PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2022-05-13
Number of transmembrane proteins: 7231 (alpha: 6680 , beta: 496 )
Content of 4tnj
HEADER    ELECTRON TRANSPORT,PHOTOSYNTHESIS       04-JUN-14   4TNJ              
TITLE RT XFEL STRUCTURE OF PHOTOSYSTEM II 500 MS AFTER THE 2ND ILLUMINATION
TITLE 2 (2F) AT 4.5 A RESOLUTION
COMPND MOL_ID: 1;
COMPND 2 MOLECULE: PHOTOSYSTEM Q(B) PROTEIN 1;
COMPND 3 CHAIN: A, a;
COMPND 4 FRAGMENT: UNP RESIDUES 1-344;
COMPND 5 SYNONYM: 32 KDA THYLAKOID MEMBRANE PROTEIN 1,PHOTOSYSTEM II PROTEIN
COMPND 6 D1 1;
COMPND 7 EC: 1.10.3.9;
COMPND 8 MOL_ID: 2;
COMPND 9 MOLECULE: PHOTOSYSTEM II CORE LIGHT HARVESTING PROTEIN;
COMPND 10 CHAIN: B, b;
COMPND 11 MOL_ID: 3;
COMPND 12 MOLECULE: PHOTOSYSTEM II CP43 PROTEIN;
COMPND 13 CHAIN: C, c;
COMPND 14 MOL_ID: 4;
COMPND 15 MOLECULE: PHOTOSYSTEM II D2 PROTEIN;
COMPND 16 CHAIN: D, d;
COMPND 17 SYNONYM: PSII D2 PROTEIN,PHOTOSYSTEM Q(A) PROTEIN;
COMPND 18 EC: 1.10.3.9;
COMPND 19 MOL_ID: 5;
COMPND 20 MOLECULE: CYTOCHROME B559 SUBUNIT ALPHA;
COMPND 21 CHAIN: E, e;
COMPND 22 SYNONYM: PSII REACTION CENTER SUBUNIT V;
COMPND 23 MOL_ID: 6;
COMPND 24 MOLECULE: CYTOCHROME B559 SUBUNIT BETA;
COMPND 25 CHAIN: F, f;
COMPND 26 SYNONYM: PSII REACTION CENTER SUBUNIT VI;
COMPND 27 MOL_ID: 7;
COMPND 28 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN H;
COMPND 29 CHAIN: H, h;
COMPND 30 SYNONYM: PSII-H;
COMPND 31 MOL_ID: 8;
COMPND 32 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN I;
COMPND 33 CHAIN: I, i;
COMPND 34 SYNONYM: PSII-I,PSII 4.4 KDA PROTEIN;
COMPND 35 MOL_ID: 9;
COMPND 36 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN J;
COMPND 37 CHAIN: J, j;
COMPND 38 SYNONYM: PSII-J;
COMPND 39 MOL_ID: 10;
COMPND 40 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN K;
COMPND 41 CHAIN: K, k;
COMPND 42 SYNONYM: PSII-K;
COMPND 43 MOL_ID: 11;
COMPND 44 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN L;
COMPND 45 CHAIN: L, l;
COMPND 46 SYNONYM: PSII-L,PSII 5 KDA PROTEIN;
COMPND 47 MOL_ID: 12;
COMPND 48 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN M;
COMPND 49 CHAIN: M, m;
COMPND 50 SYNONYM: PSII-M;
COMPND 51 MOL_ID: 13;
COMPND 52 MOLECULE: PHOTOSYSTEM II MANGANESE-STABILIZING POLYPEPTIDE;
COMPND 53 CHAIN: O, o;
COMPND 54 SYNONYM: MSP;
COMPND 55 MOL_ID: 14;
COMPND 56 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN T;
COMPND 57 CHAIN: T, t;
COMPND 58 SYNONYM: PSII-TC;
COMPND 59 MOL_ID: 15;
COMPND 60 MOLECULE: PHOTOSYSTEM II 12 KDA EXTRINSIC PROTEIN;
COMPND 61 CHAIN: U, u;
COMPND 62 SYNONYM: PS II COMPLEX 12 KDA EXTRINSIC PROTEIN,PSII-U;
COMPND 63 MOL_ID: 16;
