B 601 44.462 28.196 -2.125 1.00173.27 C
HETATM41775 ND CLA B 601 50.117 29.115 -4.812 1.00174.94 N
HETATM41776 C1D CLA B 601 49.641 28.324 -3.729 1.00174.92 C
HETATM41777 C2D CLA B 601 50.636 27.268 -3.434 1.00175.27 C
HETATM41778 C3D CLA B 601 51.693 27.480 -4.304 1.00175.84 C
HETATM41779 C4D CLA B 601 51.334 28.662 -5.116 1.00175.19 C
HETATM41780 CMD CLA B 601 50.467 26.233 -2.414 1.00173.88 C
HETATM41781 CAD CLA B 601 52.999 27.024 -4.752 1.00175.53 C
HETATM41782 OBD CLA B 601 53.633 26.030 -4.413 1.00174.87 O
HETATM41783 CBD CLA B 601 53.505 28.057 -5.810 1.00175.33 C
HETATM41784 CGD CLA B 601 54.757 28.760 -5.355 1.00175.61 C
HETATM41785 O1D CLA B 601 54.855 29.895 -4.873 1.00175.17 O
HETATM41786 O2D CLA B 601 55.897 28.027 -5.509 1.00175.84 O
HETATM41787 CED CLA B 601 56.757 27.874 -4.377 1.00175.01 C
HETATM41788 C1 CLA B 601 56.918 26.711 -10.339 1.00175.74 C
HETATM41789 C2 CLA B 601 56.418 25.593 -11.179 1.00175.50 C
HETATM41790 C3 CLA B 601 56.503 24.304 -10.802 1.00174.97 C
HETATM41791 C4 CLA B 601 55.999 23.200 -11.652 1.00174.17 C
HETATM41792 C5 CLA B 601 57.118 23.928 -9.499 1.00174.61 C
HETATM41793 C6 CLA B 601 56.085 23.718 -8.410 1.00174.48 C
HETATM41794 C7 CLA B 601 56.731 23.163 -7.157 1.00175.47 C
HETATM41795 C8 CLA B 601 55.957 23.548 -5.901 1.00175.29 C
HETATM41796 C9 CLA B 601 56.902 24.054 -4.829 1.00175.48 C
HETATM41797 C10 CLA B 601 55.149 22.370 -5.377 1.00175.11 C
HETATM41798 C11 CLA B 601 54.098 22.821 -4.386 1.00174.58 C
HETATM41799 C12 CLA B 601 53.186 21.685 -3.977 1.00174.90 C
HETATM41800 C13 CLA B 601 52.903 21.725 -2.482 1.00175.11 C
HETATM41801 C14 CLA B 601 52.885 20.322 -1.908 1.00174.78 C
HETATM41802 C15 CLA B 601 51.593 22.444 -2.177 1.00174.77 C
HETATM41803 C16 CLA B 601 51.657 23.160 -0.843 1.00175.03 C
HETATM41804 C17 CLA B 601 50.519 22.750 0.068 1.00175.63 C
HETATM41805 C18 CLA B 601 50.221 23.811 1.121 1.00175.90 C
HETATM41806 C19 CLA B 601 49.099 24.725 0.672 1.00175.43 C
HETATM41807 C20 CLA B 601 49.873 23.169 2.447 1.00174.14 C
HETATM41808 MG CLA B 602 36.442 16.748 -4.034 1.00172.53 M
HETATM41809 CHA CLA B 602 35.459 16.084 -7.301 1.00172.94 C
HETATM41810 CHB CLA B 602 36.161 20.085 -4.629 1.00174.49 C
HETATM41811 CHC CLA B 602 37.255 17.341 -0.749 1.00173.71 C
HETATM41812 CHD CLA B 602 36.798 13.268 -3.483 1.00174.22 C
HETATM41813 NA CLA B 602 35.917 17.874 -5.713 1.00173.44 N
HETATM41814 C1A CLA B 602 35.528 17.416 -6.981 1.00173.22 C
HETATM41815 C2A CLA B 602 35.233 18.592 -7.915 1.00174.04 C
HETATM41816 C3A CLA B 602 35.665 19.829 -7.094 1.00174.36 C
HETATM41817 C4A CLA B 602 35.928 19.245 -5.703 1.00174.31 C
HETATM41818 CMA CLA B 602 36.884 20.501 -7.673 1.00174.29 C
HETATM41819 CAA CLA B 602 33.746 18.664 -8.217 1.00174.18 C
HETATM41820 CBA CLA B 602 32.902 18.508 -6.963 1.00173.68 C
HETATM41821 CGA CLA B 602 32.653 19.838 -6.316 1.00173.40 C
HETATM41822 O1A CLA B 602 32.412 20.919 -6.858 1.00173.44 O
HETATM41823 O2A CLA B 602 32.710 19.800 -4.947 1.00172.99 O
HETATM41824 NB CLA B 602 36.699 18.399 -2.915 1.00173.02 N
HETATM41825 C1B CLA B 602 36.439 19.671 -3.315 1.00173.66 C
HETATM41826 C2B CLA B 602 36.535 20.601 -2.152 1.00173.51 C
HETATM41827 C3B CLA B 602 36.846 19.827 -1.053 1.00173.82 C
HETATM41828 C4B CLA B 602 36.957 18.418 -1.526 1.00173.49 C
HETATM41829 CMB CLA B 602 36.319 22.041 -2.273 1.00173.57 C
HETATM41830 CAB CLA B 602 37.058 20.181 0.326 1.00173.99 C
HETATM41831 CBB CLA B 602 36.324 21.042 1.030 1.00173.78 C
HETATM41832 NC CLA B 602 36.955 15.520 -2.422 1.00173.86 N
HETATM41833 C1C CLA B 602 37.262 15.977 -1.169 1.00173.84 C
HETATM41834 C2C CLA B 602 37.588 14.855 -0.294 1.00174.05 C
HETATM41835 C3C CLA B 602 37.449 13.698 -1.060 1.00174.65 C
HETATM41836 C4C CLA B 602 37.053 14.126 -2.399 1.00174.53 C
HETATM41837 CMC CLA B 602 37.970 14.979 1.113 1.00173.72 C
HETATM41838 CAC CLA B 602 37.689 12.310 -0.630 1.00174.91 C
HETATM41839 CBC CLA B 602 38.944 11.736 -1.253 1.00175.21 C
HETATM41840 ND CLA B 602 36.205 15.036 -5.083 1.00173.46 N
HETATM41841 C1D CLA B 602 36.400 13.671 -4.741 1.00173.71 C
HETATM41842 C2D CLA B 602 36.090 12.830 -5.919 1.00173.40 C
HETATM41843 C3D CLA B 602 35.692 13.702 -6.918 1.00173.34 C
HETATM41844 C4D CLA B 602 35.800 15.063 -6.353 1.00173.12 C
HETATM41845 CMD CLA B 602 36.171 11.371 -5.942 1.00173.13 C
HETATM41846 CAD CLA B 602 35.248 13.834 -8.293 1.00173.31 C
HETATM41847 OBD CLA B 602 35.022 12.961 -9.123 1.00173.37 O
HETATM41848 CBD CLA B 602 35.100 15.361 -8.582 1.00173.19 C
HETATM41849 CGD CLA B 602 35.969 15.774 -9.738 1.00174.18 C
HETATM41850 O1D CLA B 602 35.618 16.305 -10.795 1.00175.05 O
HETATM41851 O2D CLA B 602 37.293 15.503 -9.568 1.00174.37 O
HETATM41852 CED CLA B 602 37.967 14.792 -10.610 1.00174.80 C
HETATM41853 C1 CLA B 602 32.443 21.046 -4.268 1.00173.71 C
HETATM41854 C2 CLA B 602 32.633 20.821 -2.811 1.00174.01 C
HETATM41855 C3 CLA B 602 32.532 21.807 -1.899 1.00174.22 C
HETATM41856 C4 CLA B 602 32.222 23.203 -2.288 1.00173.76 C
HETATM41857 C5 CLA B 602 32.731 21.530 -0.445 1.00174.44 C
HETATM41858 C6 CLA B 602 33.042 22.766 0.383 1.00174.33 C
HETATM41859 C7 CLA B 602 32.907 22.480 1.867 1.00173.14 C
HETATM41860 C8 CLA B 602 33.589 23.538 2.727 1.00172.03 C
HETATM41861 C9 CLA B 602 34.669 22.911 3.585 1.00171.54 C
HETATM41862 C10 CLA B 602 32.576 24.264 3.607 1.00171.82 C
HETATM41863 C11 CLA B 602 32.975 25.701 3.867 1.00171.89 C
HETATM41864 C12 CLA B 602 31.758 26.580 4.072 1.00172.41 C
HETATM41865 C13 CLA B 602 32.117 27.931 4.677 1.00172.16 C
HETATM41866 C14 CLA B 602 31.199 28.245 5.840 1.00173.32 C
HETATM41867 C15 CLA B 602 32.053 29.041 3.632 1.00172.80 C
HETATM41868 C16 CLA B 602 32.142 30.421 4.254 1.00173.05 C
HETATM41869 C17 CLA B 602 33.553 30.749 4.689 1.00173.43 C
HETATM41870 C18 CLA B 602 33.882 32.235 4.588 1.00173.94 C
HETATM41871 C19 CLA B 602 33.270 32.870 3.357 1.00173.53 C
HETATM41872 C20 CLA B 602 33.439 32.970 5.835 1.00174.56 C
HETATM41873 MG CLA B 603 24.059 14.413 -4.723 1.00171.40 M
HETATM41874 CHA CLA B 603 27.260 14.708 -6.064 1.00173.93 C
HETATM41875 CHB CLA B 603 23.441 11.749 -6.750 1.00172.45 C
HETATM41876 CHC CLA B 603 20.918 14.174 -3.351 1.00173.49 C
HETATM41877 CHD CLA B 603 24.702 17.250 -2.697 1.00174.33 C
HETATM41878 NA CLA B 603 25.195 13.401 -6.156 1.00172.77 N
HETATM41879 C1A CLA B 603 26.511 13.672 -6.574 1.00173.68 C
HETATM41880 C2A CLA B 603 26.949 12.682 -7.655 1.00173.97 C
HETATM41881 C3A CLA B 603 25.714 11.771 -7.851 1.00173.33 C
HETATM41882 C4A CLA B 603 24.697 12.327 -6.851 1.00172.81 C
HETATM41883 CMA CLA B 603 25.194 11.823 -9.264 1.00173.51 C
HETATM41884 CAA CLA B 603 28.138 11.861 -7.197 1.00174.23 C
HETATM41885 CBA CLA B 603 27.879 11.204 -5.857 1.00173.85 C
HETATM41886 CGA CLA B 603 28.990 10.240 -5.596 1.00173.41 C
HETATM41887 O1A CLA B 603 29.712 9.688 -6.426 1.00173.18 O
HETATM41888 O2A CLA B 603 29.203 9.968 -4.274 1.00173.79 O
HETATM41889 NB CLA B 603 22.485 13.188 -4.994 1.00171.92 N
HETATM41890 C1B CLA B 603 22.414 12.164 -5.882 1.00172.04 C
HETATM41891 C2B CLA B 603 21.065 11.529 -5.813 1.00172.44 C
HETATM41892 C3B CLA B 603 20.353 12.211 -4.852 1.00172.87 C
HETATM41893 C4B CLA B 603 21.247 13.273 -4.316 1.00172.79 C
HETATM41894 CMB CLA B 603 20.670 10.396 -6.647 1.00173.15 C
HETATM41895 CAB CLA B 603 19.010 12.036 -4.366 1.00173.74 C
HETATM41896 CBB CLA B 603 17.918 11.917 -5.125 1.00173.61 C
HETATM41897 NC CLA B 603 23.018 15.508 -3.277 1.00173.44 N
HETATM41898 C1C CLA B 603 21.747 15.226 -2.860 1.00173.66 C
HETATM41899 C2C CLA B 603 21.332 16.175 -1.832 1.00174.05 C
HETATM41900 C3C CLA B 603 22.393 17.068 -1.658 1.00174.23 C
HETATM41901 C4C CLA B 603 23.447 16.635 -2.570 1.00174.13 C
HETATM41902 CMC CLA B 603 20.031 16.150 -1.164 1.00174.52 C
HETATM41903 CAC CLA B 603 22.471 18.210 -0.727 1.00174.45 C
HETATM41904 CBC CLA B 603 21.562 19.370 -1.064 1.00173.31 C
HETATM41905 ND CLA B 603 25.586 15.694 -4.387 1.00173.33 N
HETATM41906 C1D CLA B 603 25.709 16.827 -3.537 1.00173.96 C
HETATM41907 C2D CLA B 603 27.051 17.421 -3.720 1.00173.97 C
HETATM41908 C3D CLA B 603 27.696 16.637 -4.656 1.00174.15 C
HETATM41909 C4D CLA B 603 26.737 15.582 -5.053 1.00173.67 C
HETATM41910 CMD CLA B 603 27.540 18.598 -3.008 1.00173.38 C
HETATM41911 CAD CLA B 603 28.911 16.440 -5.423 1.00174.16 C
HETATM41912 OBD CLA B 603 29.955 17.083 -5.405 1.00173.91 O
HETATM41913 CBD CLA B 603 28.670 15.202 -6.345 1.00174.22 C
HETATM41914 CGD CLA B 603 28.970 15.521 -7.789 1.00174.26 C
HETATM41915 O1D CLA B 603 28.396 16.302 -8.551 1.00173.46 O
HETATM41916 O2D CLA B 603 30.052 14.853 -8.273 1.00175.04 O
HETATM41917 CED CLA B 603 31.333 15.266 -7.797 1.00174.59 C
HETATM41918 C1 CLA B 603 30.565 9.611 -3.960 1.00174.39 C
HETATM41919 C2 CLA B 603 30.620 8.989 -2.613 1.00174.55 C
HETATM41920 C3 CLA B 603 31.563 9.331 -1.718 1.00174.22 C
HETATM41921 C4 CLA B 603 32.595 10.353 -2.020 1.00174.38 C
HETATM41922 C5 CLA B 603 31.627 8.701 -0.370 1.00173.14 C
HETATM41923 C6 CLA B 603 33.038 8.258 -0.026 1.00172.95 C
HETATM41924 C7 CLA B 603 33.148 7.847 1.428 1.00173.02 C
HETATM41925 C8 CLA B 603 34.596 7.668 1.869 1.00172.27 C
HETATM41926 C9 CLA B 603 35.359 6.804 0.884 1.00171.82 C
HETATM41927 C10 CLA B 603 34.658 7.056 3.263 1.00173.03 C
HETATM41928 C11 CLA B 603 36.022 7.223 3.895 1.00173.61 C
HETATM41929 C12 CLA B 603 36.475 5.954 4.589 1.00174.06 C
HETATM41930 C13 CLA B 603 37.759 6.174 5.379 1.00173.98 C
HETATM41931 C14 CLA B 603 37.477 6.932 6.660 1.00173.91 C
HETATM41932 C15 CLA B 603 38.806 6.908 4.549 1.00175.19 C
HETATM41933 C16 CLA B 603 40.164 6.891 5.223 1.00174.63 C
HETATM41934 C17 CLA B 603 41.223 6.288 4.323 1.00174.55 C
HETATM41935 C18 CLA B 603 41.384 4.791 4.561 1.00175.01 C
HETATM41936 C19 CLA B 603 42.482 4.220 3.688 1.00175.17 C
HETATM41937 C20 CLA B 603 41.686 4.517 6.019 1.00175.32 C
HETATM41938 MG CLA B 604 30.776 5.538 -4.466 1.00174.01 M
HETATM41939 CHA CLA B 604 29.535 6.911 -7.405 1.00173.77 C
HETATM41940 CHB CLA B 604 33.745 4.917 -6.007 1.00175.21 C
HETATM41941 CHC CLA B 604 31.951 4.179 -1.534 1.00174.67 C
HETATM41942 CHD CLA B 604 27.625 6.081 -2.946 1.00174.36 C
HETATM41943 NA CLA B 604 31.502 5.895 -6.391 1.00175.16 N
HETATM41944 C1A CLA B 604 30.829 6.474 -7.478 1.00174.39 C
HETATM41945 C2A CLA B 604 31.728 6.542 -8.710 1.00174.21 C
HETATM41946 C3A CLA B 604 33.007 5.797 -8.262 1.00174.76 C
HETATM41947 C4A CLA B 604 32.764 5.520 -6.776 1.00175.67 C
HETATM41948 CMA CLA B 604 33.197 4.518 -9.035 1.00174.17 C
HETATM41949 CAA CLA B 604 32.046 7.994 -9.025 1.00173.53 C
HETATM41950 CBA CLA B 604 32.634 8.685 -7.809 1.00173.25 C
HETATM41951 CGA CLA B 604 32.540 10.173 -7.935 1.00173.07 C
HETATM41952 O1A CLA B 604 32.234 10.839 -8.925 1.00172.93 O
HETATM41953 O2A CLA B 604 32.857 10.822 -6.771 1.00173.88 O
HETATM41954 NB CLA B 604 32.495 4.651 -3.900 1.00173.88 N
HETATM41955 C1B CLA B 604 33.631 4.590 -4.642 1.00174.34 C
HETATM41956 C2B CLA B 604 34.765 4.101 -3.806 1.00173.86 C
HETATM41957 C3B CLA B 604 34.262 3.892 -2.541 1.00173.58 C
HETATM41958 C4B CLA B 604 32.815 4.243 -2.583 1.00173.79 C
HETATM41959 CMB CLA B 604 36.122 3.929 -4.319 1.00174.12 C
HETATM41960 CAB CLA B 604 34.908 3.432 -1.342 1.00174.11 C
HETATM41961 CBB CLA B 604 35.629 2.310 -1.245 1.00174.60 C
HETATM41962 NC CLA B 604 29.941 5.211 -2.584 1.00174.41 N
HETATM41963 C1C CLA B 604 30.600 4.635 -1.531 1.00174.98 C
HETATM41964 C2C CLA B 604 29.711 4.539 -0.379 1.00175.27 C
HETATM41965 C3C CLA B 604 28.489 5.079 -0.779 1.00174.12 C
HETATM41966 C4C CLA B 604 28.638 5.494 -2.166 1.00174.09 C
HETATM41967 CMC CLA B 604 30.075 3.978 0.925 1.00175.61 C
HETATM41968 CAC CLA B 604 27.268 5.202 0.022 1.00173.50 C
HETATM41969 CBC CLA B 604 27.236 6.516 0.756 1.00173.50 C
HETATM41970 ND CLA B 604 29.015 6.414 -4.944 1.00173.55 N
HETATM41971 C1D CLA B 604 27.780 6.517 -4.246 1.00173.95 C
HETATM41972 C2D CLA B 604 26.773 7.143 -5.136 1.00173.14 C
HETATM41973 C3D CLA B 604 27.403 7.343 -6.348 1.00172.86 C
HETATM41974 C4D CLA B 604 28.780 6.834 -6.189 1.00173.27 C
HETATM41975 CMD CLA B 604 25.401 7.464 -4.754 1.00173.37 C
HETATM41976 CAD CLA B 604 27.271 7.836 -7.707 1.00173.27 C
HETATM41977 OBD CLA B 604 26.327 8.412 -8.236 1.00173.58 O
HETATM41978 CBD CLA B 604 28.600 7.489 -8.447 1.00173.84 C
HETATM41979 CGD CLA B 604 28.367 6.527 -9.584 1.00173.69 C
HETATM41980 O1D CLA B 604 28.736 6.642 -10.754 1.00173.75 O
HETATM41981 O2D CLA B 604 27.661 5.410 -9.245 1.00173.19 O
HETATM41982 CED CLA B 604 28.281 4.137 -9.445 1.00173.47 C
HETATM41983 C1 CLA B 604 31.978 11.883 -6.340 1.00174.22 C
HETATM41984 C2 CLA B 604 32.777 12.820 -5.508 1.00174.37 C
HETATM41985 C3 CLA B 604 32.278 13.511 -4.466 1.00173.86 C
HETATM41986 C4 CLA B 604 30.864 13.391 -4.038 1.00172.24 C
HETATM41987 C5 CLA B 604 33.145 14.439 -3.682 1.00174.84 C
HETATM41988 C6 CLA B 604 32.778 14.524 -2.212 1.00174.23 C
HETATM41989 C7 CLA B 604 33.634 15.556 -1.506 1.00174.54 C
HETATM41990 C8 CLA B 604 32.848 16.326 -0.451 1.00173.56 C
HETATM41991 C9 CLA B 604 31.992 17.397 -1.096 1.00174.00 C
HETATM41992 C10 CLA B 604 33.783 16.950 0.577 1.00173.30 C
HETATM41993 C11 CLA B 604 33.258 16.749 1.979 1.00172.77 C
HETATM41994 C12 CLA B 604 33.641 17.896 2.890 1.00172.63 C
HETATM41995 C13 CLA B 604 35.016 17.672 3.500 1.00173.38 C
HETATM41996 C14 CLA B 604 34.906 16.864 4.776 1.00173.80 C
HETATM41997 C15 CLA B 604 35.716 18.998 3.769 1.00173.96 C
HETATM41998 C16 CLA B 604 37.085 18.787 4.380 1.00175.06 C
HETATM41999 C17 CLA B 604 38.073 18.229 3.377 1.00174.58 C
HETATM42000 C18 CLA B 604 39.464 18.812 3.580 1.00175.06 C
HETATM42001 C19 CLA B 604 40.453 18.217 2.600 1.00174.78 C
HETATM42002 C20 CLA B 604 39.433 20.319 3.436 1.00174.07 C
HETATM42003 MG CLA B 605 40.520 5.080 -7.126 1.00175.21 M
HETATM42004 CHA CLA B 605 40.260 2.844 -9.772 1.00174.36 C
HETATM42005 CHB CLA B 605 37.230 5.883 -7.482 1.00173.34 C
HETATM42006 CHC CLA B 605 40.823 7.247 -4.475 1.00173.55 C
HETATM42007 CHD CLA B 605 43.958 4.276 -6.850 1.00173.95 C
HETATM42008 NA CLA B 605 39.014 4.447 -8.426 1.00173.98 N
HETATM42009 C1A CLA B 605 39.101 3.500 -9.457 1.00173.73 C
HETATM42010 C2A CLA B 605 37.761 3.347 -10.175 1.00173.13 C
HETATM42011 C3A CLA B 605 36.855 4.389 -9.477 1.00172.64 C
HETATM42012 C4A CLA B 605 37.743 4.955 -8.371 1.00173.28 C
HETATM42013 CMA CLA B 605 36.424 5.467 -10.434 1.00172.75 C
HETATM42014 CAA CLA B 605 37.205 1.943 -10.023 1.00173.56 C
HETATM42015 CBA CLA B 605 36.013 1.913 -9.089 1.00174.14 C
HETATM42016 CGA CLA B 605 36.426 1.380 -7.753 1.00175.16 C
HETATM42017 O1A CLA B 605 37.469 0.797 -7.444 1.00175.42 O
HETATM42018 O2A CLA B 605 35.471 1.596 -6.798 1.00175.30 O
HETATM42019 NB CLA B 605 39.269 6.334 -6.170 1.00173.97 N
HETATM42020 C1B CLA B 605 37.947 6.494 -6.437 1.00173.60 C
HETATM42021 C2B CLA B 605 37.345 7.446 -5.460 1.00173.68 C
HETATM42022 C3B CLA B 605 38.356 7.835 -4.610 1.00173.92 C
HETATM42023 C4B CLA B 605 39.594 7.131 -5.048 1.00173.71 C
HETATM42024 CMB CLA B 605 35.934 7.830 -5.481 1.00174.04 C
HETATM42025 CAB CLA B 605 38.340 8.736 -3.488 1.00174.93 C
HETATM42026 CBB CLA B 605 37.710 8.507 -2.335 1.00175.81 C
HETATM42027 NC CLA B 605 42.104 5.650 -5.893 1.00173.92 N
HETATM42028 C1C CLA B 605 42.006 6.557 -4.870 1.00173.53 C
HETATM42029 C2C CLA B 605 43.304 6.723 -4.226 1.00173.13 C
HETATM42030 C3C CLA B 605 44.189 5.884 -4.900 1.00173.14 C
HETATM42031 C4C CLA B 605 43.430 5.211 -5.945 1.00173.74 C
HETATM42032 CMC CLA B 605 43.576 7.612 -3.095 1.00173.07 C
HETATM42033 CAC CLA B 605 45.619 5.699 -4.634 1.00173.36 C
HETATM42034 CBC CLA B 605 45.867 4.522 -3.726 1.00175.00 C
HETATM42035 ND CLA B 605 41.850 3.857 -8.034 1.00174.89 N
HETATM42036 C1D CLA B 605 43.237 3.627 -7.828 1.00174.39 C
HETATM42037 C2D CLA B 605 43.715 2.637 -8.819 1.00174.60 C
HETATM42038 C3D CLA B 605 42.611 2.295 -9.582 1.00175.30 C
HETATM42039 C4D CLA B 605 41.479 3.086 -9.058 1.00174.90 C
HETATM42040 CMD CLA B 605 45.091 2.153 -8.919 1.00173.90 C
HETATM42041 CAD CLA B 605 42.117 1.509 -10.699 1.00175.65 C
HETATM42042 OBD CLA B 605 42.727 0.746 -11.438 1.00176.14 O
HETATM42043 CBD CLA B 605 40.591 1.817 -10.837 1.00174.69 C
HETATM42044 CGD CLA B 605 40.197 2.239 -12.232 1.00174.60 C
HETATM42045 O1D CLA B 605 40.522 3.252 -12.854 1.00174.73 O
HETATM42046 O2D CLA B 605 39.371 1.354 -12.853 1.00174.31 O
HETATM42047 CED CLA B 605 39.527 1.161 -14.260 1.00174.28 C
HETATM42048 C1 CLA B 605 35.403 0.662 -5.698 1.00175.17 C
HETATM42049 C2 CLA B 605 34.010 0.724 -5.185 1.00174.09 C
HETATM42050 C3 CLA B 605 33.600 0.145 -4.042 1.00174.10 C
HETATM42051 C4 CLA B 605 32.192 0.247 -3.592 1.00173.70 C
HETATM42052 C5 CLA B 605 34.531 -0.623 -3.166 1.00174.55 C
HETATM42053 C6 CLA B 605 33.943 -1.941 -2.692 1.00174.39 C
HETATM42054 C7 CLA B 605 34.676 -2.456 -1.468 1.00173.53 C
HETATM42055 C8 CLA B 605 34.410 -3.935 -1.211 1.00173.18 C
HETATM42056 C9 CLA B 605 33.128 -4.104 -0.423 1.00173.47 C
HETATM42057 C10 CLA B 605 35.584 -4.579 -0.477 1.00173.84 C
HETATM42058 C11 CLA B 605 35.281 -5.986 -0.007 1.00174.73 C
HETATM42059 C12 CLA B 605 36.487 -6.634 0.645 1.00174.11 C
HETATM42060 C13 CLA B 605 36.099 -7.842 1.490 1.00173.73 C
HETATM42061 C14 CLA B 605 35.742 -9.024 0.609 1.00173.55 C
HETATM42062 C15 CLA B 605 34.945 -7.519 2.435 1.00173.64 C
HETATM42063 C16 CLA B 605 35.294 -7.799 3.883 1.00174.32 C
HETATM42064 C17 CLA B 605 35.112 -9.260 4.240 1.00175.23 C
HETATM42065 C18 CLA B 605 34.788 -9.450 5.716 1.00175.07 C
HETATM42066 C19 CLA B 605 33.302 -9.300 5.977 1.00175.17 C
HETATM42067 C20 CLA B 605 35.262 -10.806 6.194 1.00174.00 C
HETATM42068 MG CLA B 606 16.739 9.200 -12.372 1.00174.09 M
HETATM42069 CHA CLA B 606 15.719 8.416 -15.595 1.00173.58 C
HETATM42070 CHB CLA B 606 18.110 12.099 -13.511 1.00174.40 C
HETATM42071 CHC CLA B 606 17.605 9.990 -9.141 1.00174.11 C
HETATM42072 CHD CLA B 606 15.303 6.169 -11.238 1.00174.06 C
HETATM42073 NA CLA B 606 16.886 10.083 -14.258 1.00174.54 N
HETATM42074 C1A CLA B 606 16.392 9.603 -15.478 1.00173.94 C
HETATM42075 C2A CLA B 606 16.705 10.569 -16.616 1.00173.78 C
HETATM42076 C3A CLA B 606 17.592 11.643 -15.945 1.00173.97 C
HETATM42077 C4A CLA B 606 17.529 11.277 -14.460 1.00174.57 C
HETATM42078 CMA CLA B 606 19.002 11.628 -16.479 1.00174.42 C
HETATM42079 CAA CLA B 606 15.410 11.186 -17.124 1.00173.79 C
HETATM42080 CBA CLA B 606 14.947 12.341 -16.254 1.00173.35 C
HETATM42081 CGA CLA B 606 13.535 12.149 -15.789 1.00174.23 C
HETATM42082 O1A CLA B 606 12.700 11.337 -16.190 1.00174.80 O
HETATM42083 O2A CLA B 606 13.173 13.017 -14.793 1.00174.42 O
HETATM42084 NB CLA B 606 17.767 10.701 -11.508 1.00173.81 N
HETATM42085 C1B CLA B 606 18.117 11.861 -12.125 1.00173.71 C
HETATM42086 C2B CLA B 606 18.523 12.878 -11.113 1.00172.76 C
HETATM42087 C3B CLA B 606 18.383 12.286 -9.881 1.00173.47 C
HETATM42088 C4B CLA B 606 17.897 10.898 -10.113 1.00173.84 C
HETATM42089 CMB CLA B 606 18.947 14.234 -11.458 1.00172.56 C
HETATM42090 CAB CLA B 606 18.608 12.819 -8.565 1.00174.58 C
HETATM42091 CBB CLA B 606 17.824 13.720 -7.969 1.00174.75 C
HETATM42092 NC CLA B 606 16.507 8.239 -10.533 1.00173.86 N
HETATM42093 C1C CLA B 606 16.945 8.742 -9.337 1.00173.91 C
HETATM42094 C2C CLA B 606 16.625 7.818 -8.258 1.00173.94 C
HETATM42095 C3C CLA B 606 15.962 6.739 -8.845 1.00173.84 C
HETATM42096 C4C CLA B 606 15.897 7.009 -10.278 1.00173.93 C
HETATM42097 CMC CLA B 606 16.938 8.042 -6.845 1.00174.03 C
HETATM42098 CAC CLA B 606 15.430 5.550 -8.163 1.00173.91 C
HETATM42099 CBC CLA B 606 13.928 5.601 -7.999 1.00173.68 C
HETATM42100 ND CLA B 606 15.672 7.666 -13.149 1.00173.88 N
HETATM42101 C1D CLA B 606 15.188 6.455 -12.583 1.00174.01 C
HETATM42102 C2D CLA B 606 14.568 5.635 -13.652 1.00174.11 C
HETATM42103 C3D CLA B 606 14.726 6.351 -14.825 1.00173.86 C
HETATM42104 C4D CLA B 606 15.443 7.589 -14.460 1.00173.71 C
HETATM42105 CMD CLA B 606 13.920 4.341 -13.444 1.00174.13 C
HETATM42106 CAD CLA B 606 14.477 6.395 -16.255 1.00173.75 C
HETATM42107 OBD CLA B 606 13.846 5.614 -16.961 1.00173.96 O
HETATM42108 CBD CLA B 606 15.179 7.678 -16.797 1.00173.57 C
HETATM42109 CGD CLA B 606 16.303 7.315 -17.728 1.00174.34 C
HETATM42110 O1D CLA B 606 17.244 6.548 -17.502 1.00175.60 O
HETATM42111 O2D CLA B 606 16.245 7.913 -18.948 1.00173.77 O
HETATM42112 CED CLA B 606 16.605 7.109 -20.072 1.00173.54 C
HETATM42113 C1 CLA B 606 11.787 12.996 -14.390 1.00174.18 C
HETATM42114 C2 CLA B 606 11.612 14.000 -13.309 1.00173.33 C
HETATM42115 C3 CLA B 606 10.417 14.250 -12.743 1.00172.43 C
HETATM42116 C4 CLA B 606 9.189 13.536 -13.162 1.00172.60 C
HETATM42117 C5 CLA B 606 10.268 15.264 -11.659 1.00172.40 C
HETATM42118 C6 CLA B 606 9.379 14.784 -10.525 1.00172.66 C
HETATM42119 C7 CLA B 606 9.191 15.870 -9.481 1.00173.46 C
HETATM42120 C8 CLA B 606 8.156 15.493 -8.425 1.00173.65 C
HETATM42121 C9 CLA B 606 6.854 15.080 -9.079 1.00172.82 C
HETATM42122 C10 CLA B 606 7.912 16.646 -7.457 1.00173.67 C
HETATM42123 C11 CLA B 606 7.186 16.201 -6.203 1.00173.91 C
HETATM42124 C12 CLA B 606 6.734 17.382 -5.364 1.00174.06 C
HETATM42125 C13 CLA B 606 6.170 16.958 -4.011 1.00174.59 C
HETATM42126 C14 CLA B 606 5.182 15.818 -4.159 1.00174.24 C
HETATM42127 C15 CLA B 606 5.515 18.132 -3.286 1.00174.57 C
HETATM42128 C16 CLA B 606 5.035 17.739 -1.902 1.00174.69 C
HETATM42129 C17 CLA B 606 5.585 18.654 -0.828 1.00174.53 C
HETATM42130 C18 CLA B 606 4.482 19.422 -0.110 1.00174.52 C
HETATM42131 C19 CLA B 606 3.672 18.501 0.777 1.00174.84 C
HETATM42132 C20 CLA B 606 5.068 20.537 0.729 1.00173.44 C
HETATM42133 MG CLA B 607 24.299 30.483 9.258 1.00173.95 M
HETATM42134 CHA CLA B 607 25.352 28.991 12.212 1.00174.04 C
HETATM42135 CHB CLA B 607 21.679 31.896 10.907 1.00174.42 C
HETATM42136 CHC CLA B 607 23.275 31.888 6.295 1.00173.51 C
HETATM42137 CHD CLA B 607 26.953 28.865 7.560 1.00174.34 C
HETATM42138 NA CLA B 607 23.666 30.462 11.251 1.00173.40 N
HETATM42139 C1A CLA B 607 24.238 29.780 12.335 1.00173.50 C
HETATM42140 C2A CLA B 607 23.447 30.037 13.618 1.00173.46 C
HETATM42141 C3A CLA B 607 22.234 30.867 13.142 1.00173.64 C
HETATM42142 C4A CLA B 607 22.539 31.122 11.666 1.00173.90 C
HETATM42143 CMA CLA B 607 20.950 30.097 13.318 1.00173.71 C
HETATM42144 CAA CLA B 607 24.234 30.849 14.641 1.00174.29 C
HETATM42145 CBA CLA B 607 25.458 31.579 14.107 1.00174.50 C
HETATM42146 CGA CLA B 607 25.111 32.739 13.221 1.00174.60 C
HETATM42147 O1A CLA B 607 24.286 33.633 13.414 1.00175.95 O
HETATM42148 O2A CLA B 607 25.848 32.769 12.066 1.00173.52 O
HETATM42149 NB CLA B 607 22.751 31.642 8.701 1.00174.84 N
HETATM42150 C1B CLA B 607 21.823 32.176 9.536 1.00174.78 C
HETATM42151 C2B CLA B 607 20.933 33.102 8.781 1.00174.63 C
HETATM42152 C3B CLA B 607 21.377 33.105 7.476 1.00174.64 C
HETATM42153 C4B CLA B 607 22.542 32.177 7.408 1.00174.51 C
HETATM42154 CMB CLA B 607 19.833 33.826 9.414 1.00173.91 C
HETATM42155 CAB CLA B 607 20.895 33.813 6.318 1.00174.27 C
HETATM42156 CBB CLA B 607 19.613 33.957 5.974 1.00173.79 C
HETATM42157 NC CLA B 607 25.008 30.405 7.295 1.00173.51 N
HETATM42158 C1C CLA B 607 24.435 31.058 6.239 1.00173.07 C
HETATM42159 C2C CLA B 607 25.178 30.769 5.016 1.00173.24 C
HETATM42160 C3C CLA B 607 26.220 29.910 5.367 1.00173.49 C
HETATM42161 C4C CLA B 607 26.103 29.686 6.804 1.00173.83 C
HETATM42162 CMC CLA B 607 24.841 31.301 3.695 1.00173.86 C
HETATM42163 CAC CLA B 607 27.246 29.330 4.480 1.00173.41 C
HETATM42164 CBC CLA B 607 26.771 28.098 3.742 1.00173.55 C
HETATM42165 ND CLA B 607 25.875 29.306 9.726 1.00173.93 N
HETATM42166 C1D CLA B 607 26.860 28.671 8.923 1.00174.28 C
HETATM42167 C2D CLA B 607 27.708 27.817 9.785 1.00174.14 C
HETATM42168 C3D CLA B 607 27.189 27.920 11.061 1.00174.44 C
HETATM42169 C4D CLA B 607 26.031 28.833 10.962 1.00174.09 C
HETATM42170 CMD CLA B 607 28.849 27.044 9.309 1.00173.55 C
HETATM42171 CAD CLA B 607 27.299 27.499 12.447 1.00174.92 C
HETATM42172 OBD CLA B 607 28.145 26.786 12.977 1.00175.27 O
HETATM42173 CBD CLA B 607 26.090 28.128 13.214 1.00174.65 C
HETATM42174 CGD CLA B 607 25.201 27.089 13.851 1.00174.26 C
HETATM42175 O1D CLA B 607 24.289 26.438 13.330 1.00173.30 O
HETATM42176 O2D CLA B 607 25.474 26.870 15.169 1.00174.45 O
HETATM42177 CED CLA B 607 24.396 26.504 16.033 1.00174.58 C
HETATM42178 C1 CLA B 607 25.369 33.634 11.012 1.00173.82 C
HETATM42179 C2 CLA B 607 26.553 34.238 10.347 1.00173.97 C
HETATM42180 C3 CLA B 607 26.489 34.841 9.145 1.00174.29 C
HETATM42181 C4 CLA B 607 25.222 34.946 8.383 1.00174.15 C
HETATM42182 C5 CLA B 607 27.703 35.435 8.516 1.00174.05 C
HETATM42183 C6 CLA B 607 27.452 36.803 7.905 1.00174.10 C
HETATM42184 C7 CLA B 607 27.742 36.809 6.415 1.00174.37 C
HETATM42185 C8 CLA B 607 29.075 37.455 6.031 1.00175.30 C
HETATM42186 C9 CLA B 607 29.667 38.259 7.173 1.00175.66 C
HETATM42187 C10 CLA B 607 28.904 38.341 4.800 1.00173.96 C
HETATM42188 C11 CLA B 607 30.208 38.586 4.069 1.00173.15 C
HETATM42189 C12 CLA B 607 29.970 39.031 2.640 1.00172.61 C
HETATM42190 C13 CLA B 607 31.201 39.689 2.028 1.00172.68 C
HETATM42191 C14 CLA B 607 31.124 41.197 2.153 1.00172.46 C
HETATM42192 C15 CLA B 607 31.386 39.295 0.565 1.00173.26 C
HETATM42193 C16 CLA B 607 30.256 39.826 -0.295 1.00174.19 C
HETATM42194 C17 CLA B 607 30.706 40.131 -1.710 1.00174.31 C
HETATM42195 C18 CLA B 607 30.125 39.154 -2.725 1.00174.40 C
HETATM42196 C19 CLA B 607 28.638 39.381 -2.909 1.00174.23 C
HETATM42197 C20 CLA B 607 30.833 39.286 -4.059 1.00173.83 C
HETATM42198 MG CLA B 608 39.123 25.272 12.140 1.00173.88 M
HETATM42199 CHA CLA B 608 38.246 26.216 15.365 1.00174.45 C
HETATM42200 CHB CLA B 608 36.085 23.783 11.754 1.00174.02 C
HETATM42201 CHC CLA B 608 40.050 24.352 8.967 1.00174.17 C
HETATM42202 CHD CLA B 608 42.313 26.738 12.636 1.00174.65 C
HETATM42203 NA CLA B 608 37.447 25.066 13.373 1.00174.05 N
HETATM42204 C1A CLA B 608 37.276 25.522 14.690 1.00174.51 C
HETATM42205 C2A CLA B 608 35.898 25.135 15.234 1.00174.77 C
HETATM42206 C3A CLA B 608 35.296 24.271 14.102 1.00174.44 C
HETATM42207 C4A CLA B 608 36.329 24.378 12.978 1.00174.03 C
HETATM42208 CMA CLA B 608 35.125 22.840 14.542 1.00173.84 C
HETATM42209 CAA CLA B 608 35.039 26.359 15.498 1.00173.96 C
HETATM42210 CBA CLA B 608 34.876 27.191 14.243 1.00173.57 C
HETATM42211 CGA CLA B 608 34.115 28.442 14.549 1.00173.25 C
HETATM42212 O1A CLA B 608 33.957 28.999 15.639 1.00172.38 O
HETATM42213 O2A CLA B 608 33.547 28.994 13.433 1.00174.01 O
HETATM42214 NB CLA B 608 38.262 24.193 10.672 1.00174.32 N
HETATM42215 C1B CLA B 608 36.962 23.793 10.654 1.00174.13 C
HETATM42216 C2B CLA B 608 36.585 23.339 9.284 1.00173.96 C
HETATM42217 C3B CLA B 608 37.701 23.497 8.495 1.00173.84 C
HETATM42218 C4B CLA B 608 38.781 24.044 9.365 1.00174.22 C
HETATM42219 CMB CLA B 608 35.254 22.847 8.935 1.00173.35 C
HETATM42220 CAB CLA B 608 37.896 23.222 7.096 1.00173.04 C
HETATM42221 CBB CLA B 608 38.126 22.010 6.583 1.00173.33 C
HETATM42222 NC CLA B 608 40.870 25.509 11.015 1.00174.75 N
HETATM42223 C1C CLA B 608 41.035 25.041 9.738 1.00174.35 C
HETATM42224 C2C CLA B 608 42.383 25.354 9.266 1.00173.99 C
HETATM42225 C3C CLA B 608 43.024 26.039 10.299 1.00174.08 C
HETATM42226 C4C CLA B 608 42.065 26.126 11.396 1.00174.70 C
HETATM42227 CMC CLA B 608 42.911 25.005 7.947 1.00173.89 C
HETATM42228 CAC CLA B 608 44.405 26.557 10.309 1.00173.64 C
HETATM42229 CBC CLA B 608 45.437 25.504 10.655 1.00174.36 C
HETATM42230 ND CLA B 608 40.068 26.353 13.565 1.00173.98 N
HETATM42231 C1D CLA B 608 41.394 26.860 13.658 1.00174.25 C
HETATM42232 C2D CLA B 608 41.583 27.488 14.984 1.00174.02 C
HETATM42233 C3D CLA B 608 40.400 27.284 15.673 1.00174.26 C
HETATM42234 C4D CLA B 608 39.504 26.543 14.759 1.00174.02 C
HETATM42235 CMD CLA B 608 42.802 28.172 15.413 1.00173.49 C
HETATM42236 CAD CLA B 608 39.675 27.496 16.912 1.00174.79 C
HETATM42237 OBD CLA B 608 40.014 28.116 17.914 1.00175.02 O
HETATM42238 CBD CLA B 608 38.309 26.751 16.781 1.00175.00 C
HETATM42239 CGD CLA B 608 38.178 25.655 17.808 1.00175.52 C
HETATM42240 O1D CLA B 608 37.193 25.389 18.502 1.00176.00 O
HETATM42241 O2D CLA B 608 39.297 24.891 17.967 1.00175.32 O
HETATM42242 CED CLA B 608 39.138 23.476 18.104 1.00174.82 C
HETATM42243 C1 CLA B 608 33.048 30.342 13.546 1.00173.75 C
HETATM42244 C2 CLA B 608 32.198 30.604 12.355 1.00173.35 C
HETATM42245 C3 CLA B 608 30.870 30.395 12.366 1.00173.71 C
HETATM42246 C4 CLA B 608 30.180 29.887 13.573 1.00174.53 C
HETATM42247 C5 CLA B 608 30.004 30.656 11.180 1.00173.94 C
HETATM42248 C6 CLA B 608 30.705 31.278 9.986 1.00174.80 C
HETATM42249 C7 CLA B 608 29.798 31.191 8.771 1.00174.94 C
HETATM42250 C8 CLA B 608 30.152 32.164 7.650 1.00173.40 C
HETATM42251 C9 CLA B 608 30.693 33.467 8.204 1.00173.16 C
HETATM42252 C10 CLA B 608 28.931 32.426 6.774 1.00172.72 C
HETATM42253 C11 CLA B 608 29.281 33.171 5.504 1.00173.71 C
HETATM42254 C12 CLA B 608 28.109 33.218 4.542 1.00174.41 C
HETATM42255 C13 CLA B 608 28.357 34.180 3.385 1.00174.72 C
HETATM42256 C14 CLA B 608 27.068 34.842 2.946 1.00173.97 C
HETATM42257 C15 CLA B 608 29.012 33.480 2.199 1.00173.95 C
HETATM42258 C16 CLA B 608 30.241 34.234 1.733 1.00173.02 C
HETATM42259 C17 CLA B 608 30.104 34.704 0.301 1.00172.43 C
HETATM42260 C18 CLA B 608 31.457 34.957 -0.351 1.00173.46 C
HETATM42261 C19 CLA B 608 31.299 35.725 -1.647 1.00174.22 C
HETATM42262 C20 CLA B 608 32.377 35.712 0.586 1.00173.97 C
HETATM42263 MG CLA B 609 31.848 20.368 11.575 1.00175.21 M
HETATM42264 CHA CLA B 609 31.987 17.254 10.030 1.00174.24 C
HETATM42265 CHB CLA B 609 31.790 21.876 8.525 1.00173.04 C
HETATM42266 CHC CLA B 609 31.637 23.423 13.150 1.00174.39 C
HETATM42267 CHD CLA B 609 31.963 18.761 14.724 1.00174.24 C
HETATM42268 NA CLA B 609 31.887 19.654 9.611 1.00174.21 N
HETATM42269 C1A CLA B 609 31.941 18.323 9.171 1.00174.40 C
HETATM42270 C2A CLA B 609 31.955 18.253 7.644 1.00174.28 C
HETATM42271 C3A CLA B 609 31.966 19.736 7.206 1.00173.84 C
HETATM42272 C4A CLA B 609 31.868 20.495 8.529 1.00173.58 C
HETATM42273 CMA CLA B 609 33.217 20.093 6.442 1.00173.77 C
HETATM42274 CAA CLA B 609 30.709 17.566 7.116 1.00174.62 C
HETATM42275 CBA CLA B 609 30.771 17.404 5.612 1.00174.41 C
HETATM42276 CGA CLA B 609 30.473 15.982 5.248 1.00175.26 C
HETATM42277 O1A CLA B 609 29.421 15.357 5.398 1.00175.87 O
HETATM42278 O2A CLA B 609 31.541 15.340 4.683 1.00175.12 O
HETATM42279 NB CLA B 609 31.734 22.280 10.957 1.00174.01 N
HETATM42280 C1B CLA B 609 31.707 22.693 9.666 1.00173.03 C
HETATM42281 C2B CLA B 609 31.583 24.176 9.610 1.00172.78 C
HETATM42282 C3B CLA B 609 31.538 24.621 10.911 1.00173.18 C
HETATM42283 C4B CLA B 609 31.635 23.421 11.789 1.00174.06 C
HETATM42284 CMB CLA B 609 31.538 24.919 8.354 1.00174.06 C
HETATM42285 CAB CLA B 609 31.428 25.955 11.435 1.00173.38 C
HETATM42286 CBB CLA B 609 32.461 26.764 11.666 1.00173.54 C
HETATM42287 NC CLA B 609 31.814 20.971 13.576 1.00174.18 N
HETATM42288 C1C CLA B 609 31.725 22.275 13.991 1.00174.24 C
HETATM42289 C2C CLA B 609 31.727 22.337 15.448 1.00174.46 C
HETATM42290 C3C CLA B 609 31.820 21.019 15.903 1.00175.15 C
HETATM42291 C4C CLA B 609 31.877 20.166 14.717 1.00174.18 C
HETATM42292 CMC CLA B 609 31.644 23.573 16.230 1.00174.28 C
HETATM42293 CAC CLA B 609 31.867 20.570 17.305 1.00175.89 C
HETATM42294 CBC CLA B 609 30.507 20.510 17.961 1.00175.94 C
HETATM42295 ND CLA B 609 31.958 18.478 12.283 1.00173.95 N
HETATM42296 C1D CLA B 609 32.001 17.954 13.603 1.00174.08 C
HETATM42297 C2D CLA B 609 32.073 16.475 13.531 1.00174.48 C
HETATM42298 C3D CLA B 609 32.059 16.151 12.185 1.00173.61 C
HETATM42299 C4D CLA B 609 31.993 17.433 11.453 1.00173.85 C
HETATM42300 CMD CLA B 609 32.129 15.587 14.690 1.00175.71 C
HETATM42301 CAD CLA B 609 32.092 15.083 11.201 1.00172.93 C
HETATM42302 OBD CLA B 609 32.141 13.869 11.367 1.00172.38 O
HETATM42303 CBD CLA B 609 32.056 15.758 9.795 1.00173.80 C
HETATM42304 CGD CLA B 609 33.253 15.370 8.973 1.00174.15 C
HETATM42305 O1D CLA B 609 33.269 14.891 7.834 1.00174.47 O
HETATM42306 O2D CLA B 609 34.444 15.587 9.599 1.00173.90 O
HETATM42307 CED CLA B 609 35.396 16.424 8.941 1.00174.44 C
HETATM42308 C1 CLA B 609 31.572 13.905 4.819 1.00174.19 C
HETATM42309 C2 CLA B 609 31.802 13.348 3.461 1.00174.23 C
HETATM42310 C3 CLA B 609 33.026 13.104 2.964 1.00174.18 C
HETATM42311 C4 CLA B 609 33.222 12.549 1.604 1.00173.60 C
HETATM42312 C5 CLA B 609 34.253 13.375 3.762 1.00174.24 C
HETATM42313 C6 CLA B 609 35.202 12.191 3.775 1.00174.13 C
HETATM42314 C7 CLA B 609 34.733 11.136 4.755 1.00172.78 C
HETATM42315 C8 CLA B 609 35.226 11.422 6.167 1.00173.19 C
HETATM42316 C9 CLA B 609 36.655 10.950 6.336 1.00173.36 C
HETATM42317 C10 CLA B 609 34.328 10.751 7.198 1.00173.95 C
HETATM42318 C11 CLA B 609 32.914 11.287 7.154 1.00173.77 C