COMPND 64 MOLECULE: CYTOCHROME C-550;
COMPND 65 CHAIN: V, v;
COMPND 66 SYNONYM: CYTOCHROME C-549,CYTOCHROME C550,LOW-POTENTIAL CYTOCHROME C;
COMPND 67 MOL_ID: 17;
COMPND 68 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN YCF12;
COMPND 69 CHAIN: y, g;
COMPND 70 MOL_ID: 18;
COMPND 71 MOLECULE: PHOTOSYSTEM II REACTION CENTER X PROTEIN;
COMPND 72 CHAIN: X, x;
COMPND 73 MOL_ID: 19;
COMPND 74 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN Y;
COMPND 75 CHAIN: Y, G;
COMPND 76 FRAGMENT: SEE REMARK 999;
COMPND 77 MOL_ID: 20;
COMPND 78 MOLECULE: PHOTOSYSTEM II REACTION CENTER PROTEIN Z;
COMPND 79 CHAIN: Z, z;
COMPND 80 SYNONYM: PSII-Z
SOURCE MOL_ID: 1;
SOURCE 2 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 3 ORGANISM_TAXID: 197221;
SOURCE 4 STRAIN: BP-1;
SOURCE 5 MOL_ID: 2;
SOURCE 6 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 7 ORGANISM_TAXID: 197221;
SOURCE 8 STRAIN: BP-1;
SOURCE 9 MOL_ID: 3;
SOURCE 10 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 11 ORGANISM_TAXID: 197221;
SOURCE 12 STRAIN: BP-1;
SOURCE 13 MOL_ID: 4;
SOURCE 14 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 15 ORGANISM_TAXID: 197221;
SOURCE 16 STRAIN: BP-1;
SOURCE 17 MOL_ID: 5;
SOURCE 18 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 19 ORGANISM_TAXID: 197221;
SOURCE 20 STRAIN: BP-1;
SOURCE 21 MOL_ID: 6;
SOURCE 22 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 23 ORGANISM_TAXID: 197221;
SOURCE 24 STRAIN: BP-1;
SOURCE 25 MOL_ID: 7;
SOURCE 26 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 27 ORGANISM_TAXID: 197221;
SOURCE 28 STRAIN: BP-1;
SOURCE 29 MOL_ID: 8;
SOURCE 30 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 31 ORGANISM_TAXID: 197221;
SOURCE 32 STRAIN: BP-1;
SOURCE 33 MOL_ID: 9;
SOURCE 34 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 35 ORGANISM_TAXID: 197221;
SOURCE 36 STRAIN: BP-1;
SOURCE 37 MOL_ID: 10;
SOURCE 38 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 39 ORGANISM_TAXID: 197221;
SOURCE 40 STRAIN: BP-1;
SOURCE 41 MOL_ID: 11;
SOURCE 42 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 43 ORGANISM_TAXID: 197221;
SOURCE 44 STRAIN: BP-1;
SOURCE 45 MOL_ID: 12;
SOURCE 46 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 47 ORGANISM_TAXID: 197221;
SOURCE 48 STRAIN: BP-1;
SOURCE 49 MOL_ID: 13;
SOURCE 50 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 51 ORGANISM_TAXID: 197221;
SOURCE 52 STRAIN: BP-1;
SOURCE 53 MOL_ID: 14;
SOURCE 54 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 55 ORGANISM_TAXID: 197221;
SOURCE 56 STRAIN: BP-1;
SOURCE 57 MOL_ID: 15;