HETATM42319 C12 CLA B 609 32.482 11.815 8.506 1.00174.10 C
HETATM42320 C13 CLA B 609 31.007 11.544 8.776 1.00174.40 C
HETATM42321 C14 CLA B 609 30.172 12.759 8.423 1.00173.98 C
HETATM42322 C15 CLA B 609 30.794 11.102 10.225 1.00173.95 C
HETATM42323 C16 CLA B 609 29.550 11.692 10.857 1.00173.18 C
HETATM42324 C17 CLA B 609 29.713 11.845 12.354 1.00172.95 C
HETATM42325 C18 CLA B 609 28.477 12.457 12.998 1.00173.19 C
HETATM42326 C19 CLA B 609 27.555 11.379 13.531 1.00173.96 C
HETATM42327 C20 CLA B 609 28.872 13.403 14.112 1.00173.54 C
HETATM42328 MG CLA B 610 15.740 17.126 9.848 1.00174.53 M
HETATM42329 CHA CLA B 610 13.559 16.922 12.554 1.00173.80 C
HETATM42330 CHB CLA B 610 17.732 14.809 11.298 1.00174.67 C
HETATM42331 CHC CLA B 610 17.869 17.328 7.124 1.00174.63 C
HETATM42332 CHD CLA B 610 13.706 19.627 8.425 1.00174.70 C
HETATM42333 NA CLA B 610 15.627 16.044 11.637 1.00173.88 N
HETATM42334 C1A CLA B 610 14.641 16.089 12.636 1.00173.64 C
HETATM42335 C2A CLA B 610 14.962 15.132 13.785 1.00174.19 C
HETATM42336 C3A CLA B 610 16.333 14.538 13.385 1.00174.01 C
HETATM42337 C4A CLA B 610 16.599 15.155 12.007 1.00174.11 C
HETATM42338 CMA CLA B 610 17.395 14.890 14.397 1.00174.44 C
HETATM42339 CAA CLA B 610 13.915 14.038 13.872 1.00174.48 C
HETATM42340 CBA CLA B 610 13.780 13.365 12.524 1.00173.63 C
HETATM42341 CGA CLA B 610 12.518 12.569 12.463 1.00173.78 C
HETATM42342 O1A CLA B 610 12.024 11.836 13.322 1.00173.85 O
HETATM42343 O2A CLA B 610 11.871 12.708 11.270 1.00173.86 O
HETATM42344 NB CLA B 610 17.470 16.261 9.319 1.00174.14 N
HETATM42345 C1B CLA B 610 18.101 15.310 10.038 1.00174.52 C
HETATM42346 C2B CLA B 610 19.299 14.858 9.296 1.00174.00 C
HETATM42347 C3B CLA B 610 19.359 15.551 8.117 1.00173.80 C
HETATM42348 C4B CLA B 610 18.182 16.453 8.110 1.00173.97 C
HETATM42349 CMB CLA B 610 20.175 13.845 9.831 1.00174.14 C
HETATM42350 CAB CLA B 610 20.307 15.481 7.036 1.00174.34 C
HETATM42351 CBB CLA B 610 21.264 16.379 6.793 1.00174.83 C
HETATM42352 NC CLA B 610 15.777 18.271 8.101 1.00174.74 N
HETATM42353 C1C CLA B 610 16.742 18.189 7.129 1.00174.86 C
HETATM42354 C2C CLA B 610 16.459 19.125 6.054 1.00174.41 C
HETATM42355 C3C CLA B 610 15.282 19.781 6.417 1.00173.51 C
HETATM42356 C4C CLA B 610 14.853 19.237 7.703 1.00174.51 C
HETATM42357 CMC CLA B 610 17.293 19.304 4.862 1.00173.85 C
HETATM42358 CAC CLA B 610 14.582 20.821 5.657 1.00172.24 C
HETATM42359 CBC CLA B 610 13.483 20.199 4.837 1.00172.27 C
HETATM42360 ND CLA B 610 14.014 18.064 10.300 1.00175.04 N
HETATM42361 C1D CLA B 610 13.299 19.094 9.634 1.00175.19 C
HETATM42362 C2D CLA B 610 12.114 19.453 10.447 1.00174.98 C
HETATM42363 C3D CLA B 610 12.155 18.637 11.569 1.00174.70 C
HETATM42364 C4D CLA B 610 13.368 17.803 11.437 1.00174.49 C
HETATM42365 CMD CLA B 610 11.135 20.473 10.068 1.00174.09 C
HETATM42366 CAD CLA B 610 11.523 18.279 12.828 1.00174.19 C
HETATM42367 OBD CLA B 610 10.499 18.725 13.331 1.00173.95 O
HETATM42368 CBD CLA B 610 12.407 17.181 13.501 1.00174.10 C
HETATM42369 CGD CLA B 610 12.891 17.594 14.865 1.00174.66 C
HETATM42370 O1D CLA B 610 13.830 18.344 15.145 1.00175.17 O
HETATM42371 O2D CLA B 610 12.172 17.042 15.883 1.00174.66 O
HETATM42372 CED CLA B 610 11.846 17.868 17.001 1.00174.20 C
HETATM42373 C1 CLA B 610 11.168 11.540 10.803 1.00174.20 C
HETATM42374 C2 CLA B 610 10.462 11.925 9.557 1.00174.37 C
HETATM42375 C3 CLA B 610 9.523 11.146 8.999 1.00173.69 C
HETATM42376 C4 CLA B 610 9.131 9.851 9.604 1.00172.66 C
HETATM42377 C5 CLA B 610 8.825 11.557 7.747 1.00174.68 C
HETATM42378 C6 CLA B 610 9.742 11.719 6.547 1.00175.22 C
HETATM42379 C7 CLA B 610 8.941 11.705 5.257 1.00174.19 C
HETATM42380 C8 CLA B 610 9.651 12.428 4.118 1.00172.79 C
HETATM42381 C9 CLA B 610 9.382 13.918 4.190 1.00172.67 C
HETATM42382 C10 CLA B 610 9.206 11.882 2.766 1.00172.84 C
HETATM42383 C11 CLA B 610 10.373 11.693 1.819 1.00173.83 C
HETATM42384 C12 CLA B 610 11.243 10.517 2.214 1.00174.15 C
HETATM42385 C13 CLA B 610 12.393 10.326 1.234 1.00174.19 C
HETATM42386 C14 CLA B 610 12.885 8.893 1.251 1.00174.10 C
HETATM42387 C15 CLA B 610 13.542 11.282 1.534 1.00174.01 C
HETATM42388 C16 CLA B 610 14.609 11.224 0.461 1.00173.33 C
HETATM42389 C17 CLA B 610 15.917 11.797 0.963 1.00173.61 C
HETATM42390 C18 CLA B 610 16.503 12.808 -0.012 1.00173.70 C
HETATM42391 C19 CLA B 610 17.390 13.799 0.712 1.00174.41 C
HETATM42392 C20 CLA B 610 17.287 12.101 -1.097 1.00173.64 C
HETATM42393 MG CLA B 611 22.133 11.799 10.838 1.00173.57 M
HETATM42394 CHA CLA B 611 24.846 13.084 9.083 1.00173.84 C
HETATM42395 CHB CLA B 611 21.269 9.922 8.146 1.00174.80 C
HETATM42396 CHC CLA B 611 19.420 10.622 12.605 1.00173.49 C
HETATM42397 CHD CLA B 611 23.013 13.847 13.578 1.00173.99 C
HETATM42398 NA CLA B 611 22.948 11.558 8.932 1.00173.79 N
HETATM42399 C1A CLA B 611 24.084 12.181 8.391 1.00173.76 C
HETATM42400 C2A CLA B 611 24.326 11.725 6.951 1.00173.61 C
HETATM42401 C3A CLA B 611 23.134 10.780 6.669 1.00174.44 C
HETATM42402 C4A CLA B 611 22.386 10.728 8.001 1.00174.45 C
HETATM42403 CMA CLA B 611 22.258 11.317 5.564 1.00173.95 C
HETATM42404 CAA CLA B 611 25.653 10.998 6.781 1.00173.80 C
HETATM42405 CBA CLA B 611 25.934 9.963 7.851 1.00173.98 C
HETATM42406 CGA CLA B 611 26.963 9.000 7.340 1.00174.51 C
HETATM42407 O1A CLA B 611 26.788 7.931 6.749 1.00174.50 O
HETATM42408 O2A CLA B 611 28.249 9.406 7.568 1.00174.71 O
HETATM42409 NB CLA B 611 20.633 10.514 10.452 1.00173.64 N
HETATM42410 C1B CLA B 611 20.483 9.802 9.308 1.00174.13 C
HETATM42411 C2B CLA B 611 19.336 8.859 9.448 1.00173.73 C
HETATM42412 C3B CLA B 611 18.809 9.055 10.707 1.00173.45 C
HETATM42413 C4B CLA B 611 19.617 10.125 11.354 1.00173.56 C
HETATM42414 CMB CLA B 611 18.914 7.957 8.376 1.00174.29 C
HETATM42415 CAB CLA B 611 17.684 8.438 11.365 1.00173.69 C
HETATM42416 CBB CLA B 611 17.332 7.152 11.270 1.00173.60 C
HETATM42417 NC CLA B 611 21.369 12.167 12.743 1.00173.19 N
HETATM42418 C1C CLA B 611 20.244 11.582 13.259 1.00173.26 C
HETATM42419 C2C CLA B 611 19.998 12.077 14.606 1.00173.62 C
HETATM42420 C3C CLA B 611 21.018 12.985 14.887 1.00173.85 C
HETATM42421 C4C CLA B 611 21.869 13.044 13.707 1.00173.53 C
HETATM42422 CMC CLA B 611 18.893 11.656 15.467 1.00173.95 C
HETATM42423 CAC CLA B 611 21.214 13.745 16.128 1.00174.47 C
HETATM42424 CBC CLA B 611 20.760 15.177 15.996 1.00174.36 C
HETATM42425 ND CLA B 611 23.561 13.153 11.291 1.00174.24 N
HETATM42426 C1D CLA B 611 23.814 13.910 12.460 1.00174.45 C
HETATM42427 C2D CLA B 611 25.027 14.725 12.251 1.00174.76 C
HETATM42428 C3D CLA B 611 25.468 14.459 10.969 1.00174.47 C
HETATM42429 C4D CLA B 611 24.514 13.477 10.417 1.00174.24 C
HETATM42430 CMD CLA B 611 25.586 15.616 13.259 1.00174.93 C
HETATM42431 CAD CLA B 611 26.467 14.730 9.949 1.00174.08 C
HETATM42432 OBD CLA B 611 27.443 15.473 9.984 1.00174.18 O
HETATM42433 CBD CLA B 611 26.092 13.860 8.710 1.00173.61 C
HETATM42434 CGD CLA B 611 25.886 14.690 7.477 1.00172.43 C
HETATM42435 O1D CLA B 611 26.587 14.732 6.460 1.00171.91 O
HETATM42436 O2D CLA B 611 24.773 15.471 7.543 1.00172.53 O
HETATM42437 CED CLA B 611 24.780 16.684 6.794 1.00172.64 C
HETATM42438 C1 CLA B 611 29.295 8.694 6.873 1.00174.38 C
HETATM42439 C2 CLA B 611 29.630 9.467 5.649 1.00174.18 C
HETATM42440 C3 CLA B 611 29.484 8.965 4.409 1.00173.83 C
HETATM42441 C4 CLA B 611 28.981 7.589 4.181 1.00173.26 C
HETATM42442 C5 CLA B 611 29.825 9.761 3.194 1.00173.94 C
HETATM42443 C6 CLA B 611 29.051 11.064 3.081 1.00173.63 C
HETATM42444 C7 CLA B 611 27.571 10.855 3.341 1.00173.87 C
HETATM42445 C8 CLA B 611 26.698 11.171 2.134 1.00174.46 C
HETATM42446 C9 CLA B 611 25.337 11.645 2.598 1.00174.50 C
HETATM42447 C10 CLA B 611 26.544 9.947 1.241 1.00174.47 C
HETATM42448 C11 CLA B 611 26.070 10.316 -0.147 1.00173.40 C
HETATM42449 C12 CLA B 611 27.082 11.180 -0.869 1.00173.04 C
HETATM42450 C13 CLA B 611 26.391 12.197 -1.766 1.00173.22 C
HETATM42451 C14 CLA B 611 25.686 11.506 -2.914 1.00173.89 C
HETATM42452 C15 CLA B 611 27.374 13.239 -2.291 1.00173.69 C
HETATM42453 C16 CLA B 611 28.185 13.847 -1.165 1.00173.29 C
HETATM42454 C17 CLA B 611 27.864 15.314 -0.965 1.00173.42 C
HETATM42455 C18 CLA B 611 28.713 15.943 0.133 1.00173.03 C
HETATM42456 C19 CLA B 611 28.215 17.330 0.477 1.00172.32 C
HETATM42457 C20 CLA B 611 28.707 15.073 1.373 1.00174.35 C
HETATM42458 MG CLA B 612 19.177 10.602 1.940 1.00172.32 M
HETATM42459 CHA CLA B 612 16.799 9.703 4.310 1.00172.92 C
HETATM42460 CHB CLA B 612 19.952 13.363 3.765 1.00173.18 C
HETATM42461 CHC CLA B 612 21.593 11.380 -0.375 1.00171.96 C
HETATM42462 CHD CLA B 612 18.344 7.706 0.080 1.00174.22 C
HETATM42463 NA CLA B 612 18.455 11.395 3.734 1.00173.26 N
HETATM42464 C1A CLA B 612 17.468 10.868 4.580 1.00173.08 C
HETATM42465 C2A CLA B 612 17.244 11.779 5.788 1.00173.17 C
HETATM42466 C3A CLA B 612 18.163 12.992 5.506 1.00173.51 C
HETATM42467 C4A CLA B 612 18.928 12.571 4.251 1.00173.39 C
HETATM42468 CMA CLA B 612 17.377 14.260 5.284 1.00173.88 C
HETATM42469 CAA CLA B 612 17.642 11.097 7.085 1.00173.32 C
HETATM42470 CBA CLA B 612 17.484 12.031 8.266 1.00173.85 C
HETATM42471 CGA CLA B 612 16.035 12.225 8.591 1.00174.32 C
HETATM42472 O1A CLA B 612 15.329 11.577 9.367 1.00175.13 O
HETATM42473 O2A CLA B 612 15.463 13.264 7.908 1.00173.97 O
HETATM42474 NB CLA B 612 20.477 12.119 1.703 1.00172.00 N
HETATM42475 C1B CLA B 612 20.721 13.090 2.619 1.00172.57 C
HETATM42476 C2B CLA B 612 21.943 13.858 2.240 1.00172.76 C
HETATM42477 C3B CLA B 612 22.412 13.303 1.065 1.00172.44 C
HETATM42478 C4B CLA B 612 21.481 12.193 0.711 1.00171.93 C
HETATM42479 CMB CLA B 612 22.447 14.967 3.049 1.00173.31 C
HETATM42480 CAB CLA B 612 23.546 13.620 0.234 1.00172.69 C
HETATM42481 CBB CLA B 612 24.577 14.415 0.540 1.00172.68 C
HETATM42482 NC CLA B 612 19.819 9.718 0.162 1.00172.14 N
HETATM42483 C1C CLA B 612 20.809 10.218 -0.638 1.00172.01 C
HETATM42484 C2C CLA B 612 20.984 9.366 -1.808 1.00172.46 C
HETATM42485 C3C CLA B 612 20.087 8.307 -1.667 1.00172.69 C
HETATM42486 C4C CLA B 612 19.355 8.539 -0.428 1.00172.99 C
HETATM42487 CMC CLA B 612 21.952 9.605 -2.878 1.00172.83 C
HETATM42488 CAC CLA B 612 19.879 7.183 -2.594 1.00172.95 C
HETATM42489 CBC CLA B 612 18.763 7.449 -3.577 1.00172.49 C
HETATM42490 ND CLA B 612 17.903 9.039 2.095 1.00173.40 N
HETATM42491 C1D CLA B 612 17.659 7.916 1.259 1.00174.16 C
HETATM42492 C2D CLA B 612 16.592 7.086 1.864 1.00173.96 C
HETATM42493 C3D CLA B 612 16.229 7.723 3.037 1.00173.18 C
HETATM42494 C4D CLA B 612 17.071 8.934 3.131 1.00173.03 C
HETATM42495 CMD CLA B 612 16.073 5.846 1.288 1.00174.22 C
HETATM42496 CAD CLA B 612 15.359 7.702 4.198 1.00172.99 C
HETATM42497 OBD CLA B 612 14.494 6.888 4.503 1.00173.43 O
HETATM42498 CBD CLA B 612 15.706 8.962 5.053 1.00172.81 C
HETATM42499 CGD CLA B 612 14.502 9.828 5.310 1.00172.90 C
HETATM42500 O1D CLA B 612 14.337 11.011 4.998 1.00173.07 O
HETATM42501 O2D CLA B 612 13.497 9.191 5.972 1.00173.07 O
HETATM42502 CED CLA B 612 12.995 9.800 7.163 1.00173.74 C
HETATM42503 C1 CLA B 612 14.033 13.399 8.033 1.00174.03 C
HETATM42504 C2 CLA B 612 13.499 13.632 6.669 1.00173.67 C
HETATM42505 C3 CLA B 612 13.369 14.860 6.140 1.00173.65 C
HETATM42506 C4 CLA B 612 13.751 16.077 6.890 1.00173.84 C
HETATM42507 C5 CLA B 612 12.831 15.062 4.766 1.00174.06 C
HETATM42508 C6 CLA B 612 13.743 15.920 3.909 1.00174.35 C
HETATM42509 C7 CLA B 612 13.022 16.393 2.662 1.00173.93 C
HETATM42510 C8 CLA B 612 13.833 16.135 1.397 1.00173.60 C
HETATM42511 C9 CLA B 612 15.178 16.826 1.484 1.00174.38 C
HETATM42512 C10 CLA B 612 13.084 16.607 0.157 1.00172.79 C
HETATM42513 C11 CLA B 612 12.525 15.449 -0.643 1.00173.01 C
HETATM42514 C12 CLA B 612 11.218 14.930 -0.077 1.00173.66 C
HETATM42515 C13 CLA B 612 10.025 15.742 -0.563 1.00174.22 C
HETATM42516 C14 CLA B 612 9.503 16.656 0.527 1.00174.08 C
HETATM42517 C15 CLA B 612 8.904 14.837 -1.062 1.00174.49 C
HETATM42518 C16 CLA B 612 9.389 13.900 -2.150 1.00174.79 C
HETATM42519 C17 CLA B 612 8.641 12.585 -2.119 1.00175.11 C
HETATM42520 C18 CLA B 612 9.043 11.664 -3.263 1.00175.22 C
HETATM42521 C19 CLA B 612 9.198 10.234 -2.783 1.00175.08 C
HETATM42522 C20 CLA B 612 8.018 11.729 -4.376 1.00175.28 C
HETATM42523 MG CLA B 613 12.534 4.886 10.499 1.00173.80 M
HETATM42524 CHA CLA B 613 11.582 4.150 13.754 1.00173.82 C
HETATM42525 CHB CLA B 613 15.751 4.055 11.255 1.00175.53 C
HETATM42526 CHC CLA B 613 13.396 5.536 7.242 1.00174.39 C
HETATM42527 CHD CLA B 613 9.192 5.842 9.795 1.00174.25 C
HETATM42528 NA CLA B 613 13.483 4.212 12.234 1.00174.30 N
HETATM42529 C1A CLA B 613 12.911 3.962 13.490 1.00173.82 C
HETATM42530 C2A CLA B 613 13.960 3.478 14.489 1.00173.97 C
HETATM42531 C3A CLA B 613 15.282 3.558 13.692 1.00174.27 C
HETATM42532 C4A CLA B 613 14.830 3.959 12.284 1.00174.98 C
HETATM42533 CMA CLA B 613 16.223 4.574 14.284 1.00174.04 C
HETATM42534 CAA CLA B 613 13.668 2.046 14.905 1.00174.34 C
HETATM42535 CBA CLA B 613 13.570 1.124 13.703 1.00174.20 C
HETATM42536 CGA CLA B 613 12.143 0.925 13.282 1.00174.12 C
HETATM42537 O1A CLA B 613 11.240 0.339 13.881 1.00174.04 O
HETATM42538 O2A CLA B 613 11.864 1.491 12.066 1.00174.09 O
HETATM42539 NB CLA B 613 14.253 4.822 9.451 1.00173.66 N
HETATM42540 C1B CLA B 613 15.462 4.428 9.929 1.00174.46 C
HETATM42541 C2B CLA B 613 16.472 4.452 8.832 1.00173.85 C
HETATM42542 C3B CLA B 613 15.812 4.869 7.695 1.00173.59 C
HETATM42543 C4B CLA B 613 14.388 5.106 8.074 1.00173.51 C
HETATM42544 CMB CLA B 613 17.874 4.081 9.036 1.00173.80 C
HETATM42545 CAB CLA B 613 16.283 5.073 6.349 1.00174.71 C
HETATM42546 CBB CLA B 613 17.455 5.613 6.003 1.00175.14 C
HETATM42547 NC CLA B 613 11.476 5.566 8.829 1.00174.45 N
HETATM42548 C1C CLA B 613 12.028 5.760 7.592 1.00174.74 C
HETATM42549 C2C CLA B 613 11.004 6.233 6.661 1.00174.42 C
HETATM42550 C3C CLA B 613 9.811 6.328 7.386 1.00173.49 C
HETATM42551 C4C CLA B 613 10.123 5.903 8.745 1.00174.14 C
HETATM42552 CMC CLA B 613 11.251 6.540 5.251 1.00174.22 C
HETATM42553 CAC CLA B 613 8.480 6.753 6.908 1.00172.46 C
HETATM42554 CBC CLA B 613 8.387 8.209 6.509 1.00173.68 C
HETATM42555 ND CLA B 613 10.765 4.979 11.473 1.00174.29 N
HETATM42556 C1D CLA B 613 9.472 5.415 11.074 1.00174.56 C
HETATM42557 C2D CLA B 613 8.551 5.309 12.230 1.00174.81 C
HETATM42558 C3D CLA B 613 9.300 4.791 13.272 1.00174.49 C
HETATM42559 C4D CLA B 613 10.673 4.624 12.754 1.00174.16 C
HETATM42560 CMD CLA B 613 7.134 5.671 12.202 1.00174.65 C
HETATM42561 CAD CLA B 613 9.308 4.389 14.667 1.00174.25 C
HETATM42562 OBD CLA B 613 8.388 4.364 15.473 1.00174.60 O
HETATM42563 CBD CLA B 613 10.769 3.967 15.018 1.00173.93 C
HETATM42564 CGD CLA B 613 11.336 4.724 16.191 1.00174.27 C
HETATM42565 O1D CLA B 613 12.342 4.451 16.851 1.00174.83 O
HETATM42566 O2D CLA B 613 10.630 5.832 16.548 1.00174.52 O
HETATM42567 CED CLA B 613 10.383 6.036 17.941 1.00174.94 C
HETATM42568 C1 CLA B 613 10.680 1.030 11.382 1.00173.35 C
HETATM42569 C2 CLA B 613 11.032 0.934 9.942 1.00173.20 C
HETATM42570 C3 CLA B 613 10.341 1.555 8.972 1.00172.55 C
HETATM42571 C4 CLA B 613 9.161 2.397 9.264 1.00172.88 C
HETATM42572 C5 CLA B 613 10.735 1.426 7.540 1.00172.98 C
HETATM42573 C6 CLA B 613 9.699 0.679 6.722 1.00173.67 C
HETATM42574 C7 CLA B 613 9.172 1.540 5.590 1.00174.36 C
HETATM42575 C8 CLA B 613 9.993 1.393 4.314 1.00175.15 C
HETATM42576 C9 CLA B 613 9.569 2.426 3.288 1.00173.84 C
HETATM42577 C10 CLA B 613 9.851 -0.009 3.733 1.00175.33 C
HETATM42578 C11 CLA B 613 10.666 -0.180 2.469 1.00174.90 C
HETATM42579 C12 CLA B 613 10.189 -1.361 1.649 1.00174.52 C
HETATM42580 C13 CLA B 613 10.822 -1.387 0.261 1.00173.81 C
HETATM42581 C14 CLA B 613 12.275 -1.807 0.341 1.00172.88 C
HETATM42582 C15 CLA B 613 10.699 -0.041 -0.447 1.00173.86 C
HETATM42583 C16 CLA B 613 9.263 0.295 -0.804 1.00174.32 C
HETATM42584 C17 CLA B 613 8.715 -0.598 -1.898 1.00174.51 C
HETATM42585 C18 CLA B 613 7.803 0.171 -2.848 1.00173.72 C
HETATM42586 C19 CLA B 613 8.561 0.628 -4.078 1.00172.45 C
HETATM42587 C20 CLA B 613 6.608 -0.665 -3.251 1.00173.67 C
HETATM42588 MG CLA B 614 34.561 7.216 13.449 1.00175.39 M
HETATM42589 CHA CLA B 614 31.741 7.351 11.429 1.00173.76 C
HETATM42590 CHB CLA B 614 36.419 6.191 10.793 1.00175.05 C
HETATM42591 CHC CLA B 614 37.302 7.009 15.521 1.00175.02 C
HETATM42592 CHD CLA B 614 32.563 8.170 16.209 1.00174.38 C
HETATM42593 NA CLA B 614 34.128 6.874 11.433 1.00174.37 N
HETATM42594 C1A CLA B 614 32.890 6.977 10.779 1.00173.70 C
HETATM42595 C2A CLA B 614 33.019 6.621 9.295 1.00173.67 C
HETATM42596 C3A CLA B 614 34.524 6.293 9.131 1.00174.33 C
HETATM42597 C4A CLA B 614 35.086 6.465 10.543 1.00174.72 C
HETATM42598 CMA CLA B 614 34.759 4.902 8.601 1.00174.22 C
HETATM42599 CAA CLA B 614 32.617 7.782 8.400 1.00174.09 C
HETATM42600 CBA CLA B 614 32.742 7.445 6.928 1.00174.35 C
HETATM42601 CGA CLA B 614 31.972 6.201 6.599 1.00174.33 C
HETATM42602 O1A CLA B 614 30.835 5.880 6.952 1.00174.14 O
HETATM42603 O2A CLA B 614 32.665 5.347 5.790 1.00175.05 O
HETATM42604 NB CLA B 614 36.482 6.665 13.212 1.00174.22 N
HETATM42605 C1B CLA B 614 37.064 6.306 12.039 1.00174.23 C
HETATM42606 C2B CLA B 614 38.518 6.046 12.251 1.00173.62 C
HETATM42607 C3B CLA B 614 38.773 6.274 13.584 1.00173.43 C
HETATM42608 C4B CLA B 614 37.483 6.684 14.212 1.00174.15 C
HETATM42609 CMB CLA B 614 39.422 5.639 11.176 1.00174.31 C
HETATM42610 CAB CLA B 614 40.004 6.194 14.326 1.00173.67 C
HETATM42611 CBB CLA B 614 41.154 6.778 13.976 1.00172.99 C
HETATM42612 NC CLA B 614 34.873 7.571 15.483 1.00174.75 N
HETATM42613 C1C CLA B 614 36.080 7.436 16.118 1.00174.70 C
HETATM42614 C2C CLA B 614 35.937 7.761 17.531 1.00173.92 C
HETATM42615 C3C CLA B 614 34.593 8.068 17.738 1.00173.91 C
HETATM42616 C4C CLA B 614 33.930 7.941 16.445 1.00174.29 C
HETATM42617 CMC CLA B 614 37.024 7.738 18.509 1.00174.07 C
HETATM42618 CAC CLA B 614 33.957 8.454 19.009 1.00174.01 C
HETATM42619 CBC CLA B 614 33.433 7.263 19.775 1.00173.38 C
HETATM42620 ND CLA B 614 32.649 7.791 13.784 1.00174.55 N
HETATM42621 C1D CLA B 614 31.945 8.105 14.978 1.00174.32 C
HETATM42622 C2D CLA B 614 30.517 8.330 14.656 1.00174.19 C
HETATM42623 C3D CLA B 614 30.387 8.074 13.303 1.00174.24 C
HETATM42624 C4D CLA B 614 31.735 7.708 12.816 1.00174.23 C
HETATM42625 CMD CLA B 614 29.498 8.734 15.623 1.00173.82 C
HETATM42626 CAD CLA B 614 29.487 8.031 12.165 1.00174.06 C
HETATM42627 OBD CLA B 614 28.306 8.354 12.092 1.00174.20 O
HETATM42628 CBD CLA B 614 30.307 7.470 10.961 1.00173.72 C
HETATM42629 CGD CLA B 614 29.792 6.131 10.510 1.00173.75 C
HETATM42630 O1D CLA B 614 30.076 5.020 10.969 1.00173.67 O
HETATM42631 O2D CLA B 614 28.914 6.193 9.470 1.00174.15 O
HETATM42632 CED CLA B 614 28.278 4.980 9.065 1.00174.26 C
HETATM42633 C1 CLA B 614 31.878 4.482 4.943 1.00174.48 C
HETATM42634 C2 CLA B 614 32.747 4.103 3.801 1.00174.83 C
HETATM42635 C3 CLA B 614 33.445 2.956 3.752 1.00174.56 C
HETATM42636 C4 CLA B 614 34.303 2.617 2.592 1.00174.11 C
HETATM42637 C5 CLA B 614 33.386 1.965 4.863 1.00174.01 C
HETATM42638 C6 CLA B 614 34.739 1.717 5.499 1.00173.83 C
HETATM42639 C7 CLA B 614 34.620 0.719 6.633 1.00173.99 C
HETATM42640 C8 CLA B 614 35.968 0.134 7.040 1.00175.00 C
HETATM42641 C9 CLA B 614 36.843 -0.125 5.830 1.00174.88 C
HETATM42642 C10 CLA B 614 35.776 -1.156 7.826 1.00173.97 C
HETATM42643 C11 CLA B 614 36.426 -1.073 9.188 1.00172.94 C
HETATM42644 C12 CLA B 614 36.119 -2.300 10.020 1.00172.85 C
HETATM42645 C13 CLA B 614 36.607 -2.123 11.451 1.00173.65 C
HETATM42646 C14 CLA B 614 36.970 -3.462 12.060 1.00174.84 C
HETATM42647 C15 CLA B 614 35.562 -1.416 12.306 1.00173.92 C
HETATM42648 C16 CLA B 614 36.059 -0.073 12.802 1.00173.74 C
HETATM42649 C17 CLA B 614 35.444 1.077 12.032 1.00172.94 C
HETATM42650 C18 CLA B 614 35.934 2.429 12.535 1.00172.34 C
HETATM42651 C19 CLA B 614 35.753 2.560 14.034 1.00172.86 C
HETATM42652 C20 CLA B 614 37.388 2.632 12.170 1.00172.12 C
HETATM42653 MG CLA B 615 32.505 -1.107 13.960 1.00173.59 M
HETATM42654 CHA CLA B 615 32.936 -4.076 15.694 1.00173.70 C
HETATM42655 CHB CLA B 615 31.981 -2.854 11.085 1.00173.79 C
HETATM42656 CHC CLA B 615 31.959 1.869 12.316 1.00174.25 C
HETATM42657 CHD CLA B 615 33.002 0.671 16.986 1.00173.45 C
HETATM42658 NA CLA B 615 32.480 -3.141 13.491 1.00174.46 N
HETATM42659 C1A CLA B 615 32.669 -4.228 14.359 1.00174.27 C
HETATM42660 C2A CLA B 615 32.547 -5.555 13.611 1.00173.92 C
HETATM42661 C3A CLA B 615 32.330 -5.126 12.140 1.00174.44 C
HETATM42662 C4A CLA B 615 32.243 -3.600 12.222 1.00174.50 C
HETATM42663 CMA CLA B 615 33.436 -5.603 11.233 1.00173.74 C
HETATM42664 CAA CLA B 615 31.318 -6.309 14.096 1.00173.36 C
HETATM42665 CBA CLA B 615 31.658 -7.614 14.781 1.00173.00 C
HETATM42666 CGA CLA B 615 32.096 -8.625 13.769 1.00172.93 C
HETATM42667 O1A CLA B 615 32.937 -8.509 12.877 1.00172.05 O
HETATM42668 O2A CLA B 615 31.445 -9.820 13.903 1.00174.27 O
HETATM42669 NB CLA B 615 32.084 -0.589 12.060 1.00173.84 N
HETATM42670 C1B CLA B 615 31.882 -1.450 11.030 1.00173.80 C
HETATM42671 C2B CLA B 615 31.536 -0.688 9.793 1.00174.07 C
HETATM42672 C3B CLA B 615 31.529 0.646 10.133 1.00174.26 C
HETATM42673 C4B CLA B 615 31.875 0.727 11.582 1.00174.31 C
HETATM42674 CMB CLA B 615 31.259 -1.326 8.507 1.00174.02 C
HETATM42675 CAB CLA B 615 31.239 1.804 9.330 1.00173.21 C
HETATM42676 CBB CLA B 615 32.150 2.628 8.812 1.00172.67 C
HETATM42677 NC CLA B 615 32.500 0.896 14.549 1.00173.29 N
HETATM42678 C1C CLA B 615 32.249 1.947 13.709 1.00173.45 C
HETATM42679 C2C CLA B 615 32.305 3.200 14.445 1.00173.05 C
HETATM42680 C3C CLA B 615 32.598 2.870 15.767 1.00173.03 C
HETATM42681 C4C CLA B 615 32.720 1.418 15.827 1.00173.35 C
HETATM42682 CMC CLA B 615 32.077 4.519 13.859 1.00173.53 C
HETATM42683 CAC CLA B 615 32.744 3.799 16.896 1.00173.54 C
HETATM42684 CBC CLA B 615 34.109 4.438 16.926 1.00173.57 C
HETATM42685 ND CLA B 615 32.888 -1.527 15.900 1.00173.55 N
HETATM42686 C1D CLA B 615 33.086 -0.704 17.041 1.00173.44 C
HETATM42687 C2D CLA B 615 33.371 -1.564 18.213 1.00173.57 C
HETATM42688 C3D CLA B 615 33.332 -2.868 17.753 1.00173.73 C
HETATM42689 C4D CLA B 615 33.024 -2.787 16.310 1.00173.47 C
HETATM42690 CMD CLA B 615 33.634 -1.073 19.564 1.00173.75 C
HETATM42691 CAD CLA B 615 33.458 -4.273 18.096 1.00174.41 C
HETATM42692 OBD CLA B 615 33.695 -4.802 19.175 1.00175.43 O
HETATM42693 CBD CLA B 615 33.226 -5.081 16.786 1.00173.87 C
HETATM42694 CGD CLA B 615 34.441 -5.889 16.438 1.00173.98 C
HETATM42695 O1D CLA B 615 35.116 -5.814 15.407 1.00173.58 O
HETATM42696 O2D CLA B 615 34.807 -6.787 17.399 1.00175.09 O
HETATM42697 CED CLA B 615 34.247 -8.101 17.342 1.00174.68 C
HETATM42698 C1 CLA B 615 32.258 -10.938 14.316 1.00175.06 C
HETATM42699 C2 CLA B 615 31.501 -12.178 14.006 1.00175.55 C
HETATM42700 C3 CLA B 615 31.262 -12.620 12.757 1.00175.44 C
HETATM42701 C4 CLA B 615 30.499 -13.867 12.508 1.00174.20 C
HETATM42702 C5 CLA B 615 31.745 -11.881 11.555 1.00174.71 C
HETATM42703 C6 CLA B 615 32.999 -12.489 10.957 1.00174.66 C
HETATM42704 C7 CLA B 615 34.230 -11.748 11.436 1.00174.40 C
HETATM42705 C8 CLA B 615 34.971 -11.067 10.293 1.00175.33 C
HETATM42706 C9 CLA B 615 35.896 -12.061 9.619 1.00175.86 C
HETATM42707 C10 CLA B 615 35.755 -9.862 10.802 1.00175.53 C
HETATM42708 C11 CLA B 615 35.612 -8.649 9.903 1.00175.38 C
HETATM42709 C12 CLA B 615 36.666 -8.618 8.812 1.00175.40 C
HETATM42710 C13 CLA B 615 37.539 -7.367 8.862 1.00174.74 C
HETATM42711 C14 CLA B 615 37.889 -6.980 10.287 1.00175.20 C
HETATM42712 C15 CLA B 615 36.886 -6.190 8.143 1.00174.33 C
HETATM42713 C16 CLA B 615 37.907 -5.417 7.332 1.00174.99 C
HETATM42714 C17 CLA B 615 37.836 -5.767 5.859 1.00175.11 C
HETATM42715 C18 CLA B 615 39.213 -5.813 5.207 1.00175.10 C
HETATM42716 C19 CLA B 615 40.050 -4.605 5.580 1.00174.35 C
HETATM42717 C20 CLA B 615 39.934 -7.088 5.586 1.00174.76 C
HETATM42718 C1 BCR B 616 9.212 5.626 -10.900 1.00173.04 C
HETATM42719 C2 BCR B 616 8.151 6.127 -11.859 1.00173.72 C
HETATM42720 C3 BCR B 616 6.785 6.127 -11.234 1.00173.26 C
HETATM42721 C4 BCR B 616 6.403 4.750 -10.755 1.00172.26 C
HETATM42722 C5 BCR B 616 7.507 4.091 -10.025 1.00172.20 C
HETATM42723 C6 BCR B 616 8.776 4.476 -10.062 1.00172.71 C
HETATM42724 C7 BCR B 616 9.814 3.770 -9.313 1.00173.28 C
HETATM42725 C8 BCR B 616 10.100 4.071 -8.046 1.00174.02 C
HETATM42726 C9 BCR B 616 11.086 3.351 -7.263 1.00174.83 C
HETATM42727 C10 BCR B 616 11.190 3.582 -5.948 1.00175.12 C
HETATM42728 C11 BCR B 616 12.116 2.892 -5.083 1.00174.92 C
HETATM42729 C33 BCR B 616 7.075 2.947 -9.204 1.00172.62 C
HETATM42730 C31 BCR B 616 9.634 6.805 -10.049 1.00173.41 C
HETATM42731 C32 BCR B 616 10.395 5.193 -11.740 1.00172.87 C
HETATM42732 C34 BCR B 616 11.915 2.340 -7.944 1.00174.86 C
HETATM42733 C12 BCR B 616 12.096 3.139 -3.769 1.00173.99 C
HETATM42734 C13 BCR B 616 12.960 2.498 -2.807 1.00173.28 C
HETATM42735 C14 BCR B 616 12.869 2.845 -1.516 1.00173.85 C
HETATM42736 C15 BCR B 616 13.606 2.207 -0.456 1.00174.86 C
HETATM42737 C16 BCR B 616 13.449 2.599 0.815 1.00174.53 C
HETATM42738 C17 BCR B 616 14.189 1.930 1.853 1.00174.26 C
HETATM42739 C18 BCR B 616 14.121 2.205 3.160 1.00174.20 C
HETATM42740 C19 BCR B 616 14.847 1.376 4.103 1.00174.90 C
HETATM42741 C20 BCR B 616 14.763 1.563 5.422 1.00175.11 C
HETATM42742 C21 BCR B 616 15.521 0.716 6.314 1.00174.74 C
HETATM42743 C22 BCR B 616 15.419 0.706 7.649 1.00174.07 C
HETATM42744 C23 BCR B 616 16.316 -0.145 8.420 1.00173.18 C
HETATM42745 C24 BCR B 616 16.107 -0.462 9.702 1.00172.78 C
HETATM42746 C25 BCR B 616 17.014 -1.252 10.529 1.00173.30 C
HETATM42747 C26 BCR B 616 17.104 -2.575 10.399 1.00173.83 C
HETATM42748 C27 BCR B 616 17.986 -3.470 11.182 1.00173.15 C
HETATM42749 C28 BCR B 616 19.135 -2.710 11.792 1.00173.20 C
HETATM42750 C29 BCR B 616 18.618 -1.460 12.455 1.00174.12 C
HETATM42751 C30 BCR B 616 17.829 -0.525 11.545 1.00173.52 C
HETATM42752 C35 BCR B 616 13.867 1.416 -3.235 1.00172.86 C
HETATM42753 C36 BCR B 616 13.234 3.254 3.690 1.00173.79 C
HETATM42754 C37 BCR B 616 14.318 1.410 8.340 1.00174.30 C
HETATM42755 C38 BCR B 616 16.307 -3.325 9.410 1.00173.65 C
HETATM42756 C39 BCR B 616 18.738 0.483 10.867 1.00173.85 C
HETATM42757 C40 BCR B 616 16.929 0.265 12.486 1.00173.18 C
HETATM42758 C1 BCR B 617 21.993 -15.823 5.601 1.00173.43 C
HETATM42759 C2 BCR B 617 22.032 -17.308 5.903 1.00173.66 C
HETATM42760 C3 BCR B 617 20.798 -17.720 6.654 1.00174.14 C
HETATM42761 C4 BCR B 617 19.570 -17.472 5.816 1.00173.42 C
HETATM42762 C5 BCR B 617 19.604 -16.147 5.148 1.00172.68 C
HETATM42763 C6 BCR B 617 20.685 -15.380 5.039 1.00172.92 C
HETATM42764 C7 BCR B 617 20.646 -14.082 4.362 1.00173.26 C
HETATM42765 C8 BCR B 617 20.185 -12.983 4.967 1.00173.20 C
HETATM42766 C9 BCR B 617 20.396 -11.639 4.457 1.00173.57 C
HETATM42767 C10 BCR B 617 19.399 -11.026 3.804 1.00174.54 C
HETATM42768 C11 BCR B 617 19.506 -9.739 3.157 1.00174.27 C
HETATM42769 C33 BCR B 617 18.304 -15.727 4.595 1.00173.25 C
HETATM42770 C31 BCR B 617 23.121 -15.519 4.639 1.00174.56 C
HETATM42771 C32 BCR B 617 22.267 -15.110 6.908 1.00173.18 C
HETATM42772 C34 BCR B 617 21.780 -11.132 4.398 1.00173.29 C
HETATM42773 C12 BCR B 617 18.477 -9.291 2.428 1.00174.06 C
HETATM42774 C13 BCR B 617 18.468 -8.047 1.690 1.00173.86 C
HETATM42775 C14 BCR B 617 17.452 -7.782 0.858 1.00174.24 C
HETATM42776 C15 BCR B 617 17.474 -6.706 -0.099 1.00173.67 C
HETATM42777 C16 BCR B 617 16.353 -6.273 -0.690 1.00173.12 C
HETATM42778 C17 BCR B 617 16.486 -5.247 -1.690 1.00173.07 C
HETATM42779 C18 BCR B 617 15.492 -4.619 -2.327 1.00173.45 C
HETATM42780 C19 BCR B 617 15.825 -3.628 -3.332 1.00174.00 C
HETATM42781 C20 BCR B 617 14.920 -3.031 -4.109 1.00174.28 C
HETATM42782 C21 BCR B 617 15.375 -2.263 -5.245 1.00174.53 C
HETATM42783 C22 BCR B 617 14.603 -1.668 -6.165 1.00174.76 C
HETATM42784 C23 BCR B 617 15.248 -1.038 -7.312 1.00174.40 C
HETATM42785 C24 BCR B 617 14.822 0.106 -7.854 1.00173.15 C
HETATM42786 C25 BCR B 617 15.421 0.791 -8.996 1.00172.58 C
HETATM42787 C26 BCR B 617 14.816 0.796 -10.182 1.00173.25 C
HETATM42788 C27 BCR B 617 15.327 1.471 -11.390 1.00174.04 C
HETATM42789 C28 BCR B 617 16.071 2.716 -10.986 1.00173.86 C
HETATM42790 C29 BCR B 617 17.143 2.374 -9.982 1.00173.14 C
HETATM42791 C30 BCR B 617 16.725 1.497 -8.802 1.00172.60 C
HETATM42792 C35 BCR B 617 19.637 -7.148 1.743 1.00173.43 C
HETATM42793 C36 BCR B 617 14.081 -4.812 -1.951 1.00173.26 C
HETATM42794 C37 BCR B 617 13.167 -1.418 -5.915 1.00174.37 C
HETATM42795 C38 BCR B 617 13.527 0.119 -10.411 1.00173.79 C
HETATM42796 C39 BCR B 617 16.678 2.287 -7.508 1.00172.96 C
HETATM42797 C40 BCR B 617 17.877 0.514 -8.664 1.00173.33 C
HETATM42798 C1 BCR B 618 12.990 11.051 -5.823 1.00172.05 C
HETATM42799 C2 BCR B 618 12.232 11.873 -6.852 1.00172.62 C
HETATM42800 C3 BCR B 618 10.754 11.604 -6.839 1.00171.71 C
HETATM42801 C4 BCR B 618 10.476 10.138 -7.028 1.00171.83 C
HETATM42802 C5 BCR B 618 11.246 9.332 -6.060 1.00172.53 C
HETATM42803 C6 BCR B 618 12.388 9.725 -5.500 1.00172.70 C
HETATM42804 C7 BCR B 618 13.109 8.896 -4.533 1.00174.06 C
HETATM42805 C8 BCR B 618 13.869 7.858 -4.891 1.00174.22 C
HETATM42806 C9 BCR B 618 14.611 7.059 -3.935 1.00174.06 C
HETATM42807 C10 BCR B 618 15.162 5.898 -4.313 1.00173.50 C
HETATM42808 C11 BCR B 618 15.884 5.028 -3.418 1.00171.94 C
HETATM42809 C33 BCR B 618 10.625 8.031 -5.747 1.00173.82 C
HETATM42810 C31 BCR B 618 13.090 11.902 -4.575 1.00172.02 C
HETATM42811 C32 BCR B 618 14.386 10.853 -6.373 1.00172.91 C
HETATM42812 C34 BCR B 618 14.708 7.542 -2.545 1.00174.18 C
HETATM42813 C12 BCR B 618 16.399 3.888 -3.885 1.00172.16 C
HETATM42814 C13 BCR B 618 17.185 2.971 -3.095 1.00172.60 C
HETATM42815 C14 BCR B 618 17.573 1.807 -3.631 1.00173.05 C
HETATM42816 C15 BCR B 618 18.416 0.856 -2.953 1.00172.46 C
HETATM42817 C16 BCR B 618 18.686 -0.333 -3.505 1.00171.57 C
HETATM42818 C17 BCR B 618 19.493 -1.267 -2.766 1.00171.19 C
HETATM42819 C18 BCR B 618 19.841 -2.494 -3.165 1.00171.89 C
HETATM42820 C19 BCR B 618 20.721 -3.285 -2.326 1.00172.88 C
HETATM42821 C20 BCR B 618 20.951 -4.578 -2.555 1.00173.64 C
HETATM42822 C21 BCR B 618 21.913 -5.289 -1.747 1.00174.27 C
HETATM42823 C22 BCR B 618 22.163 -6.601 -1.831 1.00174.65 C
HETATM42824 C23 BCR B 618 23.194 -7.188 -0.984 1.00174.52 C
HETATM42825 C24 BCR B 618 23.292 -8.507 -0.793 1.00174.15 C
HETATM42826 C25 BCR B 618 24.275 -9.187 0.045 1.00173.50 C
HETATM42827 C26 BCR B 618 24.132 -9.255 1.367 1.00172.81 C
HETATM42828 C27 BCR B 618 25.058 -9.927 2.294 1.00172.19 C
HETATM42829 C28 BCR B 618 26.475 -9.956 1.776 1.00172.38 C
HETATM42830 C29 BCR B 618 26.603 -10.178 0.285 1.00172.92 C
HETATM42831 C30 BCR B 618 25.425 -9.852 -0.632 1.00173.41 C
HETATM42832 C35 BCR B 618 17.587 3.341 -1.725 1.00173.53 C
HETATM42833 C36 BCR B 618 19.313 -3.090 -4.404 1.00172.68 C
HETATM42834 C37 BCR B 618 21.389 -7.469 -2.744 1.00174.25 C
HETATM42835 C38 BCR B 618 23.002 -8.628 2.076 1.00172.85 C
HETATM42836 C39 BCR B 618 24.917 -11.099 -1.332 1.00173.64 C
HETATM42837 C40 BCR B 618 26.022 -8.967 -1.720 1.00173.39 C
HETATM42838 C1 BCR B 619 39.083 -1.525 -2.036 1.00173.33 C
HETATM42839 C2 BCR B 619 40.318 -1.788 -2.880 1.00173.22 C
HETATM42840 C3 BCR B 619 41.531 -1.116 -2.309 1.00173.50 C
HETATM42841 C4 BCR B 619 41.776 -1.647 -0.924 1.00173.69 C
HETATM42842 C5 BCR B 619 40.577 -1.427 -0.088 1.00174.07 C
HETATM42843 C6 BCR B 619 39.338 -1.376 -0.574 1.00173.87 C
HETATM42844 C7 BCR B 619 38.171 -1.141 0.278 1.00173.89 C
HETATM42845 C8 BCR B 619 37.560 -2.108 0.968 1.00174.43 C
HETATM42846 C9 BCR B 619 36.441 -1.844 1.854 1.00174.66 C
HETATM42847 C10 BCR B 619 36.058 -2.766 2.747 1.00174.57 C
HETATM42848 C11 BCR B 619 34.934 -2.617 3.640 1.00174.07 C
HETATM42849 C33 BCR B 619 40.867 -1.267 1.349 1.00174.84 C
HETATM42850 C31 BCR B 619 38.120 -2.662 -2.313 1.00173.37 C
HETATM42851 C32 BCR B 619 38.482 -0.236 -2.550 1.00173.15 C
HETATM42852 C34 BCR B 619 35.675 -0.599 1.644 1.00173.96 C
HETATM42853 C12 BCR B 619 34.584 -3.646 4.418 1.00173.09 C
HETATM42854 C13 BCR B 619 33.382 -3.701 5.215 1.00172.81 C
HETATM42855 C14 BCR B 619 33.156 -4.780 5.976 1.00173.77 C
HETATM42856 C15 BCR B 619 32.011 -4.952 6.835 1.00174.94 C
HETATM42857 C16 BCR B 619 31.914 -6.034 7.622 1.00175.18 C
HETATM42858 C17 BCR B 619 30.737 -6.231 8.429 1.00174.68 C
HETATM42859 C18 BCR B 619 30.491 -7.283 9.220 1.00173.99 C
HETATM42860 C19 BCR B 619 29.256 -7.331 9.978 1.00173.59 C
HETATM42861 C20 BCR B 619 28.921 -8.382 10.727 1.00173.39 C
HETATM42862 C21 BCR B 619 27.671 -8.368 11.448 1.00174.00 C
HETATM42863 C22 BCR B 619 27.183 -9.375 12.185 1.00173.40 C
HETATM42864 C23 BCR B 619 25.819 -9.286 12.688 1.00173.42 C
HETATM42865 C24 BCR B 619 25.170 -10.327 13.215 1.00172.93 C
HETATM42866 C25 BCR B 619 23.822 -10.273 13.769 1.00172.89 C
HETATM42867 C26 BCR B 619 23.607 -9.882 15.026 1.00173.15 C