SOURCE 58 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 59 ORGANISM_TAXID: 197221;
SOURCE 60 STRAIN: BP-1;
SOURCE 61 MOL_ID: 16;
SOURCE 62 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 63 ORGANISM_TAXID: 197221;
SOURCE 64 STRAIN: BP-1;
SOURCE 65 MOL_ID: 17;
SOURCE 66 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 67 ORGANISM_TAXID: 197221;
SOURCE 68 STRAIN: BP-1;
SOURCE 69 MOL_ID: 18;
SOURCE 70 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 71 ORGANISM_TAXID: 197221;
SOURCE 72 STRAIN: BP-1;
SOURCE 73 MOL_ID: 19;
SOURCE 74 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 75 ORGANISM_TAXID: 197221;
SOURCE 76 STRAIN: BP-1;
SOURCE 77 MOL_ID: 20;
SOURCE 78 ORGANISM_SCIENTIFIC: THERMOSYNECHOCOCCUS ELONGATUS;
SOURCE 79 ORGANISM_TAXID: 197221;
SOURCE 80 STRAIN: BP-1
KEYWDS PHOTOSYNTHESIS, WATER OXIDATION, MEMBRANE PROTEIN, X-RAY FREE
KEYWDS 2 ELECTRON LASER, ELECTRON TRANSPORT
EXPDTA X-RAY DIFFRACTION
AUTHOR J.KERN,R.TRAN,R.ALONSO-MORI,S.KOROIDOV,N.ECHOLS,J.HATTNE,M.IBRAHIM,
AUTHOR 2 S.GUL,H.LAKSMONO,R.G.SIERRA,R.J.GILDEA,G.HAN,J.HELLMICH,B.LASSALLE-
AUTHOR 3 KAISER,R.CHATTERJEE,A.BREWSTER,C.A.STAN,C.GLOECKNER,A.LAMPE,
AUTHOR 4 D.DIFIORE,D.MILATHIANAKI,A.R.FRY,M.M.SEIBERT,J.E.KOGLIN,E.GALLO,
AUTHOR 5 J.UHLIG,D.SOKARAS,T.-C.WENG,P.H.ZWART,D.E.SKINNER,M.J.BOGAN,
AUTHOR 6 M.MESSERSCHMIDT,P.GLATZEL,G.J.WILLIAMS,S.BOUTET,P.D.ADAMS,A.ZOUNI,
AUTHOR 7 J.MESSINGER,N.K.SAUTER,U.BERGMANN,J.YANO,V.K.YACHANDRA
REVDAT 1 09-JUL-14 4TNJ 0
JRNL AUTH J.KERN,R.TRAN,R.ALONSO-MORI,S.KOROIDOV,N.ECHOLS,J.HATTNE,
JRNL AUTH 2 M.IBRAHIM,S.GUL,H.LAKSMONO,R.G.SIERRA,R.J.GILDEA,G.HAN,
JRNL AUTH 3 J.HELLMICH,B.LASSALLE-KAISER,R.CHATTERJEE,A.BREWSTER,
JRNL AUTH 4 C.A.STAN,C.GLOECKNER,A.LAMPE,D.DIFIORE,D.MILATHIANAKI,
JRNL AUTH 5 A.R.FRY,M.M.SEIBERT,J.E.KOGLIN,E.GALLO,J.UHLIG,D.SOKARAS,
JRNL AUTH 6 T.-C.WENG,P.H.ZWART,D.E.SKINNER,M.J.BOGAN,M.MESSERSCHMIDT,
JRNL AUTH 7 P.GLATZEL,G.J.WILLIAMS,S.BOUTET,P.D.ADAMS,A.ZOUNI,
JRNL AUTH 8 J.MESSINGER,N.K.SAUTER,U.BERGMANN,J.YANO,V.K.YACHANDRA
JRNL TITL TAKING SNAPSHOTS OF PHOTOSYNTHETIC WATER OXIDATION USING
JRNL TITL 2 FEMTOSECOND X-RAY DIFFRACTION AND SPECTROSCOPY
JRNL REF NATURE COMMUNICATIONS 2014
JRNL REFN ESSN 2041-1723
JRNL DOI 10.1038/NCOMMS5371
REMARK 1
REMARK 1 REFERENCE 1
REMARK 1 AUTH P.V.AFONINE,R.W.GROSSE-KUNSTLEVE,N.ECHOLS,J.J.HEADD,
REMARK 1 AUTH 2 N.W.MORIARTY,M.MUSTYAKIMOV,T.C.TERWILLIGER,A.URZHUMTSEV,
REMARK 1 AUTH 3 P.H.ZWART,P.D.ADAMS
REMARK 1 TITL TOWARDS AUTOMATED CRYSTALLOGRAPHIC STRUCTURE REFINEMENT WITH
REMARK 1 TITL 2 PHENIX.REFINE.
REMARK 1 REF ACTA CRYSTALLOGR. D BIOL. V. 68 352 2012
REMARK 1 REF 2 CRYSTALLOGR.