HETATM42868 C27 BCR B 619 22.293 -9.787 15.701 1.00173.67 C
HETATM42869 C28 BCR B 619 21.153 -9.801 14.713 1.00173.30 C
HETATM42870 C29 BCR B 619 21.397 -10.856 13.665 1.00173.38 C
HETATM42871 C30 BCR B 619 22.691 -10.679 12.887 1.00173.40 C
HETATM42872 C35 BCR B 619 32.415 -2.589 5.159 1.00172.44 C
HETATM42873 C36 BCR B 619 31.446 -8.394 9.365 1.00173.54 C
HETATM42874 C37 BCR B 619 28.006 -10.558 12.512 1.00173.05 C
HETATM42875 C38 BCR B 619 24.711 -9.481 15.919 1.00174.17 C
HETATM42876 C39 BCR B 619 22.521 -9.689 11.749 1.00174.66 C
HETATM42877 C40 BCR B 619 22.958 -12.033 12.244 1.00173.42 C
HETATM42878 C1A DGD B 620 27.755 33.631 -10.718 1.00172.92 C
HETATM42879 C2A DGD B 620 27.865 34.710 -9.697 1.00172.51 C
HETATM42880 C3A DGD B 620 27.214 34.262 -8.389 1.00172.59 C
HETATM42881 C4A DGD B 620 27.317 35.359 -7.331 1.00172.83 C
HETATM42882 C5A DGD B 620 26.471 34.967 -6.124 1.00173.44 C
HETATM42883 C6A DGD B 620 26.752 35.858 -4.929 1.00173.20 C
HETATM42884 C7A DGD B 620 25.484 35.793 -4.085 1.00173.44 C
HETATM42885 C8A DGD B 620 25.811 35.997 -2.621 1.00173.46 C
HETATM42886 C9A DGD B 620 24.492 36.141 -1.880 1.00173.81 C
HETATM42887 CAA DGD B 620 24.373 35.003 -0.898 1.00173.43 C
HETATM42888 CBA DGD B 620 22.974 35.049 -0.297 1.00173.18 C
HETATM42889 CCA DGD B 620 22.769 33.741 0.423 1.00172.59 C
HETATM42890 CDA DGD B 620 21.316 33.705 0.875 1.00172.18 C
HETATM42891 CEA DGD B 620 21.083 32.392 1.578 1.00172.50 C
HETATM42892 CFA DGD B 620 20.798 31.315 0.556 1.00171.50 C
HETATM42893 O1A DGD B 620 27.305 32.507 -10.587 1.00173.55 O
HETATM42894 C1B DGD B 620 30.163 31.420 -11.305 1.00174.23 C
HETATM42895 C2B DGD B 620 30.315 30.062 -10.689 1.00173.91 C
HETATM42896 C3B DGD B 620 29.032 29.597 -10.040 1.00173.81 C
HETATM42897 C4B DGD B 620 29.142 29.640 -8.518 1.00173.24 C
HETATM42898 C5B DGD B 620 28.072 28.674 -8.038 1.00173.48 C
HETATM42899 C6B DGD B 620 27.036 29.511 -7.292 1.00173.11 C
HETATM42900 C7B DGD B 620 25.924 29.739 -8.291 1.00173.21 C
HETATM42901 C8B DGD B 620 24.664 29.357 -7.579 1.00173.29 C
HETATM42902 C9B DGD B 620 24.081 28.209 -8.337 1.00173.79 C
HETATM42903 CAB DGD B 620 23.356 28.853 -9.479 1.00173.59 C
HETATM42904 CBB DGD B 620 22.865 27.678 -10.241 1.00172.46 C
HETATM42905 CCB DGD B 620 21.963 28.206 -11.309 1.00172.14 C
HETATM42906 CDB DGD B 620 20.909 27.144 -11.312 1.00171.74 C
HETATM42907 O1B DGD B 620 30.775 32.419 -10.968 1.00174.37 O
HETATM42908 O1G DGD B 620 28.482 33.968 -11.820 1.00172.70 O
HETATM42909 C1G DGD B 620 28.240 33.290 -13.026 1.00172.78 C
HETATM42910 C2G DGD B 620 29.515 32.485 -13.353 1.00173.13 C
HETATM42911 O2G DGD B 620 29.550 31.348 -12.522 1.00173.93 O
HETATM42912 C3G DGD B 620 29.340 31.953 -14.796 1.00173.24 C
HETATM42913 O3G DGD B 620 29.300 33.144 -15.570 1.00173.33 O
HETATM42914 C1D DGD B 620 28.483 33.016 -16.699 1.00173.63 C
HETATM42915 C2D DGD B 620 28.625 34.320 -17.530 1.00172.39 C
HETATM42916 O2D DGD B 620 27.950 35.299 -16.809 1.00172.52 O
HETATM42917 C3D DGD B 620 27.830 34.053 -18.837 1.00172.16 C
HETATM42918 O3D DGD B 620 27.986 35.145 -19.689 1.00172.67 O
HETATM42919 C4D DGD B 620 28.440 32.814 -19.555 1.00172.43 C
HETATM42920 O4D DGD B 620 29.788 33.012 -19.830 1.00171.59 O
HETATM42921 C5D DGD B 620 28.352 31.629 -18.552 1.00174.06 C
HETATM42922 O5D DGD B 620 29.848 30.659 -20.100 1.00174.49 O
HETATM42923 C6D DGD B 620 28.972 30.303 -19.061 1.00174.48 C
HETATM42924 O6D DGD B 620 29.072 31.932 -17.384 1.00174.20 O
HETATM42925 C1E DGD B 620 30.707 29.630 -20.517 1.00174.60 C
HETATM42926 C2E DGD B 620 32.192 30.058 -20.304 1.00174.45 C
HETATM42927 O2E DGD B 620 32.329 30.396 -18.961 1.00173.76 O
HETATM42928 C3E DGD B 620 32.497 31.280 -21.185 1.00175.30 C
HETATM42929 O3E DGD B 620 33.856 31.550 -21.008 1.00175.66 O
HETATM42930 C4E DGD B 620 32.246 30.861 -22.651 1.00175.68 C
HETATM42931 O4E DGD B 620 33.045 29.764 -22.964 1.00175.86 O
HETATM42932 C5E DGD B 620 30.770 30.417 -22.786 1.00175.65 C
HETATM42933 O6E DGD B 620 30.425 29.393 -21.875 1.00175.36 O
HETATM42934 C6E DGD B 620 30.487 29.760 -24.158 1.00175.48 C
HETATM42935 O5E DGD B 620 29.515 30.564 -24.765 1.00176.17 O
HETATM42936 C1 LMG B 621 10.215 7.007 -18.639 1.00173.78 C
HETATM42937 O1 LMG B 621 10.493 7.773 -17.491 1.00174.05 O
HETATM42938 C2 LMG B 621 9.528 7.954 -19.640 1.00173.78 C
HETATM42939 O2 LMG B 621 8.310 8.291 -19.043 1.00173.71 O
HETATM42940 C3 LMG B 621 9.225 7.073 -20.874 1.00173.57 C
HETATM42941 O3 LMG B 621 8.629 7.929 -21.805 1.00173.82 O
HETATM42942 C4 LMG B 621 10.559 6.509 -21.446 1.00173.41 C
HETATM42943 O4 LMG B 621 11.317 7.563 -21.942 1.00173.49 O
HETATM42944 C5 LMG B 621 11.353 5.826 -20.276 1.00173.77 C
HETATM42945 O5 LMG B 621 13.447 4.944 -19.671 1.00174.62 O
HETATM42946 C6 LMG B 621 12.764 5.452 -20.781 1.00174.10 C
HETATM42947 O6 LMG B 621 11.487 6.675 -19.159 1.00173.81 O
HETATM42948 C7 LMG B 621 10.479 7.009 -16.300 1.00174.11 C
HETATM42949 C8 LMG B 621 9.973 7.949 -15.165 1.00174.23 C
HETATM42950 C9 LMG B 621 11.100 8.927 -14.811 1.00173.96 C
HETATM42951 O7 LMG B 621 8.902 8.740 -15.662 1.00174.54 O
HETATM42952 C10 LMG B 621 7.800 8.900 -14.873 1.00173.74 C
HETATM42953 O9 LMG B 621 6.807 8.220 -15.100 1.00173.75 O
HETATM42954 C11 LMG B 621 7.864 10.137 -14.027 1.00173.09 C
HETATM42955 C12 LMG B 621 6.810 10.113 -12.936 1.00173.42 C
HETATM42956 C13 LMG B 621 7.339 10.631 -11.604 1.00174.03 C
HETATM42957 C14 LMG B 621 6.176 10.609 -10.622 1.00174.06 C
HETATM42958 C15 LMG B 621 6.704 10.368 -9.222 1.00173.84 C
HETATM42959 C16 LMG B 621 5.794 9.370 -8.523 1.00173.83 C
HETATM42960 C17 LMG B 621 6.371 9.108 -7.148 1.00174.35 C
HETATM42961 C18 LMG B 621 5.947 7.702 -6.755 1.00174.49 C
HETATM42962 C19 LMG B 621 6.347 7.483 -5.314 1.00174.20 C
HETATM42963 C20 LMG B 621 6.815 6.052 -5.227 1.00174.43 C
HETATM42964 C21 LMG B 621 7.290 5.818 -3.819 1.00174.64 C
HETATM42965 C22 LMG B 621 7.415 4.327 -3.688 1.00174.36 C
HETATM42966 C23 LMG B 621 8.083 4.060 -2.368 1.00174.27 C
HETATM42967 O8 LMG B 621 11.380 8.701 -13.447 1.00173.39 O
HETATM42968 C28 LMG B 621 12.535 9.223 -12.972 1.00173.82 C
HETATM42969 O10 LMG B 621 13.347 9.702 -13.754 1.00173.99 O
HETATM42970 C29 LMG B 621 12.518 9.454 -11.497 1.00174.52 C
HETATM42971 C30 LMG B 621 13.760 10.202 -11.055 1.00174.50 C
HETATM42972 C31 LMG B 621 13.481 11.687 -11.144 1.00173.56 C
HETATM42973 C32 LMG B 621 14.801 12.401 -10.891 1.00172.90 C
HETATM42974 C33 LMG B 621 14.531 13.884 -11.012 1.00172.60 C
HETATM42975 C34 LMG B 621 14.749 14.520 -9.655 1.00172.09 C
HETATM42976 C35 LMG B 621 14.094 15.895 -9.718 1.00172.61 C
HETATM42977 C36 LMG B 621 14.210 16.496 -8.347 1.00172.42 C
HETATM42978 C37 LMG B 621 12.939 16.160 -7.604 1.00172.98 C
HETATM42979 C38 LMG B 621 12.842 17.257 -6.588 1.00173.31 C
HETATM42980 C39 LMG B 621 11.418 17.339 -6.116 1.00174.11 C
HETATM42981 C40 LMG B 621 11.500 18.328 -4.990 1.00173.45 C
HETATM42982 C41 LMG B 621 10.140 18.442 -4.365 1.00173.50 C
HETATM42983 C42 LMG B 621 10.406 19.218 -3.104 1.00173.92 C
HETATM42984 C43 LMG B 621 9.133 19.280 -2.302 1.00174.87 C
HETATM42985 C1B LMT B 622 47.199 -3.335 -12.589 1.00176.97 C
HETATM42986 C2B LMT B 622 48.734 -3.197 -12.652 1.00177.20 C
HETATM42987 C3B LMT B 622 49.146 -1.900 -13.382 1.00177.01 C
HETATM42988 C4B LMT B 622 48.407 -1.767 -14.736 1.00176.70 C
HETATM42989 C5B LMT B 622 46.904 -1.944 -14.461 1.00176.98 C
HETATM42990 C6B LMT B 622 46.110 -1.782 -15.752 1.00176.18 C
HETATM42991 O1B LMT B 622 46.697 -2.378 -11.720 1.00177.34 O
HETATM42992 O2B LMT B 622 49.195 -3.197 -11.355 1.00176.01 O
HETATM42993 O3B LMT B 622 50.507 -1.798 -13.515 1.00176.97 O
HETATM42994 O4' LMT B 622 48.636 -0.532 -15.299 1.00175.88 O
HETATM42995 O5B LMT B 622 46.622 -3.182 -13.852 1.00176.82 O
HETATM42996 O6B LMT B 622 44.764 -1.899 -15.494 1.00175.40 O
HETATM42997 C1' LMT B 622 44.151 -1.543 -8.662 1.00175.88 C
HETATM42998 C2' LMT B 622 45.382 -2.347 -8.212 1.00176.86 C
HETATM42999 C3' LMT B 622 46.432 -2.389 -9.358 1.00176.97 C
HETATM43000 C4' LMT B 622 45.807 -2.796 -10.710 1.00176.98 C
HETATM43001 C5' LMT B 622 44.502 -1.978 -10.883 1.00176.22 C
HETATM43002 C6' LMT B 622 43.778 -2.249 -12.177 1.00175.14 C
HETATM43003 O1' LMT B 622 43.178 -1.565 -7.703 1.00175.35 O
HETATM43004 O2' LMT B 622 45.938 -1.721 -7.125 1.00177.58 O
HETATM43005 O3' LMT B 622 47.450 -3.244 -9.042 1.00176.51 O
HETATM43006 O5' LMT B 622 43.622 -2.180 -9.808 1.00176.13 O
HETATM43007 O6' LMT B 622 42.785 -1.305 -12.260 1.00175.53 O
HETATM43008 C1 LMT B 622 42.202 -0.555 -7.838 1.00174.24 C
HETATM43009 C2 LMT B 622 41.544 -0.459 -6.495 1.00173.86 C
HETATM43010 C3 LMT B 622 42.027 0.631 -5.600 1.00173.74 C
HETATM43011 C4 LMT B 622 40.880 1.579 -5.376 1.00173.62 C
HETATM43012 C5 LMT B 622 41.242 2.567 -4.321 1.00173.78 C
HETATM43013 C6 LMT B 622 40.038 3.225 -3.735 1.00173.61 C
HETATM43014 C7 LMT B 622 40.337 3.682 -2.338 1.00174.30 C
HETATM43015 C8 LMT B 622 39.117 4.311 -1.762 1.00174.47 C
HETATM43016 C9 LMT B 622 39.210 4.587 -0.295 1.00175.01 C
HETATM43017 C10 LMT B 622 39.191 3.261 0.412 1.00174.01 C
HETATM43018 C11 LMT B 622 38.976 3.430 1.881 1.00173.00 C
HETATM43019 C12 LMT B 622 38.871 2.118 2.580 1.00171.65 C
HETATM43020 C1B LMT B 623 29.392 37.283 29.403 1.00174.92 C
HETATM43021 C2B LMT B 623 29.910 36.642 30.715 1.00176.54 C
HETATM43022 C3B LMT B 623 28.743 36.102 31.565 1.00177.65 C
HETATM43023 C4B LMT B 623 27.679 37.203 31.766 1.00177.21 C
HETATM43024 C5B LMT B 623 27.274 37.705 30.370 1.00175.57 C
HETATM43025 C6B LMT B 623 26.173 38.753 30.499 1.00174.55 C
HETATM43026 O1B LMT B 623 28.942 36.307 28.512 1.00174.63 O
HETATM43027 O2B LMT B 623 30.791 35.633 30.393 1.00176.33 O
HETATM43028 O3B LMT B 623 29.179 35.568 32.751 1.00177.94 O
HETATM43029 O4' LMT B 623 26.577 36.705 32.426 1.00177.05 O
HETATM43030 O5B LMT B 623 28.375 38.216 29.651 1.00174.60 O
HETATM43031 O6B LMT B 623 25.602 38.997 29.273 1.00173.11 O
HETATM43032 C1' LMT B 623 30.142 34.496 24.950 1.00176.22 C
HETATM43033 C2' LMT B 623 30.584 33.779 26.251 1.00176.10 C
HETATM43034 C3' LMT B 623 29.794 34.330 27.473 1.00175.49 C
HETATM43035 C4' LMT B 623 29.832 35.868 27.504 1.00175.16 C
HETATM43036 C5' LMT B 623 29.305 36.294 26.118 1.00175.22 C
HETATM43037 C6' LMT B 623 29.007 37.761 25.964 1.00174.73 C
HETATM43038 O1' LMT B 623 30.985 34.197 23.915 1.00175.44 O
HETATM43039 O2' LMT B 623 30.312 32.437 26.127 1.00175.52 O
HETATM43040 O3' LMT B 623 30.281 33.817 28.641 1.00174.47 O
HETATM43041 O5' LMT B 623 30.220 35.900 25.133 1.00175.85 O
HETATM43042 O6' LMT B 623 28.832 37.962 24.618 1.00175.29 O
HETATM43043 C1 LMT B 623 30.524 34.618 22.649 1.00173.95 C
HETATM43044 C2 LMT B 623 31.562 34.152 21.669 1.00173.95 C
HETATM43045 C3 LMT B 623 31.306 34.488 20.236 1.00174.04 C
HETATM43046 C4 LMT B 623 32.507 34.072 19.425 1.00174.77 C
HETATM43047 C5 LMT B 623 32.267 34.385 17.985 1.00174.92 C
HETATM43048 C6 LMT B 623 33.487 34.217 17.139 1.00174.54 C
HETATM43049 C7 LMT B 623 33.181 34.676 15.742 1.00173.79 C
HETATM43050 C8 LMT B 623 34.456 34.914 15.011 1.00173.41 C
HETATM43051 C9 LMT B 623 34.346 35.925 13.916 1.00173.77 C
HETATM43052 C10 LMT B 623 35.556 35.773 13.041 1.00174.35 C
HETATM43053 C11 LMT B 623 35.680 36.903 12.070 1.00173.75 C
HETATM43054 C12 LMT B 623 36.632 36.579 10.968 1.00173.39 C
HETATM43055 C1 LMG B 624 7.197 21.351 14.862 1.00174.58 C
HETATM43056 O1 LMG B 624 7.819 21.904 13.726 1.00174.70 O
HETATM43057 C2 LMG B 624 7.895 22.035 16.083 1.00173.98 C
HETATM43058 O2 LMG B 624 9.115 21.362 16.212 1.00173.89 O
HETATM43059 C3 LMG B 624 7.060 21.727 17.358 1.00174.99 C
HETATM43060 O3 LMG B 624 7.617 22.524 18.366 1.00175.38 O
HETATM43061 C4 LMG B 624 5.585 22.126 17.132 1.00174.31 C
HETATM43062 O4 LMG B 624 5.524 23.497 16.891 1.00172.97 O
HETATM43063 C5 LMG B 624 5.106 21.394 15.860 1.00174.02 C
HETATM43064 O5 LMG B 624 3.058 21.976 16.855 1.00172.69 O
HETATM43065 C6 LMG B 624 3.632 21.748 15.603 1.00173.49 C
HETATM43066 O6 LMG B 624 5.858 21.801 14.752 1.00174.96 O
HETATM43067 C7 LMG B 624 8.153 20.954 12.739 1.00174.22 C
HETATM43068 C8 LMG B 624 7.726 21.574 11.379 1.00173.27 C
HETATM43069 C9 LMG B 624 6.548 20.765 10.816 1.00173.24 C
HETATM43070 O7 LMG B 624 7.219 22.871 11.619 1.00173.10 O
HETATM43071 C10 LMG B 624 7.697 23.890 10.857 1.00172.90 C
HETATM43072 O9 LMG B 624 8.588 24.600 11.304 1.00173.28 O
HETATM43073 C11 LMG B 624 6.863 24.144 9.640 1.00172.46 C
HETATM43074 C12 LMG B 624 7.695 24.792 8.549 1.00172.95 C
HETATM43075 C13 LMG B 624 7.139 24.525 7.156 1.00173.84 C
HETATM43076 C14 LMG B 624 8.264 24.796 6.165 1.00173.59 C
HETATM43077 C15 LMG B 624 7.954 24.108 4.851 1.00173.31 C
HETATM43078 C16 LMG B 624 9.260 23.738 4.169 1.00172.47 C
HETATM43079 C17 LMG B 624 8.937 22.721 3.101 1.00171.83 C
HETATM43080 C18 LMG B 624 9.987 21.630 3.204 1.00172.38 C
HETATM43081 C19 LMG B 624 9.336 20.329 2.802 1.00172.71 C
HETATM43082 C20 LMG B 624 8.878 19.677 4.078 1.00174.41 C
HETATM43083 C21 LMG B 624 9.806 18.524 4.354 1.00174.44 C
HETATM43084 C22 LMG B 624 9.988 18.541 5.840 1.00174.18 C
HETATM43085 C23 LMG B 624 10.117 17.117 6.293 1.00172.51 C
HETATM43086 C24 LMG B 624 10.184 17.228 7.791 1.00172.49 C
HETATM43087 C25 LMG B 624 10.174 15.839 8.362 1.00173.41 C
HETATM43088 O8 LMG B 624 7.123 19.666 10.141 1.00173.33 O
HETATM43089 C28 LMG B 624 6.334 19.030 9.240 1.00174.03 C
HETATM43090 O10 LMG B 624 5.885 17.924 9.513 1.00174.55 O
HETATM43091 C29 LMG B 624 6.363 19.647 7.874 1.00173.94 C
HETATM43092 C30 LMG B 624 5.253 19.102 6.986 1.00173.13 C
HETATM43093 C31 LMG B 624 5.866 18.069 6.057 1.00173.05 C
HETATM43094 C32 LMG B 624 5.045 18.029 4.770 1.00172.74 C
HETATM43095 C33 LMG B 624 4.727 16.569 4.495 1.00172.60 C
HETATM43096 C34 LMG B 624 5.320 16.189 3.152 1.00172.82 C
HETATM43097 C35 LMG B 624 4.277 15.333 2.440 1.00172.46 C
HETATM43098 C36 LMG B 624 5.011 14.570 1.378 1.00172.28 C
HETATM43099 C37 LMG B 624 4.090 13.490 0.869 1.00172.66 C
HETATM43100 C38 LMG B 624 4.861 12.934 -0.287 1.00172.81 C
HETATM43101 C39 LMG B 624 4.840 11.433 -0.216 1.00173.94 C
HETATM43102 C40 LMG B 624 5.456 11.044 -1.529 1.00173.44 C
HETATM43103 C41 LMG B 624 5.532 9.546 -1.606 1.00173.99 C
HETATM43104 C1A DGD B 625 36.582 -10.769 -8.145 1.00173.47 C
HETATM43105 C2A DGD B 625 35.263 -11.179 -7.597 1.00173.52 C
HETATM43106 C3A DGD B 625 35.205 -10.935 -6.098 1.00174.78 C
HETATM43107 C4A DGD B 625 34.433 -9.655 -5.825 1.00175.38 C
HETATM43108 C5A DGD B 625 34.883 -9.064 -4.504 1.00176.39 C
HETATM43109 C6A DGD B 625 34.478 -7.612 -4.412 1.00175.32 C
HETATM43110 C7A DGD B 625 35.764 -6.855 -4.140 1.00175.82 C
HETATM43111 C8A DGD B 625 36.424 -6.469 -5.444 1.00175.68 C
HETATM43112 C9A DGD B 625 37.674 -5.678 -5.096 1.00174.88 C
HETATM43113 O1A DGD B 625 37.486 -10.156 -7.602 1.00173.12 O
HETATM43114 C1B DGD B 625 35.274 -11.028 -12.660 1.00175.94 C
HETATM43115 C2B DGD B 625 34.437 -11.569 -11.537 1.00175.51 C
HETATM43116 C3B DGD B 625 33.021 -11.901 -11.998 1.00174.18 C
HETATM43117 C4B DGD B 625 32.315 -12.831 -11.004 1.00173.83 C
HETATM43118 C5B DGD B 625 31.404 -11.923 -10.186 1.00174.18 C
HETATM43119 C6B DGD B 625 30.595 -12.831 -9.252 1.00174.70 C
HETATM43120 C7B DGD B 625 30.099 -11.924 -8.141 1.00175.21 C
HETATM43121 C8B DGD B 625 30.765 -12.422 -6.887 1.00174.77 C
HETATM43122 C9B DGD B 625 29.986 -11.867 -5.730 1.00174.68 C
HETATM43123 CAB DGD B 625 30.786 -12.283 -4.527 1.00173.39 C
HETATM43124 CBB DGD B 625 29.787 -12.278 -3.426 1.00172.52 C
HETATM43125 CCB DGD B 625 30.115 -11.107 -2.550 1.00172.34 C
HETATM43126 CDB DGD B 625 29.635 -11.619 -1.230 1.00172.09 C
HETATM43127 O1B DGD B 625 34.837 -10.715 -13.755 1.00175.12 O
HETATM43128 O1G DGD B 625 36.700 -11.237 -9.417 1.00173.92 O
HETATM43129 C1G DGD B 625 37.780 -10.814 -10.207 1.00174.73 C
HETATM43130 C2G DGD B 625 37.481 -11.257 -11.669 1.00175.62 C
HETATM43131 O2G DGD B 625 36.447 -10.450 -12.206 1.00176.84 O
HETATM43132 C3G DGD B 625 38.814 -11.012 -12.460 1.00175.02 C
HETATM43133 O3G DGD B 625 38.444 -10.115 -13.504 1.00176.55 O
HETATM43134 C1D DGD B 625 38.765 -10.600 -14.788 1.00177.17 C
HETATM43135 C2D DGD B 625 37.646 -10.135 -15.748 1.00177.15 C
HETATM43136 O2D DGD B 625 36.475 -10.744 -15.311 1.00176.31 O
HETATM43137 C3D DGD B 625 38.022 -10.777 -17.092 1.00176.74 C
HETATM43138 O3D DGD B 625 37.085 -10.380 -18.055 1.00174.33 O