REMARK 1 REFN ESSN 1399-0047
REMARK 1 PMID 22505256
REMARK 1 DOI 10.1107/S0907444912001308
REMARK 1 REFERENCE 2
REMARK 1 AUTH P.D.ADAMS,P.V.AFONINE,G.BUNKOCZI,V.B.CHEN,I.W.DAVIS,
REMARK 1 AUTH 2 N.ECHOLS,J.J.HEADD,L.W.HUNG,G.J.KAPRAL,R.W.GROSSE-KUNSTLEVE,
REMARK 1 AUTH 3 A.J.MCCOY,N.W.MORIARTY,R.OEFFNER,R.J.READ,D.C.RICHARDSON,
REMARK 1 AUTH 4 J.S.RICHARDSON,T.C.TERWILLIGER,P.H.ZWART
REMARK 1 TITL PHENIX: A COMPREHENSIVE PYTHON-BASED SYSTEM FOR
REMARK 1 TITL 2 MACROMOLECULAR STRUCTURE SOLUTION.
REMARK 1 REF ACTA CRYSTALLOGR. D BIOL. V. 66 213 2010
REMARK 1 REF 2 CRYSTALLOGR.
REMARK 1 REFN ESSN 1399-0047
REMARK 1 PMID 20124702
REMARK 1 DOI 10.1107/S0907444909052925
REMARK 2
REMARK 2 RESOLUTION. 4.50 ANGSTROMS.
REMARK 3
REMARK 3 REFINEMENT.
REMARK 3 PROGRAM : PHENIX (PHENIX.REFINE: DEV_1635+SVN)
REMARK 3 AUTHORS : PAUL ADAMS,PAVEL AFONINE,VINCENT CHEN,IAN
REMARK 3 : DAVIS,KRESHNA GOPAL,RALF GROSSE-KUNSTLEVE,
REMARK 3 : LI-WEI HUNG,ROBERT IMMORMINO,TOM IOERGER,
REMARK 3 : AIRLIE MCCOY,ERIK MCKEE,NIGEL MORIARTY,
REMARK 3 : REETAL PAI,RANDY READ,JANE RICHARDSON,
REMARK 3 : DAVID RICHARDSON,TOD ROMO,JIM SACCHETTINI,
REMARK 3 : NICHOLAS SAUTER,JACOB SMITH,LAURENT
REMARK 3 : STORONI,TOM TERWILLIGER,PETER ZWART
REMARK 3
REMARK 3 REFINEMENT TARGET : NULL
REMARK 3
REMARK 3 DATA USED IN REFINEMENT.
REMARK 3 RESOLUTION RANGE HIGH (ANGSTROMS) : 4.50
REMARK 3 RESOLUTION RANGE LOW (ANGSTROMS) : 72.97
REMARK 3 MIN(FOBS/SIGMA_FOBS) : 1.364
REMARK 3 COMPLETENESS FOR RANGE (%) : 96.8
REMARK 3 NUMBER OF REFLECTIONS : 103594
REMARK 3
REMARK 3 FIT TO DATA USED IN REFINEMENT.
REMARK 3 R VALUE (WORKING + TEST SET) : 0.276
REMARK 3 R VALUE (WORKING SET) : 0.276
REMARK 3 FREE R VALUE : 0.284
REMARK 3 FREE R VALUE TEST SET SIZE (%) : 4.896
REMARK 3 FREE R VALUE TEST SET COUNT : 5072
REMARK 3
REMARK 3 FIT TO DATA USED IN REFINEMENT (IN BINS).