HETATM43139 C4D DGD B 625 39.407 -10.228 -17.547 1.00175.91 C
HETATM43140 O4D DGD B 625 39.332 -8.868 -17.849 1.00174.47 O
HETATM43141 C5D DGD B 625 40.477 -10.384 -16.401 1.00176.89 C
HETATM43142 O5D DGD B 625 42.501 -9.352 -15.589 1.00177.26 O
HETATM43143 C6D DGD B 625 41.730 -9.529 -16.750 1.00176.48 C
HETATM43144 O6D DGD B 625 39.990 -9.942 -15.130 1.00177.14 O
HETATM43145 C1E DGD B 625 42.964 -8.029 -15.411 1.00177.32 C
HETATM43146 C2E DGD B 625 44.438 -7.801 -15.995 1.00177.09 C
HETATM43147 O2E DGD B 625 44.513 -8.347 -17.284 1.00175.78 O
HETATM43148 C3E DGD B 625 45.520 -8.447 -15.083 1.00176.04 C
HETATM43149 O3E DGD B 625 46.746 -7.925 -15.511 1.00175.32 O
HETATM43150 C4E DGD B 625 45.263 -8.006 -13.621 1.00175.45 C
HETATM43151 O4E DGD B 625 45.310 -6.615 -13.537 1.00174.67 O
HETATM43152 C5E DGD B 625 43.834 -8.444 -13.249 1.00175.71 C
HETATM43153 O6E DGD B 625 42.891 -7.775 -14.036 1.00176.72 O
HETATM43154 C6E DGD B 625 43.433 -8.027 -11.817 1.00174.79 C
HETATM43155 O5E DGD B 625 42.371 -8.876 -11.477 1.00174.26 O
HETATM43156 O6 SQD B 626 14.675 -5.847 17.423 1.00176.11 O
HETATM43157 C44 SQD B 626 14.549 -4.578 16.808 1.00175.34 C
HETATM43158 C45 SQD B 626 13.710 -4.627 15.523 1.00174.74 C
HETATM43159 C46 SQD B 626 12.261 -5.035 15.804 1.00174.78 C
HETATM43160 O47 SQD B 626 13.741 -3.381 14.848 1.00174.94 O
HETATM43161 C7 SQD B 626 14.109 -3.297 13.481 1.00175.34 C
HETATM43162 O49 SQD B 626 14.877 -4.117 13.010 1.00175.50 O
HETATM43163 C8 SQD B 626 13.284 -2.423 12.536 1.00175.03 C
HETATM43164 C9 SQD B 626 12.749 -3.284 11.391 1.00174.59 C
HETATM43165 C10 SQD B 626 11.971 -2.393 10.437 1.00174.12 C
HETATM43166 C11 SQD B 626 12.633 -2.431 9.057 1.00173.36 C
HETATM43167 C12 SQD B 626 11.670 -3.034 8.048 1.00173.55 C
HETATM43168 C13 SQD B 626 11.874 -2.363 6.689 1.00173.23 C
HETATM43169 C14 SQD B 626 12.803 -3.217 5.831 1.00173.19 C
HETATM43170 C15 SQD B 626 13.863 -2.332 5.189 1.00174.38 C
HETATM43171 C16 SQD B 626 14.761 -3.190 4.307 1.00175.00 C
HETATM43172 C17 SQD B 626 15.761 -2.307 3.557 1.00174.28 C
HETATM43173 C18 SQD B 626 16.230 -3.052 2.301 1.00173.71 C
HETATM43174 C19 SQD B 626 17.519 -2.428 1.779 1.00173.46 C
HETATM43175 C20 SQD B 626 18.709 -3.062 2.464 1.00173.87 C
HETATM43176 C21 SQD B 626 19.973 -2.329 2.043 1.00174.05 C
HETATM43177 C22 SQD B 626 21.150 -3.265 2.124 1.00174.35 C
HETATM43178 O48 SQD B 626 11.924 -6.222 15.110 1.00174.34 O
HETATM43179 C23 SQD B 626 10.929 -6.161 14.099 1.00175.05 C
HETATM43180 O10 SQD B 626 9.824 -5.709 14.357 1.00175.58 O
HETATM43181 C24 SQD B 626 11.164 -6.906 12.790 1.00174.96 C
HETATM43182 C25 SQD B 626 10.201 -6.406 11.716 1.00174.71 C
HETATM43183 C26 SQD B 626 10.377 -7.266 10.455 1.00173.60 C
HETATM43184 C27 SQD B 626 9.743 -6.577 9.240 1.00173.41 C
HETATM43185 C28 SQD B 626 10.016 -7.430 7.993 1.00174.34 C
HETATM43186 C29 SQD B 626 9.780 -6.601 6.722 1.00174.45 C
HETATM43187 C30 SQD B 626 10.291 -7.385 5.510 1.00172.94 C
HETATM43188 C31 SQD B 626 10.153 -6.524 4.247 1.00170.91 C
HETATM43189 C1 SQD B 626 13.908 -6.035 18.602 1.00175.31 C
HETATM43190 C2 SQD B 626 13.922 -7.407 19.201 1.00174.45 C
HETATM43191 O2 SQD B 626 13.750 -8.363 18.233 1.00174.04 O
HETATM43192 C3 SQD B 626 12.770 -7.483 20.158 1.00174.15 C
HETATM43193 O3 SQD B 626 12.887 -8.649 20.879 1.00174.18 O
HETATM43194 C4 SQD B 626 12.652 -6.329 21.118 1.00174.22 C
HETATM43195 O4 SQD B 626 11.312 -6.133 21.381 1.00172.79 O
HETATM43196 C5 SQD B 626 13.235 -5.023 20.636 1.00174.72 C
HETATM43197 C6 SQD B 626 13.780 -4.257 21.825 1.00175.63 C
HETATM43198 O5 SQD B 626 14.193 -5.092 19.598 1.00175.43 O
HETATM43199 S SQD B 626 14.967 -3.009 21.354 1.00178.82 S
HETATM43200 O7 SQD B 626 16.239 -3.585 20.985 1.00177.39 O
HETATM43201 O8 SQD B 626 15.134 -2.035 22.454 1.00176.47 O
HETATM43202 O9 SQD B 626 14.593 -2.348 20.124 1.00176.06 O
HETATM43203 C1B LMT B 627 42.715 -11.698 -23.371 1.00176.96 C
HETATM43204 C2B LMT B 627 42.608 -10.208 -23.769 1.00176.82 C
HETATM43205 C3B LMT B 627 42.486 -10.043 -25.303 1.00176.95 C
HETATM43206 C4B LMT B 627 43.560 -10.878 -26.048 1.00177.25 C
HETATM43207 C5B LMT B 627 43.502 -12.310 -25.493 1.00177.05 C
HETATM43208 C6B LMT B 627 44.506 -13.201 -26.216 1.00175.88 C
HETATM43209 O1B LMT B 627 41.484 -12.327 -23.576 1.00177.30 O
HETATM43210 O2B LMT B 627 41.507 -9.688 -23.133 1.00176.61 O
HETATM43211 O3B LMT B 627 42.500 -8.721 -25.674 1.00176.21 O
HETATM43212 O4' LMT B 627 43.310 -10.896 -27.401 1.00176.56 O
HETATM43213 O5B LMT B 627 43.719 -12.334 -24.105 1.00177.58 O
HETATM43214 O6B LMT B 627 44.476 -14.472 -25.684 1.00174.55 O
HETATM43215 C1' LMT B 627 41.157 -14.017 -19.804 1.00175.38 C
HETATM43216 C2' LMT B 627 41.786 -14.957 -20.852 1.00175.23 C
HETATM43217 C3' LMT B 627 42.170 -14.157 -22.126 1.00176.04 C
HETATM43218 C4' LMT B 627 41.008 -13.266 -22.619 1.00176.57 C
HETATM43219 C5' LMT B 627 40.475 -12.500 -21.383 1.00176.05 C
HETATM43220 C6' LMT B 627 39.364 -11.533 -21.694 1.00175.60 C
HETATM43221 O1' LMT B 627 40.692 -14.730 -18.735 1.00175.28 O
HETATM43222 O2' LMT B 627 42.923 -15.508 -20.322 1.00174.83 O
HETATM43223 O3' LMT B 627 42.564 -15.005 -23.124 1.00175.18 O
HETATM43224 O5' LMT B 627 40.034 -13.390 -20.393 1.00175.45 O
HETATM43225 O6' LMT B 627 39.358 -10.624 -20.671 1.00175.10 O
HETATM43226 C1 LMT B 627 40.620 -14.013 -17.522 1.00175.01 C
HETATM43227 C2 LMT B 627 39.858 -14.912 -16.593 1.00173.95 C
HETATM43228 C3 LMT B 627 39.367 -14.301 -15.323 1.00173.23 C
HETATM43229 C4 LMT B 627 38.295 -15.202 -14.772 1.00172.24 C
HETATM43230 C5 LMT B 627 37.626 -14.547 -13.613 1.00172.27 C
HETATM43231 C6 LMT B 627 36.727 -15.479 -12.876 1.00173.01 C
HETATM43232 C7 LMT B 627 36.408 -14.900 -11.530 1.00173.65 C
HETATM43233 C8 LMT B 627 35.404 -15.764 -10.853 1.00174.30 C
HETATM43234 C9 LMT B 627 35.208 -15.450 -9.407 1.00174.49 C
HETATM43235 C10 LMT B 627 34.151 -16.386 -8.890 1.00174.13 C
HETATM43236 C11 LMT B 627 33.938 -16.214 -7.421 1.00174.33 C
HETATM43237 C12 LMT B 627 33.581 -14.805 -7.076 1.00174.91 C
HETATM43238 C1B LMT B 628 15.752 -2.482 -24.141 1.00177.14 C
HETATM43239 C2B LMT B 628 16.192 -1.028 -24.432 1.00176.54 C
HETATM43240 C3B LMT B 628 15.324 -0.391 -25.540 1.00174.99 C
HETATM43241 C4B LMT B 628 15.235 -1.322 -26.772 1.00175.44 C
HETATM43242 C5B LMT B 628 14.780 -2.702 -26.270 1.00176.54 C
HETATM43243 C6B LMT B 628 14.602 -3.660 -27.444 1.00175.58 C
HETATM43244 O1B LMT B 628 14.518 -2.489 -23.485 1.00178.01 O
HETATM43245 O2B LMT B 628 16.092 -0.319 -23.258 1.00175.95 O
HETATM43246 O3B LMT B 628 15.758 0.868 -25.865 1.00173.00 O
HETATM43247 O4' LMT B 628 14.327 -0.838 -27.685 1.00174.53 O
HETATM43248 O5B LMT B 628 15.672 -3.231 -25.318 1.00177.22 O
HETATM43249 O6B LMT B 628 14.257 -4.910 -26.984 1.00173.99 O
HETATM43250 C1' LMT B 628 15.529 -3.537 -19.630 1.00175.74 C
HETATM43251 C2' LMT B 628 15.669 -4.715 -20.611 1.00175.91 C
HETATM43252 C3' LMT B 628 15.512 -4.247 -22.089 1.00174.97 C
HETATM43253 C4' LMT B 628 14.352 -3.235 -22.283 1.00175.64 C
HETATM43254 C5' LMT B 628 14.404 -2.234 -21.102 1.00174.74 C
HETATM43255 C6' LMT B 628 13.369 -1.142 -21.162 1.00174.58 C
HETATM43256 O1' LMT B 628 15.484 -3.991 -18.344 1.00176.47 O
HETATM43257 O2' LMT B 628 16.919 -5.261 -20.450 1.00176.84 O
HETATM43258 O3' LMT B 628 15.319 -5.337 -22.896 1.00173.54 O
HETATM43259 O5' LMT B 628 14.295 -2.902 -19.880 1.00174.33 O
HETATM43260 O6' LMT B 628 13.504 -0.437 -19.991 1.00173.31 O
HETATM43261 C1 LMT B 628 15.766 -3.017 -17.368 1.00175.66 C
HETATM43262 C2 LMT B 628 15.797 -3.771 -16.075 1.00174.02 C
HETATM43263 C3 LMT B 628 17.146 -4.071 -15.516 1.00173.05 C
HETATM43264 C4 LMT B 628 16.934 -4.581 -14.119 1.00172.81 C
HETATM43265 C5 LMT B 628 18.034 -4.123 -13.227 1.00172.89 C
HETATM43266 C6 LMT B 628 17.787 -4.504 -11.808 1.00174.14 C
HETATM43267 C7 LMT B 628 18.940 -4.064 -10.955 1.00173.59 C
HETATM43268 C8 LMT B 628 18.646 -4.406 -9.536 1.00173.30 C
HETATM43269 C9 LMT B 628 17.691 -3.473 -8.868 1.00173.07 C
HETATM43270 C10 LMT B 628 16.585 -4.306 -8.285 1.00172.91 C
HETATM43271 C11 LMT B 628 17.031 -5.010 -7.046 1.00173.04 C
HETATM43272 C12 LMT B 628 15.890 -5.667 -6.344 1.00173.85 C
TER 43273 LMT B 628
ATOM 6481 N ASP C 27 -20.623 67.322 27.031 1.00174.94 N
ATOM 6482 CA ASP C 27 -21.796 66.492 27.283 1.00175.41 C
ATOM 6483 C ASP C 27 -21.520 65.034 26.919 1.00175.42 C
ATOM 6484 O ASP C 27 -21.711 64.134 27.739 1.00174.69 O
ATOM 6485 CB ASP C 27 -23.003 67.023 26.505 1.00175.56 C
ATOM 6486 CG ASP C 27 -24.202 66.095 26.579 1.00175.29 C
ATOM 6487 OD1 ASP C 27 -24.299 65.176 25.738 1.00175.31 O
ATOM 6488 OD2 ASP C 27 -25.046 66.283 27.480 1.00175.27 O
ATOM 6489 N GLN C 28 -21.067 64.808 25.689 1.00175.89 N
ATOM 6490 CA GLN C 28 -20.746 63.463 25.226 1.00175.16 C
ATOM 6491 C GLN C 28 -19.266 63.334 24.883 1.00174.47 C
ATOM 6492 O GLN C 28 -18.697 64.176 24.182 1.00173.86 O
ATOM 6493 CB GLN C 28 -21.603 63.088 24.013 1.00175.22 C
ATOM 6494 CG GLN C 28 -22.975 62.501 24.349 1.00174.93 C
ATOM 6495 CD GLN C 28 -22.914 61.061 24.842 1.00174.27 C
ATOM 6496 OE1 GLN C 28 -22.178 60.734 25.774 1.00173.11 O
ATOM 6497 NE2 GLN C 28 -23.698 60.191 24.212 1.00174.28 N
ATOM 6498 N GLU C 29 -18.648 62.270 25.389 1.00174.67 N
ATOM 6499 CA GLU C 29 -17.224 62.032 25.195 1.00174.63 C
ATOM 6500 C GLU C 29 -16.924 60.535 25.150 1.00174.63 C
ATOM 6501 O GLU C 29 -17.758 59.740 24.713 1.00174.35 O
ATOM 6502 CB GLU C 29 -16.411 62.712 26.300 1.00174.84 C
ATOM 6503 CG GLU C 29 -17.147 62.857 27.624 1.00175.58 C
ATOM 6504 CD GLU C 29 -17.428 61.523 28.284 1.00176.63 C
ATOM 6505 OE1 GLU C 29 -18.535 61.351 28.842 1.00176.29 O
ATOM 6506 OE2 GLU C 29 -16.537 60.648 28.251 1.00177.17 O
ATOM 6507 N SER C 30 -15.728 60.160 25.593 1.00174.57 N
ATOM 6508 CA SER C 30 -15.288 58.767 25.585 1.00174.68 C
ATOM 6509 C SER C 30 -16.223 57.834 26.361 1.00174.53 C
ATOM 6510 O SER C 30 -16.326 56.649 26.045 1.00174.49 O
ATOM 6511 CB SER C 30 -13.869 58.663 26.151 1.00175.25 C
ATOM 6512 OG SER C 30 -13.377 57.338 26.048 1.00176.21 O
ATOM 6513 N SER C 31 -16.899 58.368 27.374 1.00174.24 N
ATOM 6514 CA SER C 31 -17.828 57.574 28.174 1.00173.40 C
ATOM 6515 C SER C 31 -19.189 57.472 27.491 1.00173.47 C
ATOM 6516 O SER C 31 -20.220 57.822 28.066 1.00173.23 O
ATOM 6517 CB SER C 31 -17.981 58.169 29.575 1.00172.89 C
ATOM 6518 OG SER C 31 -16.813 57.951 30.349 1.00171.50 O
ATOM 6519 N GLY C 32 -19.173 56.993 26.251 1.00173.58 N
ATOM 6520 CA GLY C 32 -20.380 56.753 25.483 1.00174.47 C
ATOM 6521 C GLY C 32 -20.033 55.906 24.276 1.00175.38 C
ATOM 6522 O GLY C 32 -20.583 54.821 24.080 1.00175.88 O
ATOM 6523 N PHE C 33 -19.107 56.412 23.468 1.00175.41 N
ATOM 6524 CA PHE C 33 -18.549 55.674 22.340 1.00175.14 C
ATOM 6525 C PHE C 33 -17.100 56.102 22.132 1.00175.02 C
ATOM 6526 O PHE C 33 -16.612 57.004 22.814 1.00175.06 O
ATOM 6527 CB PHE C 33 -19.364 55.916 21.065 1.00174.35 C
ATOM 6528 CG PHE C 33 -20.618 55.092 20.975 1.00174.31 C
ATOM 6529 CD1 PHE C 33 -20.566 53.769 20.570 1.00173.48 C
ATOM 6530 CD2 PHE C 33 -21.850 55.642 21.293 1.00174.41 C
ATOM 6531 CE1 PHE C 33 -21.719 53.011 20.483 1.00173.22 C
ATOM 6532 CE2 PHE C 33 -23.005 54.887 21.212 1.00173.56 C
ATOM 6533 CZ PHE C 33 -22.939 53.570 20.806 1.00173.31 C
ATOM 6534 N ALA C 34 -16.413 55.458 21.195 1.00174.64 N
ATOM 6535 CA ALA C 34 -15.065 55.876 20.829 1.00174.09 C
ATOM 6536 C ALA C 34 -15.134 57.044 19.853 1.00174.57 C
ATOM 6537 O ALA C 34 -16.188 57.313 19.274 1.00174.64 O
ATOM 6538 CB ALA C 34 -14.285 54.722 20.228 1.00174.30 C
ATOM 6539 N TRP C 35 -14.012 57.737 19.680 1.00174.67 N
ATOM 6540 CA TRP C 35 -13.938 58.879 18.771 1.00175.01 C
ATOM 6541 C TRP C 35 -14.314 58.490 17.338 1.00174.52 C
ATOM 6542 O TRP C 35 -15.036 59.221 16.658 1.00173.23 O
ATOM 6543 CB TRP C 35 -12.536 59.503 18.809 1.00175.29 C
ATOM 6544 CG TRP C 35 -11.480 58.702 18.100 1.00175.57 C
ATOM 6545 CD1 TRP C 35 -10.680 57.737 18.642 1.00175.19 C
ATOM 6546 CD2 TRP C 35 -11.106 58.804 16.720 1.00175.13 C
ATOM 6547 NE1 TRP C 35 -9.837 57.228 17.683 1.00175.26 N
ATOM 6548 CE2 TRP C 35 -10.080 57.867 16.494 1.00174.59 C
ATOM 6549 CE3 TRP C 35 -11.546 59.594 15.653 1.00174.14 C
ATOM 6550 CZ2 TRP C 35 -9.484 57.698 15.246 1.00173.50 C
ATOM 6551 CZ3 TRP C 35 -10.953 59.426 14.414 1.00174.16 C
ATOM 6552 CH2 TRP C 35 -9.933 58.485 14.222 1.00173.85 C
ATOM 6553 N TRP C 36 -13.824 57.338 16.887 1.00174.63 N
ATOM 6554 CA TRP C 36 -14.082 56.861 15.530 1.00173.59 C
ATOM 6555 C TRP C 36 -15.498 56.315 15.373 1.00172.77 C
ATOM 6556 O TRP C 36 -15.872 55.833 14.304 1.00172.47 O
ATOM 6557 CB TRP C 36 -13.062 55.788 15.139 1.00173.77 C
ATOM 6558 CG TRP C 36 -12.870 54.721 16.177 1.00174.31 C
ATOM 6559 CD1 TRP C 36 -11.870 54.650 17.104 1.00174.14 C
ATOM 6560 CD2 TRP C 36 -13.695 53.569 16.387 1.00174.41 C
ATOM 6561 NE1 TRP C 36 -12.025 53.528 17.882 1.00173.44 N
ATOM 6562 CE2 TRP C 36 -13.137 52.846 17.461 1.00174.23 C
ATOM 6563 CE3 TRP C 36 -14.852 53.079 15.773 1.00174.16 C
ATOM 6564 CZ2 TRP C 36 -13.697 51.661 17.934 1.00174.73 C
ATOM 6565 CZ3 TRP C 36 -15.406 51.902 16.244 1.00174.41 C
ATOM 6566 CH2 TRP C 36 -14.828 51.207 17.314 1.00175.09 C
ATOM 6567 N ALA C 37 -16.277 56.380 16.446 1.00172.96 N
ATOM 6568 CA ALA C 37 -17.683 55.996 16.415 1.00173.07 C
ATOM 6569 C ALA C 37 -18.520 57.137 16.980 1.00173.64 C
ATOM 6570 O ALA C 37 -19.645 56.938 17.434 1.00174.41 O
ATOM 6571 CB ALA C 37 -17.912 54.715 17.200 1.00172.86 C
ATOM 6572 N GLY C 38 -17.932 58.331 16.956 1.00173.56 N
ATOM 6573 CA GLY C 38 -18.532 59.540 17.490 1.00174.03 C
ATOM 6574 C GLY C 38 -19.997 59.802 17.188 1.00174.63 C
ATOM 6575 O GLY C 38 -20.769 60.104 18.097 1.00175.32 O
ATOM 6576 N ASN C 39 -20.383 59.694 15.920 1.00173.87 N
ATOM 6577 CA ASN C 39 -21.756 59.975 15.506 1.00173.69 C
ATOM 6578 C ASN C 39 -22.801 59.043 16.118 1.00173.75 C
ATOM 6579 O ASN C 39 -24.001 59.302 16.021 1.00173.55 O
ATOM 6580 CB ASN C 39 -21.862 59.918 13.982 1.00173.74 C
ATOM 6581 CG ASN C 39 -21.069 61.013 13.301 1.00173.26 C
ATOM 6582 OD1 ASN C 39 -21.410 62.189 13.397 1.00173.10 O
ATOM 6583 ND2 ASN C 39 -19.993 60.632 12.621 1.00173.24 N
ATOM 6584 N ALA C 40 -22.347 57.974 16.763 1.00174.20 N
ATOM 6585 CA ALA C 40 -23.252 57.055 17.443 1.00174.16 C
ATOM 6586 C ALA C 40 -23.622 57.571 18.830 1.00173.78 C
ATOM 6587 O ALA C 40 -24.499 57.020 19.492 1.00172.68 O
ATOM 6588 CB ALA C 40 -22.631 55.671 17.540 1.00174.62 C
ATOM 6589 N ARG C 41 -22.949 58.629 19.268 1.00174.29 N
ATOM 6590 CA ARG C 41 -23.263 59.258 20.545 1.00173.91 C
ATOM 6591 C ARG C 41 -24.518 60.110 20.406 1.00173.58 C
ATOM 6592 O ARG C 41 -25.054 60.618 21.391 1.00173.26 O
ATOM 6593 CB ARG C 41 -22.095 60.119 21.029 1.00174.36 C
ATOM 6594 CG ARG C 41 -20.788 59.365 21.243 1.00174.71 C
ATOM 6595 CD ARG C 41 -19.615 60.337 21.335 1.00174.93 C
ATOM 6596 NE ARG C 41 -18.341 59.662 21.571 1.00175.11 N
ATOM 6597 CZ ARG C 41 -17.161 60.277 21.591 1.00174.88 C
ATOM 6598 NH1 ARG C 41 -17.088 61.586 21.389 1.00174.28 N
ATOM 6599 NH2 ARG C 41 -16.053 59.584 21.814 1.00175.07 N
ATOM 6600 N LEU C 42 -24.975 60.261 19.167 1.00173.66 N
ATOM 6601 CA LEU C 42 -26.107 61.122 18.848 1.00174.55 C
ATOM 6602 C LEU C 42 -27.386 60.333 18.604 1.00174.68 C
ATOM 6603 O LEU C 42 -28.399 60.899 18.192 1.00174.83 O
ATOM 6604 CB LEU C 42 -25.783 61.970 17.618 1.00174.50 C
ATOM 6605 CG LEU C 42 -24.542 62.851 17.747 1.00174.29 C
ATOM 6606 CD1 LEU C 42 -23.884 63.044 16.394 1.00174.18 C
ATOM 6607 CD2 LEU C 42 -24.909 64.190 18.364 1.00174.26 C
ATOM 6608 N ILE C 43 -27.333 59.027 18.851 1.00174.19 N
ATOM 6609 CA ILE C 43 -28.489 58.158 18.654 1.00174.63 C
ATOM 6610 C ILE C 43 -29.677 58.608 19.507 1.00175.06 C
ATOM 6611 O ILE C 43 -30.831 58.516 19.083 1.00174.30 O
ATOM 6612 CB ILE C 43 -28.136 56.689 18.981 1.00174.93 C
ATOM 6613 CG1 ILE C 43 -27.116 56.155 17.974 1.00174.78 C
ATOM 6614 CG2 ILE C 43 -29.383 55.809 18.997 1.00174.68 C
ATOM 6615 CD1 ILE C 43 -26.675 54.735 18.248 1.00175.16 C
ATOM 6616 N ASN C 44 -29.389 59.127 20.697 1.00175.84 N
ATOM 6617 CA ASN C 44 -30.440 59.569 21.609 1.00175.61 C
ATOM 6618 C ASN C 44 -30.330 61.056 21.930 1.00174.94 C
ATOM 6619 O ASN C 44 -30.521 61.473 23.072 1.00174.75 O
ATOM 6620 CB ASN C 44 -30.404 58.754 22.906 1.00175.92 C
ATOM 6621 CG ASN C 44 -30.551 57.263 22.668 1.00175.74 C
ATOM 6622 OD1 ASN C 44 -31.472 56.818 21.980 1.00175.58 O
ATOM 6623 ND2 ASN C 44 -29.646 56.482 23.243 1.00175.63 N
ATOM 6624 N LEU C 45 -30.021 61.847 20.907 1.00174.67 N
ATOM 6625 CA LEU C 45 -29.915 63.297 21.033 1.00174.36 C
ATOM 6626 C LEU C 45 -30.644 63.964 19.873 1.00174.10 C
ATOM 6627 O LEU C 45 -30.032 64.677 19.075 1.00174.21 O
ATOM 6628 CB LEU C 45 -28.451 63.752 21.070 1.00174.38 C
ATOM 6629 CG LEU C 45 -27.652 63.706 22.381 1.00173.94 C
ATOM 6630 CD1 LEU C 45 -27.364 62.289 22.849 1.00173.28 C
ATOM 6631 CD2 LEU C 45 -26.353 64.493 22.239 1.00173.75 C
ATOM 6632 N SER C 46 -31.949 63.697 19.791 1.00174.52 N
ATOM 6633 CA SER C 46 -32.845 64.193 18.739 1.00174.64 C
ATOM 6634 C SER C 46 -32.503 65.582 18.199 1.00174.95 C
ATOM 6635 O SER C 46 -32.499 65.798 16.987 1.00174.85 O
ATOM 6636 CB SER C 46 -34.288 64.196 19.255 1.00174.37 C
ATOM 6637 OG SER C 46 -34.399 64.921 20.466 1.00174.47 O
ATOM 6638 N GLY C 47 -32.238 66.519 19.105 1.00175.09 N
ATOM 6639 CA GLY C 47 -31.865 67.871 18.729 1.00174.68 C
ATOM 6640 C GLY C 47 -30.638 67.932 17.839 1.00174.85 C
ATOM 6641 O GLY C 47 -30.709 68.390 16.697 1.00174.40 O
ATOM 6642 N LYS C 48 -29.512 67.472 18.370 1.00175.14 N
ATOM 6643 CA LYS C 48 -28.259 67.446 17.627 1.00175.25 C
ATOM 6644 C LYS C 48 -28.328 66.488 16.441 1.00175.61 C
ATOM 6645 O LYS C 48 -27.721 66.735 15.400 1.00175.65 O
ATOM 6646 CB LYS C 48 -27.099 67.061 18.545 1.00173.68 C
ATOM 6647 CG LYS C 48 -26.746 68.124 19.570 1.00173.21 C
ATOM 6648 CD LYS C 48 -25.497 67.748 20.346 1.00173.19 C
ATOM 6649 CE LYS C 48 -24.984 68.926 21.158 1.00172.94 C
ATOM 6650 NZ LYS C 48 -24.589 70.078 20.307 1.00172.60 N
ATOM 6651 N LEU C 49 -29.070 65.396 16.603 1.00175.65 N
ATOM 6652 CA LEU C 49 -29.217 64.414 15.535 1.00175.21 C
ATOM 6653 C LEU C 49 -30.014 64.996 14.367 1.00175.06 C
ATOM 6654 O LEU C 49 -29.968 64.478 13.251 1.00175.08 O
ATOM 6655 CB LEU C 49 -29.895 63.146 16.063 1.00174.93 C
ATOM 6656 CG LEU C 49 -29.907 61.930 15.135 1.00174.55 C
ATOM 6657 CD1 LEU C 49 -28.492 61.611 14.679 1.00174.22 C
ATOM 6658 CD2 LEU C 49 -30.548 60.724 15.808 1.00174.06 C
ATOM 6659 N LEU C 50 -30.724 66.088 14.625 1.00174.55 N
ATOM 6660 CA LEU C 50 -31.464 66.781 13.580 1.00173.86 C
ATOM 6661 C LEU C 50 -30.517 67.710 12.837 1.00174.84 C
ATOM 6662 O LEU C 50 -30.591 67.843 11.616 1.00175.89 O
ATOM 6663 CB LEU C 50 -32.640 67.565 14.163 1.00173.19 C
ATOM 6664 CG LEU C 50 -33.411 68.446 13.177 1.00172.76 C
ATOM 6665 CD1 LEU C 50 -34.067 67.604 12.094 1.00172.48 C
ATOM 6666 CD2 LEU C 50 -34.442 69.301 13.896 1.00172.55 C
ATOM 6667 N GLY C 51 -29.622 68.343 13.592 1.00174.66 N
ATOM 6668 CA GLY C 51 -28.605 69.219 13.036 1.00174.72 C
ATOM 6669 C GLY C 51 -27.742 68.535 11.996 1.00175.15 C
ATOM 6670 O GLY C 51 -27.476 69.099 10.936 1.00175.78 O
ATOM 6671 N ALA C 52 -27.298 67.323 12.313 1.00174.32 N
ATOM 6672 CA ALA C 52 -26.509 66.513 11.390 1.00174.00 C
ATOM 6673 C ALA C 52 -27.228 66.329 10.053 1.00174.49 C
ATOM 6674 O ALA C 52 -26.687 66.661 9.000 1.00174.23 O
ATOM 6675 CB ALA C 52 -26.194 65.161 12.012 1.00173.28 C
ATOM 6676 N HIS C 53 -28.448 65.803 10.111 1.00174.63 N
ATOM 6677 CA HIS C 53 -29.255 65.530 8.924 1.00174.09 C
ATOM 6678 C HIS C 53 -29.556 66.775 8.094 1.00174.28 C
ATOM 6679 O HIS C 53 -29.751 66.691 6.883 1.00174.34 O
ATOM 6680 CB HIS C 53 -30.579 64.886 9.331 1.00173.42 C
ATOM 6681 CG HIS C 53 -30.433 63.530 9.941 1.00174.42 C
ATOM 6682 ND1 HIS C 53 -29.944 63.333 11.214 1.00175.26 N
ATOM 6683 CD2 HIS C 53 -30.736 62.302 9.459 1.00174.47 C
ATOM 6684 CE1 HIS C 53 -29.941 62.040 11.487 1.00175.14 C
ATOM 6685 NE2 HIS C 53 -30.415 61.394 10.437 1.00174.52 N
ATOM 6686 N VAL C 54 -29.602 67.925 8.756 1.00174.54 N
ATOM 6687 CA VAL C 54 -29.875 69.184 8.075 1.00174.44 C
ATOM 6688 C VAL C 54 -28.590 69.780 7.504 1.00174.36 C
ATOM 6689 O VAL C 54 -28.593 70.364 6.419 1.00174.46 O
ATOM 6690 CB VAL C 54 -30.555 70.190 9.033 1.00174.95 C
ATOM 6691 CG1 VAL C 54 -30.656 71.563 8.400 1.00174.76 C
ATOM 6692 CG2 VAL C 54 -31.940 69.691 9.424 1.00175.48 C
ATOM 6693 N ALA C 55 -27.488 69.594 8.221 1.00174.35 N
ATOM 6694 CA ALA C 55 -26.187 70.074 7.772 1.00174.49 C
ATOM 6695 C ALA C 55 -25.698 69.199 6.630 1.00174.51 C
ATOM 6696 O ALA C 55 -25.076 69.675 5.680 1.00175.08 O
ATOM 6697 CB ALA C 55 -25.184 70.072 8.914 1.00174.49 C
ATOM 6698 N HIS C 56 -25.980 67.907 6.748 1.00173.76 N
ATOM 6699 CA HIS C 56 -25.651 66.935 5.719 1.00173.39 C
ATOM 6700 C HIS C 56 -26.420 67.200 4.433 1.00173.65 C
ATOM 6701 O HIS C 56 -25.842 67.205 3.345 1.00173.45 O
ATOM 6702 CB HIS C 56 -25.954 65.523 6.209 1.00173.62 C
ATOM 6703 CG HIS C 56 -25.601 64.458 5.221 1.00173.88 C
ATOM 6704 ND1 HIS C 56 -26.336 64.226 4.078 1.00173.25 N
ATOM 6705 CD2 HIS C 56 -24.586 63.563 5.203 1.00174.15 C
ATOM 6706 CE1 HIS C 56 -25.787 63.236 3.397 1.00173.67 C
ATOM 6707 NE2 HIS C 56 -24.727 62.815 4.061 1.00173.81 N
ATOM 6708 N ALA C 57 -27.730 67.389 4.567 1.00174.19 N
ATOM 6709 CA ALA C 57 -28.600 67.688 3.431 1.00174.41 C
ATOM 6710 C ALA C 57 -28.151 68.937 2.685 1.00173.72 C
ATOM 6711 O ALA C 57 -28.434 69.096 1.499 1.00172.92 O
ATOM 6712 CB ALA C 57 -30.038 67.847 3.897 1.00174.89 C
ATOM 6713 N GLY C 58 -27.445 69.818 3.387 1.00173.91 N
ATOM 6714 CA GLY C 58 -26.898 71.015 2.780 1.00173.46 C
ATOM 6715 C GLY C 58 -25.729 70.674 1.885 1.00173.83 C
ATOM 6716 O GLY C 58 -25.566 71.260 0.816 1.00174.04 O
ATOM 6717 N LEU C 59 -24.917 69.716 2.326 1.00173.93 N
ATOM 6718 CA LEU C 59 -23.771 69.254 1.551 1.00173.93 C
ATOM 6719 C LEU C 59 -24.206 68.675 0.209 1.00173.94 C
ATOM 6720 O LEU C 59 -23.511 68.825 -0.796 1.00174.25 O
ATOM 6721 CB LEU C 59 -22.979 68.207 2.335 1.00173.80 C
ATOM 6722 CG LEU C 59 -22.340 68.658 3.648 1.00174.00 C
ATOM 6723 CD1 LEU C 59 -21.807 67.461 4.421 1.00174.00 C
ATOM 6724 CD2 LEU C 59 -21.236 69.671 3.390 1.00173.85 C
ATOM 6725 N ILE C 60 -25.354 68.006 0.202 1.00173.66 N
ATOM 6726 CA ILE C 60 -25.884 67.415 -1.021 1.00173.67 C
ATOM 6727 C ILE C 60 -26.353 68.511 -1.970 1.00174.07 C
ATOM 6728 O ILE C 60 -26.100 68.454 -3.174 1.00174.39 O
ATOM 6729 CB ILE C 60 -27.048 66.449 -0.730 1.00173.65 C
ATOM 6730 CG1 ILE C 60 -26.606 65.361 0.247 1.00174.40 C
ATOM 6731 CG2 ILE C 60 -27.556 65.822 -2.019 1.00173.69 C
ATOM 6732 CD1 ILE C 60 -27.684 64.348 0.566 1.00174.62 C
ATOM 6733 N VAL C 61 -27.034 69.511 -1.417 1.00174.09 N
ATOM 6734 CA VAL C 61 -27.493 70.649 -2.204 1.00174.23 C
ATOM 6735 C VAL C 61 -26.296 71.474 -2.673 1.00173.82 C
ATOM 6736 O VAL C 61 -26.260 71.938 -3.813 1.00173.88 O
ATOM 6737 CB VAL C 61 -28.461 71.550 -1.409 1.00174.14 C
ATOM 6738 CG1 VAL C 61 -28.985 72.658 -2.291 1.00174.00 C
ATOM 6739 CG2 VAL C 61 -29.622 70.744 -0.877 1.00173.99 C
ATOM 6740 N PHE C 62 -25.322 71.650 -1.782 1.00173.80 N
ATOM 6741 CA PHE C 62 -24.091 72.373 -2.100 1.00173.58 C
ATOM 6742 C PHE C 62 -23.379 71.776 -3.306 1.00173.21 C
ATOM 6743 O PHE C 62 -23.025 72.495 -4.239 1.00173.49 O
ATOM 6744 CB PHE C 62 -23.145 72.383 -0.897 1.00174.26 C
ATOM 6745 CG PHE C 62 -21.909 73.211 -1.106 1.00174.04 C
ATOM 6746 CD1 PHE C 62 -21.916 74.568 -0.827 1.00174.46 C
ATOM 6747 CD2 PHE C 62 -20.739 72.635 -1.574 1.00173.22 C
ATOM 6748 CE1 PHE C 62 -20.784 75.335 -1.017 1.00174.18 C
ATOM 6749 CE2 PHE C 62 -19.604 73.398 -1.767 1.00173.42 C
ATOM 6750 CZ PHE C 62 -19.627 74.749 -1.487 1.00173.97 C
ATOM 6751 N TRP C 63 -23.159 70.465 -3.271 1.00173.29 N
ATOM 6752 CA TRP C 63 -22.505 69.767 -4.374 1.00173.80 C
ATOM 6753 C TRP C 63 -23.255 69.984 -5.681 1.00173.63 C
ATOM 6754 O TRP C 63 -22.696 70.518 -6.636 1.00173.97 O
ATOM 6755 CB TRP C 63 -22.393 68.270 -4.084 1.00174.49 C
ATOM 6756 CG TRP C 63 -21.740 67.511 -5.201 1.00174.66 C
ATOM 6757 CD1 TRP C 63 -20.400 67.395 -5.438 1.00173.84 C
ATOM 6758 CD2 TRP C 63 -22.397 66.778 -6.243 1.00174.73 C
ATOM 6759 NE1 TRP C 63 -20.183 66.630 -6.560 1.00173.51 N
ATOM 6760 CE2 TRP C 63 -21.394 66.239 -7.072 1.00174.16 C
ATOM 6761 CE3 TRP C 63 -23.737 66.523 -6.554 1.00174.40 C
ATOM 6762 CZ2 TRP C 63 -21.685 65.462 -8.191 1.00173.82 C
ATOM 6763 CZ3 TRP C 63 -24.026 65.751 -7.666 1.00173.92 C
ATOM 6764 CH2 TRP C 63 -23.004 65.229 -8.470 1.00173.74 C
ATOM 6765 N ALA C 64 -24.518 69.565 -5.707 1.00173.09 N
ATOM 6766 CA ALA C 64 -25.394 69.730 -6.866 1.00173.23 C
ATOM 6767 C ALA C 64 -25.301 71.129 -7.472 1.00173.75 C
ATOM 6768 O ALA C 64 -25.206 71.284 -8.688 1.00173.91 O
ATOM 6769 CB ALA C 64 -26.833 69.420 -6.478 1.00173.99 C
ATOM 6770 N GLY C 65 -25.324 72.143 -6.612 1.00174.07 N
ATOM 6771 CA GLY C 65 -25.207 73.521 -7.049 1.00174.29 C
ATOM 6772 C GLY C 65 -23.829 73.889 -7.569 1.00174.14 C
ATOM 6773 O GLY C 65 -23.681 74.302 -8.719 1.00173.95 O
ATOM 6774 N ALA C 66 -22.820 73.743 -6.714 1.00174.37 N
ATOM 6775 CA ALA C 66 -21.448 74.117 -7.050 1.00173.86 C
ATOM 6776 C ALA C 66 -20.893 73.329 -8.235 1.00173.06 C
ATOM 6777 O ALA C 66 -20.056 73.831 -8.984 1.00172.58 O
ATOM 6778 CB ALA C 66 -20.545 73.937 -5.837 1.00174.58 C
ATOM 6779 N MET C 67 -21.362 72.096 -8.404 1.00172.84 N
ATOM 6780 CA MET C 67 -20.883 71.241 -9.485 1.00173.08 C
ATOM 6781 C MET C 67 -21.488 71.650 -10.819 1.00173.19 C
ATOM 6782 O MET C 67 -20.805 71.661 -11.843 1.00173.58 O
ATOM 6783 CB MET C 67 -21.204 69.775 -9.203 1.00174.29 C
ATOM 6784 CG MET C 67 -20.691 68.818 -10.260 1.00175.51 C
ATOM 6785 SD MET C 67 -18.895 68.725 -10.306 1.00177.32 S
ATOM 6786 CE MET C 67 -18.668 67.015 -9.847 1.00174.18 C
ATOM 6787 N THR C 68 -22.777 71.972 -10.797 1.00173.12 N
ATOM 6788 CA THR C 68 -23.480 72.429 -11.989 1.00173.72 C
ATOM 6789 C THR C 68 -22.794 73.657 -12.580 1.00174.08 C
ATOM 6790 O THR C 68 -22.579 73.739 -13.790 1.00173.79 O
ATOM 6791 CB THR C 68 -24.947 72.763 -11.681 1.00174.22 C
ATOM 6792 OG1 THR C 68 -25.592 71.614 -11.117 1.00174.37 O
ATOM 6793 CG2 THR C 68 -25.676 73.181 -12.949 1.00174.71 C
ATOM 6794 N LEU C 69 -22.453 74.608 -11.716 1.00174.37 N
ATOM 6795 CA LEU C 69 -21.742 75.809 -12.138 1.00174.31 C
ATOM 6796 C LEU C 69 -20.341 75.473 -12.634 1.00174.54 C
ATOM 6797 O LEU C 69 -19.821 76.124 -13.538 1.00174.77 O
ATOM 6798 CB LEU C 69 -21.664 76.818 -10.993 1.00174.05 C
ATOM 6799 CG LEU C 69 -23.010 77.298 -10.455 1.00174.90 C
ATOM 6800 CD1 LEU C 69 -22.812 78.237 -9.276 1.00175.15 C
ATOM 6801 CD2 LEU C 69 -23.809 77.969 -11.561 1.00174.60 C
ATOM 6802 N PHE C 70 -19.733 74.456 -12.031 1.00174.53 N
ATOM 6803 CA PHE C 70 -18.418 73.989 -12.453 1.00174.31 C
ATOM 6804 C PHE C 70 -18.486 73.384 -13.850 1.00174.38 C
ATOM 6805 O PHE C 70 -17.635 73.652 -14.698 1.00174.20 O
ATOM 6806 CB PHE C 70 -17.867 72.968 -11.457 1.00173.95 C
ATOM 6807 CG PHE C 70 -16.483 72.482 -11.787 1.00173.88 C
ATOM 6808 CD1 PHE C 70 -15.370 73.233 -11.445 1.00174.20 C
ATOM 6809 CD2 PHE C 70 -16.295 71.271 -12.433 1.00173.94 C
ATOM 6810 CE1 PHE C 70 -14.096 72.785 -11.747 1.00174.27 C
ATOM 6811 CE2 PHE C 70 -15.025 70.820 -12.738 1.00173.79 C
ATOM 6812 CZ PHE C 70 -13.924 71.578 -12.394 1.00173.62 C
ATOM 6813 N GLU C 71 -19.507 72.561 -14.075 1.00174.35 N
ATOM 6814 CA GLU C 71 -19.745 71.947 -15.376 1.00174.06 C
ATOM 6815 C GLU C 71 -20.022 73.000 -16.446 1.00173.90 C
ATOM 6816 O GLU C 71 -19.416 72.978 -17.517 1.00173.78 O
ATOM 6817 CB GLU C 71 -20.908 70.954 -15.293 1.00173.74 C
ATOM 6818 CG GLU C 71 -20.548 69.629 -14.634 1.00173.66 C
ATOM 6819 CD GLU C 71 -21.659 68.602 -14.732 1.00173.70 C
ATOM 6820 OE1 GLU C 71 -22.420 68.637 -15.722 1.00173.60 O
ATOM 6821 OE2 GLU C 71 -21.769 67.757 -13.820 1.00173.98 O
ATOM 6822 N LEU C 72 -20.942 73.915 -16.150 1.00173.35 N
ATOM 6823 CA LEU C 72 -21.279 75.002 -17.066 1.00172.60 C
ATOM 6824 C LEU C 72 -20.066 75.862 -17.413 1.00173.18 C
ATOM 6825 O LEU C 72 -19.889 76.257 -18.565 1.00173.20 O
ATOM 6826 CB LEU C 72 -22.378 75.882 -16.468 1.00172.38 C
ATOM 6827 CG LEU C 72 -22.873 77.007 -17.378 1.00172.88 C
ATOM 6828 CD1 LEU C 72 -23.661 76.439 -18.546 1.00173.14 C
ATOM 6829 CD2 LEU C 72 -23.706 78.010 -16.598 1.00173.95 C
ATOM 6830 N ALA C 73 -19.238 76.145 -16.411 1.00173.59 N
ATOM 6831 CA ALA C 73 -18.038 76.960 -16.596 1.00173.52 C
ATOM 6832 C ALA C 73 -17.071 76.340 -17.602 1.00173.47 C
ATOM 6833 O ALA C 73 -16.270 77.042 -18.218 1.00173.43 O
ATOM 6834 CB ALA C 73 -17.337 77.179 -15.263 1.00173.79 C
ATOM 6835 N HIS C 74 -17.146 75.023 -17.758 1.00173.61 N
ATOM 6836 CA HIS C 74 -16.296 74.307 -18.701 1.00173.80 C
ATOM 6837 C HIS C 74 -17.078 73.885 -19.941 1.00173.82 C
ATOM 6838 O HIS C 74 -16.492 73.513 -20.958 1.00174.23 O
ATOM 6839 CB HIS C 74 -15.667 73.077 -18.037 1.00173.20 C
ATOM 6840 CG HIS C 74 -14.799 73.402 -16.862 1.00173.07 C
ATOM 6841 ND1 HIS C 74 -15.311 73.816 -15.652 1.00173.36 N
ATOM 6842 CD2 HIS C 74 -13.455 73.369 -16.710 1.00173.07 C
ATOM 6843 CE1 HIS C 74 -14.318 74.029 -14.807 1.00173.27 C
ATOM 6844 NE2 HIS C 74 -13.181 73.763 -15.423 1.00173.11 N
ATOM 6845 N PHE C 75 -18.402 73.935 -19.841 1.00173.56 N
ATOM 6846 CA PHE C 75 -19.277 73.480 -20.916 1.00173.48 C
ATOM 6847 C PHE C 75 -19.036 74.190 -22.246 1.00173.56 C
ATOM 6848 O PHE C 75 -19.013 75.419 -22.317 1.00173.41 O
ATOM 6849 CB PHE C 75 -20.741 73.649 -20.515 1.00173.64 C
ATOM 6850 CG PHE C 75 -21.706 73.215 -21.577 1.00174.04 C
ATOM 6851 CD1 PHE C 75 -21.875 71.873 -21.865 1.00173.72 C
ATOM 6852 CD2 PHE C 75 -22.445 74.145 -22.286 1.00174.92 C
ATOM 6853 CE1 PHE C 75 -22.760 71.463 -22.840 1.00174.03 C
ATOM 6854 CE2 PHE C 75 -23.334 73.742 -23.264 1.00174.97 C
ATOM 6855 CZ PHE C 75 -23.491 72.398 -23.540 1.00174.62 C
ATOM 6856 N ILE C 76 -18.859 73.395 -23.298 1.00173.58 N
ATOM 6857 CA ILE C 76 -18.699 73.913 -24.651 1.00173.46 C
ATOM 6858 C ILE C 76 -19.909 73.530 -25.498 1.00173.42 C
ATOM 6859 O ILE C 76 -20.080 72.360 -25.841 1.00172.94 O
ATOM 6860 CB ILE C 76 -17.413 73.384 -25.313 1.00173.15 C
ATOM 6861 CG1 ILE C 76 -16.214 73.598 -24.386 1.00172.84 C
ATOM 6862 CG2 ILE C 76 -17.184 74.065 -26.655 1.00173.54 C
ATOM 6863 CD1 ILE C 76 -14.912 73.055 -24.938 1.00172.47 C
ATOM 6864 N PRO C 77 -20.753 74.519 -25.832 1.00173.95 N
ATOM 6865 CA PRO C 77 -22.013 74.339 -26.564 1.00174.64 C
ATOM 6866 C PRO C 77 -21.892 73.495 -27.834 1.00174.64 C
ATOM 6867 O PRO C 77 -22.579 72.482 -27.949 1.00174.46 O
ATOM 6868 CB PRO C 77 -22.424 75.780 -26.908 1.00174.98 C
ATOM 6869 CG PRO C 77 -21.160 76.575 -26.801 1.00174.39 C
ATOM 6870 CD PRO C 77 -20.442 75.947 -25.653 1.00174.26 C
ATOM 6871 N GLU C 78 -21.031 73.898 -28.763 1.00174.82 N
ATOM 6872 CA GLU C 78 -20.886 73.173 -30.022 1.00174.47 C
ATOM 6873 C GLU C 78 -19.990 71.949 -29.858 1.00173.22 C
ATOM 6874 O GLU C 78 -19.013 71.765 -30.584 1.00173.93 O
ATOM 6875 CB GLU C 78 -20.349 74.100 -31.121 1.00175.12 C
ATOM 6876 CG GLU C 78 -19.045 74.822 -30.797 1.00175.39 C
ATOM 6877 CD GLU C 78 -19.239 76.046 -29.921 1.00175.21 C
ATOM 6878 OE1 GLU C 78 -19.881 77.013 -30.380 1.00174.76 O
ATOM 6879 OE2 GLU C 78 -18.731 76.047 -28.780 1.00174.49 O
ATOM 6880 N LYS C 79 -20.356 71.101 -28.907 1.00172.32 N
ATOM 6881 CA LYS C 79 -19.584 69.916 -28.578 1.00173.01 C
ATOM 6882 C LYS C 79 -20.421 68.996 -27.703 1.00173.97 C
ATOM 6883 O LYS C 79 -21.062 69.455 -26.757 1.00174.05 O
ATOM 6884 CB LYS C 79 -18.284 70.298 -27.864 1.00173.51 C
ATOM 6885 CG LYS C 79 -17.389 69.119 -27.513 1.00173.56 C
ATOM 6886 CD LYS C 79 -16.082 69.577 -26.891 1.00173.78 C
ATOM 6887 CE LYS C 79 -15.159 68.400 -26.618 1.00173.86 C
ATOM 6888 NZ LYS C 79 -13.926 68.824 -25.899 1.00172.99 N
ATOM 6889 N PRO C 80 -20.428 67.694 -28.025 1.00174.71 N
ATOM 6890 CA PRO C 80 -21.160 66.665 -27.279 1.00175.05 C
ATOM 6891 C PRO C 80 -20.922 66.725 -25.771 1.00174.20 C
ATOM 6892 O PRO C 80 -19.796 66.947 -25.326 1.00174.06 O
ATOM 6893 CB PRO C 80 -20.608 65.369 -27.869 1.00175.01 C
ATOM 6894 CG PRO C 80 -20.317 65.731 -29.283 1.00174.69 C
ATOM 6895 CD PRO C 80 -19.752 67.123 -29.203 1.00173.93 C
ATOM 6896 N MET C 81 -21.987 66.529 -25.003 1.00173.57 N
ATOM 6897 CA MET C 81 -21.925 66.625 -23.551 1.00173.38 C
ATOM 6898 C MET C 81 -21.100 65.498 -22.953 1.00173.30 C
ATOM 6899 O MET C 81 -20.343 65.707 -22.005 1.00173.96 O
ATOM 6900 CB MET C 81 -23.330 66.607 -22.958 1.00173.42 C
ATOM 6901 CG MET C 81 -24.230 67.710 -23.481 1.00173.99 C
ATOM 6902 SD MET C 81 -25.928 67.515 -22.919 1.00172.15 S
ATOM 6903 CE MET C 81 -25.852 68.351 -21.343 1.00172.71 C
ATOM 6904 N TYR C 82 -21.252 64.302 -23.508 1.00172.61 N
ATOM 6905 CA TYR C 82 -20.522 63.136 -23.026 1.00172.79 C
ATOM 6906 C TYR C 82 -19.012 63.248 -23.244 1.00172.87 C
ATOM 6907 O TYR C 82 -18.239 62.497 -22.649 1.00172.58 O
ATOM 6908 CB TYR C 82 -21.063 61.863 -23.686 1.00173.13 C
ATOM 6909 CG TYR C 82 -21.175 61.911 -25.195 1.00173.88 C
ATOM 6910 CD1 TYR C 82 -22.298 62.452 -25.811 1.00173.92 C
ATOM 6911 CD2 TYR C 82 -20.173 61.392 -26.004 1.00174.57 C
ATOM 6912 CE1 TYR C 82 -22.414 62.486 -27.189 1.00173.95 C
ATOM 6913 CE2 TYR C 82 -20.279 61.424 -27.383 1.00174.97 C
ATOM 6914 CZ TYR C 82 -21.401 61.973 -27.971 1.00174.68 C
ATOM 6915 OH TYR C 82 -21.509 62.008 -29.343 1.00173.77 O
ATOM 6916 N GLU C 83 -18.595 64.185 -24.090 1.00173.46 N
ATOM 6917 CA GLU C 83 -17.174 64.423 -24.321 1.00174.03 C
ATOM 6918 C GLU C 83 -16.623 65.518 -23.413 1.00174.45 C
ATOM 6919 O GLU C 83 -15.523 66.023 -23.638 1.00174.49 O
ATOM 6920 CB GLU C 83 -16.917 64.805 -25.780 1.00174.29 C
ATOM 6921 CG GLU C 83 -17.349 63.769 -26.796 1.00174.78 C
ATOM 6922 CD GLU C 83 -16.893 64.125 -28.195 1.00174.68 C
ATOM 6923 OE1 GLU C 83 -17.400 63.521 -29.162 1.00175.77 O
ATOM 6924 OE2 GLU C 83 -16.024 65.013 -28.323 1.00173.91 O
ATOM 6925 N GLN C 84 -17.388 65.888 -22.391 1.00174.59 N
ATOM 6926 CA GLN C 84 -16.994 66.991 -21.523 1.00174.61 C
ATOM 6927 C GLN C 84 -17.111 66.632 -20.043 1.00173.57 C
ATOM 6928 O GLN C 84 -16.893 67.475 -19.174 1.00173.47 O
ATOM 6929 CB GLN C 84 -17.837 68.233 -21.827 1.00175.00 C
ATOM 6930 CG GLN C 84 -17.655 68.777 -23.240 1.00174.16 C
ATOM 6931 CD GLN C 84 -18.448 70.047 -23.483 1.00173.58 C
ATOM 6932 OE1 GLN C 84 -18.432 70.968 -22.668 1.00173.23 O
ATOM 6933 NE2 GLN C 84 -19.148 70.100 -24.611 1.00173.63 N
ATOM 6934 N GLY C 85 -17.441 65.376 -19.761 1.00172.89 N
ATOM 6935 CA GLY C 85 -17.500 64.893 -18.394 1.00173.09 C
ATOM 6936 C GLY C 85 -18.644 65.494 -17.605 1.00173.13 C
ATOM 6937 O GLY C 85 -18.492 65.834 -16.433 1.00173.99 O
ATOM 6938 N LEU C 86 -19.796 65.623 -18.253 1.00172.53 N
ATOM 6939 CA LEU C 86 -20.976 66.184 -17.610 1.00173.07 C
ATOM 6940 C LEU C 86 -21.886 65.077 -17.089 1.00173.90 C
ATOM 6941 O LEU C 86 -22.085 64.064 -17.760 1.00174.90 O
ATOM 6942 CB LEU C 86 -21.744 67.077 -18.586 1.00173.04 C
ATOM 6943 CG LEU C 86 -21.308 68.526 -18.821 1.00173.51 C
ATOM 6944 CD1 LEU C 86 -19.863 68.781 -18.413 1.00174.02 C
ATOM 6945 CD2 LEU C 86 -21.516 68.870 -20.282 1.00173.73 C
ATOM 6946 N ILE C 87 -22.443 65.275 -15.898 1.00173.44 N
ATOM 6947 CA ILE C 87 -23.353 64.297 -15.310 1.00173.02 C
ATOM 6948 C ILE C 87 -24.550 64.971 -14.647 1.00172.58 C
ATOM 6949 O ILE C 87 -25.487 64.301 -14.213 1.00172.57 O
ATOM 6950 CB ILE C 87 -22.641 63.411 -14.265 1.00173.69 C
ATOM 6951 CG1 ILE C 87 -21.926 64.280 -13.228 1.00173.59 C
ATOM 6952 CG2 ILE C 87 -21.647 62.473 -14.934 1.00173.81 C
ATOM 6953 CD1 ILE C 87 -21.343 63.497 -12.071 1.00173.54 C
ATOM 6954 N LEU C 88 -24.524 66.298 -14.584 1.00172.79 N
ATOM 6955 CA LEU C 88 -25.620 67.046 -13.978 1.00173.48 C
ATOM 6956 C LEU C 88 -26.388 67.847 -15.021 1.00173.86 C
ATOM 6957 O LEU C 88 -27.617 67.841 -15.034 1.00174.03 O
ATOM 6958 CB LEU C 88 -25.101 67.976 -12.881 1.00173.89 C
ATOM 6959 CG LEU C 88 -24.364 67.313 -11.716 1.00173.93 C
ATOM 6960 CD1 LEU C 88 -24.242 68.277 -10.548 1.00173.49 C
ATOM 6961 CD2 LEU C 88 -25.056 66.028 -11.286 1.00174.00 C
ATOM 6962 N ILE C 89 -25.660 68.547 -15.884 1.00174.33 N
ATOM 6963 CA ILE C 89 -26.279 69.249 -17.002 1.00174.60 C
ATOM 6964 C ILE C 89 -27.063 68.299 -17.928 1.00174.27 C
ATOM 6965 O ILE C 89 -28.135 68.667 -18.411 1.00174.09 O
ATOM 6966 CB ILE C 89 -25.233 70.034 -17.831 1.00174.64 C
ATOM 6967 CG1 ILE C 89 -24.383 70.920 -16.920 1.00174.73 C
ATOM 6968 CG2 ILE C 89 -25.918 70.889 -18.884 1.00174.24 C
ATOM 6969 CD1 ILE C 89 -23.456 71.855 -17.673 1.00174.55 C
ATOM 6970 N PRO C 90 -26.548 67.076 -18.179 1.00174.25 N
ATOM 6971 CA PRO C 90 -27.409 66.168 -18.945 1.00173.78 C
ATOM 6972 C PRO C 90 -28.630 65.692 -18.164 1.00173.34 C
ATOM 6973 O PRO C 90 -29.596 65.243 -18.775 1.00173.16 O
ATOM 6974 CB PRO C 90 -26.479 64.991 -19.261 1.00174.19 C
ATOM 6975 CG PRO C 90 -25.435 65.044 -18.206 1.00174.34 C
ATOM 6976 CD PRO C 90 -25.201 66.505 -18.009 1.00174.57 C
ATOM 6977 N HIS C 91 -28.590 65.788 -16.839 1.00172.98 N
ATOM 6978 CA HIS C 91 -29.748 65.438 -16.027 1.00173.21 C
ATOM 6979 C HIS C 91 -30.826 66.501 -16.194 1.00173.33 C
ATOM 6980 O HIS C 91 -32.019 66.202 -16.174 1.00173.53 O
ATOM 6981 CB HIS C 91 -29.364 65.301 -14.552 1.00173.80 C
ATOM 6982 CG HIS C 91 -29.142 63.889 -14.109 1.00173.96 C
ATOM 6983 ND1 HIS C 91 -28.013 63.171 -14.441 1.00173.60 N
ATOM 6984 CD2 HIS C 91 -29.904 63.063 -13.353 1.00174.15 C
ATOM 6985 CE1 HIS C 91 -28.091 61.964 -13.910 1.00173.62 C
ATOM 6986 NE2 HIS C 91 -29.229 61.872 -13.246 1.00173.76 N
ATOM 6987 N ILE C 92 -30.388 67.744 -16.368 1.00173.43 N
ATOM 6988 CA ILE C 92 -31.295 68.866 -16.573 1.00173.96 C
ATOM 6989 C ILE C 92 -31.865 68.837 -17.986 1.00174.32 C
ATOM 6990 O ILE C 92 -33.052 69.094 -18.195 1.00174.40 O
ATOM 6991 CB ILE C 92 -30.588 70.213 -16.329 1.00174.10 C
ATOM 6992 CG1 ILE C 92 -29.968 70.251 -14.931 1.00174.15 C
ATOM 6993 CG2 ILE C 92 -31.555 71.369 -16.511 1.00173.98 C
ATOM 6994 CD1 ILE C 92 -29.163 71.501 -14.657 1.00174.02 C
ATOM 6995 N ALA C 93 -31.003 68.528 -18.952 1.00174.67 N
ATOM 6996 CA ALA C 93 -31.391 68.419 -20.356 1.00175.10 C
ATOM 6997 C ALA C 93 -32.549 67.442 -20.570 1.00174.89 C
ATOM 6998 O ALA C 93 -33.439 67.695 -21.381 1.00175.08 O
ATOM 6999 CB ALA C 93 -30.191 68.003 -21.198 1.00175.48 C
ATOM 7000 N THR C 94 -32.525 66.327 -19.844 1.00174.36 N
ATOM 7001 CA THR C 94 -33.570 65.309 -19.942 1.00173.78 C
ATOM 7002 C THR C 94 -34.947 65.868 -19.609 1.00173.99 C
ATOM 7003 O THR C 94 -35.957 65.437 -20.165 1.00173.42 O
ATOM 7004 CB THR C 94 -33.291 64.118 -19.005 1.00173.13 C
ATOM 7005 OG1 THR C 94 -33.136 64.592 -17.661 1.00172.71 O
ATOM 7006 CG2 THR C 94 -32.030 63.390 -19.426 1.00173.51 C
ATOM 7007 N LEU C 95 -34.978 66.826 -18.689 1.00174.33 N
ATOM 7008 CA LEU C 95 -36.225 67.442 -18.252 1.00174.27 C
ATOM 7009 C LEU C 95 -36.706 68.527 -19.213 1.00175.40 C
ATOM 7010 O LEU C 95 -37.611 69.293 -18.885 1.00175.81 O
ATOM 7011 CB LEU C 95 -36.057 68.032 -16.853 1.00173.37 C
ATOM 7012 CG LEU C 95 -35.718 67.013 -15.767 1.00173.53 C
ATOM 7013 CD1 LEU C 95 -35.389 67.709 -14.454 1.00174.53 C
ATOM 7014 CD2 LEU C 95 -36.858 66.025 -15.591 1.00173.75 C
ATOM 7015 N GLY C 96 -36.103 68.586 -20.397 1.00175.25 N
ATOM 7016 CA GLY C 96 -36.454 69.594 -21.381 1.00174.33 C
ATOM 7017 C GLY C 96 -36.081 70.993 -20.927 1.00174.39 C
ATOM 7018 O GLY C 96 -36.950 71.818 -20.646 1.00174.83 O
ATOM 7019 N TRP C 97 -34.781 71.259 -20.861 1.00174.06 N
ATOM 7020 CA TRP C 97 -34.287 72.554 -20.405 1.00174.50 C
ATOM 7021 C TRP C 97 -33.002 72.951 -21.119 1.00174.51 C
ATOM 7022 O TRP C 97 -31.955 72.332 -20.927 1.00174.02 O
ATOM 7023 CB TRP C 97 -34.053 72.534 -18.892 1.00174.27 C
ATOM 7024 CG TRP C 97 -35.185 73.103 -18.092 1.00173.98 C
ATOM 7025 CD1 TRP C 97 -36.094 74.032 -18.504 1.00174.02 C
ATOM 7026 CD2 TRP C 97 -35.526 72.780 -16.739 1.00173.49 C
ATOM 7027 NE1 TRP C 97 -36.980 74.309 -17.491 1.00173.41 N
ATOM 7028 CE2 TRP C 97 -36.653 73.553 -16.397 1.00173.42 C
ATOM 7029 CE3 TRP C 97 -34.989 71.912 -15.783 1.00173.71 C
ATOM 7030 CZ2 TRP C 97 -37.253 73.484 -15.141 1.00173.75 C
ATOM 7031 CZ3 TRP C 97 -35.585 71.845 -14.538 1.00174.33 C
ATOM 7032 CH2 TRP C 97 -36.705 72.626 -14.228 1.00174.35 C
ATOM 7033 N GLY C 98 -33.093 73.987 -21.946 1.00174.76 N
ATOM 7034 CA GLY C 98 -31.935 74.524 -22.637 1.00174.89 C
ATOM 7035 C GLY C 98 -31.512 73.713 -23.845 1.00175.11 C
ATOM 7036 O GLY C 98 -30.444 73.941 -24.413 1.00175.50 O
ATOM 7037 N VAL C 99 -32.352 72.764 -24.242 1.00174.50 N
ATOM 7038 CA VAL C 99 -32.049 71.916 -25.387 1.00173.66 C
ATOM 7039 C VAL C 99 -33.184 71.935 -26.401 1.00172.81 C
ATOM 7040 O VAL C 99 -34.288 72.393 -26.106 1.00172.39 O
ATOM 7041 CB VAL C 99 -31.780 70.459 -24.960 1.00173.36 C
ATOM 7042 CG1 VAL C 99 -30.542 70.381 -24.075 1.00173.18 C
ATOM 7043 CG2 VAL C 99 -32.997 69.879 -24.256 1.00173.81 C
ATOM 7044 N GLY C 100 -32.904 71.434 -27.599 1.00172.67 N
ATOM 7045 CA GLY C 100 -33.898 71.389 -28.654 1.00173.30 C
ATOM 7046 C GLY C 100 -33.738 70.168 -29.537 1.00173.67 C
ATOM 7047 O GLY C 100 -33.432 69.083 -29.044 1.00174.07 O
ATOM 7048 N PRO C 101 -33.951 70.340 -30.851 1.00173.92 N
ATOM 7049 CA PRO C 101 -33.817 69.291 -31.868 1.00174.15 C
ATOM 7050 C PRO C 101 -32.498 68.524 -31.788 1.00174.61 C
ATOM 7051 O PRO C 101 -31.429 69.130 -31.829 1.00174.40 O
ATOM 7052 CB PRO C 101 -33.905 70.077 -33.177 1.00174.62 C
ATOM 7053 CG PRO C 101 -34.774 71.236 -32.840 1.00174.99 C
ATOM 7054 CD PRO C 101 -34.353 71.625 -31.449 1.00174.63 C
ATOM 7055 N GLY C 102 -32.586 67.201 -31.683 1.00174.68 N
ATOM 7056 CA GLY C 102 -31.412 66.347 -31.628 1.00174.31 C
ATOM 7057 C GLY C 102 -30.495 66.594 -30.442 1.00173.99 C
ATOM 7058 O GLY C 102 -29.322 66.220 -30.470 1.00174.19 O
ATOM 7059 N GLY C 103 -31.026 67.224 -29.401 1.00173.75 N
ATOM 7060 CA GLY C 103 -30.257 67.488 -28.199 1.00173.33 C
ATOM 7061 C GLY C 103 -29.363 68.702 -28.338 1.00172.99 C
ATOM 7062 O GLY C 103 -28.399 68.866 -27.590 1.00172.81 O
ATOM 7063 N GLU C 104 -29.688 69.557 -29.301 1.00172.88 N
ATOM 7064 CA GLU C 104 -28.924 70.773 -29.539 1.00173.45 C
ATOM 7065 C GLU C 104 -29.121 71.753 -28.390 1.00173.40 C
ATOM 7066 O GLU C 104 -30.251 72.073 -28.023 1.00173.52 O
ATOM 7067 CB GLU C 104 -29.337 71.416 -30.865 1.00174.16 C
ATOM 7068 CG GLU C 104 -28.240 71.454 -31.922 1.00173.41 C
ATOM 7069 CD GLU C 104 -27.346 72.674 -31.795 1.00173.95 C
ATOM 7070 OE1 GLU C 104 -26.457 72.850 -32.655 1.00173.18 O
ATOM 7071 OE2 GLU C 104 -27.533 73.457 -30.841 1.00174.60 O
ATOM 7072 N VAL C 105 -28.016 72.229 -27.828 1.00173.12 N
ATOM 7073 CA VAL C 105 -28.072 73.140 -26.692 1.00173.27 C
ATOM 7074 C VAL C 105 -28.431 74.551 -27.151 1.00173.53 C
ATOM 7075 O VAL C 105 -27.683 75.181 -27.899 1.00173.49 O
ATOM 7076 CB VAL C 105 -26.737 73.165 -25.926 1.00172.83 C
ATOM 7077 CG1 VAL C 105 -26.720 74.306 -24.925 1.00172.95 C
ATOM 7078 CG2 VAL C 105 -26.514 71.837 -25.221 1.00173.20 C
ATOM 7079 N VAL C 106 -29.587 75.036 -26.707 1.00173.56 N
ATOM 7080 CA VAL C 106 -30.087 76.344 -27.119 1.00173.43 C
ATOM 7081 C VAL C 106 -29.736 77.447 -26.126 1.00173.93 C
ATOM 7082 O VAL C 106 -29.084 78.426 -26.480 1.00174.86 O
ATOM 7083 CB VAL C 106 -31.614 76.324 -27.309 1.00173.01 C
ATOM 7084 CG1 VAL C 106 -32.098 77.658 -27.861 1.00173.01 C
ATOM 7085 CG2 VAL C 106 -32.019 75.183 -28.226 1.00173.52 C
ATOM 7086 N ASP C 107 -30.179 77.287 -24.883 1.00173.53 N
ATOM 7087 CA ASP C 107 -29.997 78.319 -23.869 1.00173.60 C
ATOM 7088 C ASP C 107 -29.406 77.743 -22.581 1.00173.56 C
ATOM 7089 O ASP C 107 -30.000 76.869 -21.954 1.00173.29 O
ATOM 7090 CB ASP C 107 -31.331 79.016 -23.588 1.00173.90 C
ATOM 7091 CG ASP C 107 -31.209 80.130 -22.569 1.00174.06 C
ATOM 7092 OD1 ASP C 107 -30.337 81.008 -22.740 1.00173.56 O
ATOM 7093 OD2 ASP C 107 -32.005 80.140 -21.608 1.00174.36 O
ATOM 7094 N THR C 108 -28.234 78.237 -22.194 1.00173.87 N
ATOM 7095 CA THR C 108 -27.517 77.707 -21.037 1.00174.09 C
ATOM 7096 C THR C 108 -27.979 78.329 -19.720 1.00174.42 C
ATOM 7097 O THR C 108 -27.452 78.004 -18.654 1.00174.15 O
ATOM 7098 CB THR C 108 -25.997 77.922 -21.170 1.00174.03 C
ATOM 7099 OG1 THR C 108 -25.700 79.323 -21.146 1.00174.27 O
ATOM 7100 CG2 THR C 108 -25.484 77.319 -22.469 1.00173.59 C
ATOM 7101 N PHE C 109 -28.956 79.225 -19.797 1.00174.73 N
ATOM 7102 CA PHE C 109 -29.481 79.901 -18.611 1.00174.51 C
ATOM 7103 C PHE C 109 -30.158 78.959 -17.597 1.00174.25 C
ATOM 7104 O PHE C 109 -29.896 79.079 -16.400 1.00173.96 O
ATOM 7105 CB PHE C 109 -30.450 81.013 -19.027 1.00174.50 C
ATOM 7106 CG PHE C 109 -30.947 81.846 -17.879 1.00174.54 C
ATOM 7107 CD1 PHE C 109 -30.082 82.669 -17.177 1.00174.49 C
ATOM 7108 CD2 PHE C 109 -32.281 81.812 -17.509 1.00174.52 C
ATOM 7109 CE1 PHE C 109 -30.539 83.440 -16.124 1.00174.40 C
ATOM 7110 CE2 PHE C 109 -32.744 82.581 -16.459 1.00174.79 C
ATOM 7111 CZ PHE C 109 -31.871 83.396 -15.765 1.00174.83 C
ATOM 7112 N PRO C 110 -31.033 78.032 -18.054 1.00174.41 N
ATOM 7113 CA PRO C 110 -31.627 77.102 -17.084 1.00174.46 C
ATOM 7114 C PRO C 110 -30.589 76.297 -16.307 1.00173.80 C
ATOM 7115 O PRO C 110 -30.815 75.959 -15.145 1.00173.55 O
ATOM 7116 CB PRO C 110 -32.472 76.181 -17.964 1.00174.30 C
ATOM 7117 CG PRO C 110 -32.854 77.032 -19.110 1.00173.89 C
ATOM 7118 CD PRO C 110 -31.618 77.832 -19.394 1.00174.07 C
ATOM 7119 N PHE C 111 -29.465 75.995 -16.946 1.00173.33 N
ATOM 7120 CA PHE C 111 -28.375 75.297 -16.283 1.00173.12 C
ATOM 7121 C PHE C 111 -27.783 76.180 -15.191 1.00173.93 C
ATOM 7122 O PHE C 111 -27.587 75.737 -14.060 1.00174.27 O
ATOM 7123 CB PHE C 111 -27.299 74.896 -17.290 1.00173.44 C
ATOM 7124 CG PHE C 111 -27.810 74.029 -18.404 1.00173.78 C
ATOM 7125 CD1 PHE C 111 -28.764 73.055 -18.161 1.00173.86 C
ATOM 7126 CD2 PHE C 111 -27.340 74.193 -19.695 1.00174.48 C
ATOM 7127 CE1 PHE C 111 -29.237 72.258 -19.186 1.00174.67 C
ATOM 7128 CE2 PHE C 111 -27.808 73.399 -20.725 1.00174.80 C
ATOM 7129 CZ PHE C 111 -28.759 72.430 -20.470 1.00174.78 C
ATOM 7130 N PHE C 112 -27.501 77.431 -15.545 1.00174.16 N
ATOM 7131 CA PHE C 112 -26.983 78.415 -14.598 1.00174.16 C
ATOM 7132 C PHE C 112 -27.922 78.604 -13.408 1.00173.98 C
ATOM 7133 O PHE C 112 -27.476 78.684 -12.265 1.00174.03 O
ATOM 7134 CB PHE C 112 -26.750 79.758 -15.295 1.00173.82 C
ATOM 7135 CG PHE C 112 -26.171 80.814 -14.397 1.00173.93 C
ATOM 7136 CD1 PHE C 112 -24.855 80.737 -13.973 1.00173.76 C
ATOM 7137 CD2 PHE C 112 -26.942 81.887 -13.978 1.00174.09 C
ATOM 7138 CE1 PHE C 112 -24.320 81.706 -13.146 1.00173.52 C
ATOM 7139 CE2 PHE C 112 -26.412 82.859 -13.151 1.00173.98 C
ATOM 7140 CZ PHE C 112 -25.099 82.767 -12.734 1.00173.56 C
ATOM 7141 N VAL C 113 -29.221 78.680 -13.689 1.00174.08 N
ATOM 7142 CA VAL C 113 -30.234 78.850 -12.649 1.00174.22 C
ATOM 7143 C VAL C 113 -30.241 77.692 -11.653 1.00173.92 C
ATOM 7144 O VAL C 113 -30.025 77.898 -10.461 1.00174.07 O
ATOM 7145 CB VAL C 113 -31.642 78.994 -13.249 1.00174.66 C
ATOM 7146 CG1 VAL C 113 -32.689 78.979 -12.147 1.00174.57 C
ATOM 7147 CG2 VAL C 113 -31.741 80.280 -14.041 1.00174.53 C
ATOM 7148 N VAL C 114 -30.507 76.485 -12.147 1.00173.77 N
ATOM 7149 CA VAL C 114 -30.519 75.279 -11.320 1.00173.95 C
ATOM 7150 C VAL C 114 -29.281 75.185 -10.423 1.00173.93 C
ATOM 7151 O VAL C 114 -29.371 74.795 -9.258 1.00173.83 O
ATOM 7152 CB VAL C 114 -30.615 74.008 -12.195 1.00174.05 C
ATOM 7153 CG1 VAL C 114 -30.421 72.758 -11.354 1.00174.05 C
ATOM 7154 CG2 VAL C 114 -31.952 73.960 -12.921 1.00173.70 C
ATOM 7155 N GLY C 115 -28.131 75.564 -10.969 1.00173.63 N
ATOM 7156 CA GLY C 115 -26.890 75.564 -10.216 1.00173.46 C
ATOM 7157 C GLY C 115 -26.865 76.575 -9.083 1.00173.81 C
ATOM 7158 O GLY C 115 -26.608 76.217 -7.934 1.00173.28 O
ATOM 7159 N VAL C 116 -27.133 77.838 -9.405 1.00174.62 N
ATOM 7160 CA VAL C 116 -27.074 78.911 -8.410 1.00174.40 C
ATOM 7161 C VAL C 116 -28.174 78.823 -7.345 1.00173.68 C
ATOM 7162 O VAL C 116 -27.923 79.113 -6.177 1.00172.91 O
ATOM 7163 CB VAL C 116 -27.124 80.313 -9.078 1.00174.44 C
ATOM 7164 CG1 VAL C 116 -25.932 80.504 -10.002 1.00174.67 C
ATOM 7165 CG2 VAL C 116 -28.429 80.531 -9.831 1.00174.12 C
ATOM 7166 N VAL C 117 -29.379 78.426 -7.743 1.00174.14 N
ATOM 7167 CA VAL C 117 -30.489 78.298 -6.804 1.00174.15 C
ATOM 7168 C VAL C 117 -30.157 77.274 -5.727 1.00174.41 C
ATOM 7169 O VAL C 117 -30.328 77.535 -4.536 1.00174.50 O
ATOM 7170 CB VAL C 117 -31.801 77.899 -7.509 1.00173.75 C
ATOM 7171 CG1 VAL C 117 -32.906 77.665 -6.490 1.00173.46 C
ATOM 7172 CG2 VAL C 117 -32.213 78.972 -8.503 1.00173.44 C
ATOM 7173 N HIS C 118 -29.698 76.102 -6.157 1.00174.78 N
ATOM 7174 CA HIS C 118 -29.230 75.075 -5.233 1.00174.78 C
ATOM 7175 C HIS C 118 -28.152 75.593 -4.299 1.00174.60 C
ATOM 7176 O HIS C 118 -28.306 75.557 -3.079 1.00174.49 O
ATOM 7177 CB HIS C 118 -28.693 73.870 -5.996 1.00174.80 C
ATOM 7178 CG HIS C 118 -29.728 72.833 -6.281 1.00174.36 C
ATOM 7179 ND1 HIS C 118 -30.671 72.975 -7.276 1.00174.05 N
ATOM 7180 CD2 HIS C 118 -29.989 71.649 -5.679 1.00173.90 C
ATOM 7181 CE1 HIS C 118 -31.455 71.912 -7.288 1.00173.67 C
ATOM 7182 NE2 HIS C 118 -31.065 71.095 -6.327 1.00173.21 N
ATOM 7183 N LEU C 119