REMARK 3 BIN RESOLUTION RANGE COMPL. NWORK NFREE RWORK RFREE
REMARK 3 1 72.9798 - 13.9511 1.00 3411 149 0.3138 0.3032
REMARK 3 2 13.9511 - 11.0859 1.00 3387 176 0.2272 0.2217
REMARK 3 3 11.0859 - 9.6882 1.00 3394 169 0.2200 0.2138
REMARK 3 4 9.6882 - 8.8040 1.00 3379 168 0.2079 0.2239
REMARK 3 5 8.8040 - 8.1739 1.00 3403 192 0.2234 0.2128
REMARK 3 6 8.1739 - 7.6925 1.00 3409 185 0.2346 0.2807
REMARK 3 7 7.6925 - 7.3077 1.00 3393 170 0.2384 0.2545
REMARK 3 8 7.3077 - 6.9898 1.00 3347 175 0.2458 0.2869
REMARK 3 9 6.9898 - 6.7209 1.00 3424 177 0.2569 0.2718
REMARK 3 10 6.7209 - 6.4892 1.00 3417 173 0.2707 0.3124
REMARK 3 11 6.4892 - 6.2864 1.00 3351 172 0.2636 0.2590
REMARK 3 12 6.2864 - 6.1068 1.00 3428 174 0.2777 0.2912
REMARK 3 13 6.1068 - 5.9461 1.00 3392 188 0.2801 0.3347
REMARK 3 14 5.9461 - 5.8011 1.00 3404 162 0.2907 0.2844
REMARK 3 15 5.8011 - 5.6692 1.00 3386 199 0.2995 0.3075
REMARK 3 16 5.6692 - 5.5486 1.00 3382 157 0.2873 0.3259
REMARK 3 17 5.5486 - 5.4377 1.00 3429 182 0.3082 0.3028
REMARK 3 18 5.4377 - 5.3351 1.00 3335 181 0.3038 0.3356
REMARK 3 19 5.3351 - 5.2398 1.00 3425 164 0.3126 0.3522
REMARK 3 20 5.2398 - 5.1510 1.00 3374 177 0.3080 0.3008
REMARK 3 21 5.1510 - 5.0680 0.99 3307 167 0.3202 0.2995
REMARK 3 22 5.0680 - 4.9900 0.99 3393 198 0.3254 0.3408
REMARK 3 23 4.9900 - 4.9167 0.98 3334 175 0.3196 0.3218
REMARK 3 24 4.9167 - 4.8474 0.96 3276 163 0.3395 0.2994
REMARK 3 25 4.8474 - 4.7819 0.95 3242 161 0.3352 0.3406
REMARK 3 26 4.7819 - 4.7198 0.92 3052 155 0.3489 0.3529
REMARK 3 27 4.7198 - 4.6608 0.86 2971 143 0.3623 0.3655
REMARK 3 28 4.6608 - 4.6047 0.86 2948 161 0.3564 0.3870
REMARK 3 29 4.6047 - 4.5512 0.81 2736 148 0.3683 0.3759
REMARK 3 30 4.5512 - 4.5000 0.70 2393 111 0.3779 0.4248
REMARK 3
REMARK 3 BULK SOLVENT MODELLING.
REMARK 3 METHOD USED : FLAT BULK SOLVENT MODEL
REMARK 3 SOLVENT RADIUS : 1.11
REMARK 3 SHRINKAGE RADIUS : 0.90
REMARK 3 K_SOL : NULL
REMARK 3 B_SOL : NULL
REMARK 3
REMARK 3 ERROR ESTIMATES.
REMARK 3 COORDINATE ERROR (MAXIMUM-LIKELIHOOD BASED) : 0.648
REMARK 3 PHASE ERROR (DEGREES, MAXIMUM-LIKELIHOOD BASED) : 28.666
REMARK 3
REMARK 3 B VALUES.
REMARK 3 FROM WILSON PLOT (A**2) : 152.7
REMARK 3 MEAN B VALUE (OVERALL, A**2) : 174.0
REMARK 3 OVERALL ANISOTROPIC B VALUE.
REMARK 3 B11 (A**2) : NULL
REMARK 3 B22 (A**2) : NULL
REMARK 3 B33 (A**2) : NULL
REMARK 3 B12 (A**2) : NULL
REMARK 3 B13 (A**2) : NULL
REMARK 3 B23 (A**2) : NULL
REMARK 3
REMARK 3 TWINNING INFORMATION.
REMARK 3 FRACTION: NULL
REMARK 3 OPERATOR: NULL
REMARK 3
REMARK 3 DEVIATIONS FROM IDEAL VALUES.
REMARK 3 RMSD COUNT
REMARK 3 BOND : 0.005 52088
REMARK 3 ANGLE : 0.757 71528
REMARK 3 CHIRALITY : 0.029 7238
REMARK 3 PLANARITY : 0.004 8510
REMARK 3 DIHEDRAL : 18.658 18206
REMARK 3
REMARK 3 TLS DETAILS
REMARK 3 NUMBER OF TLS GROUPS : NULL
REMARK 3
REMARK 3 NCS DETAILS
REMARK 3 NUMBER OF NCS GROUPS : 19
REMARK 3 NCS GROUP : 1
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'A'
REMARK 3 SELECTION : CHAIN 'G'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 2
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'B'
REMARK 3 SELECTION : CHAIN 'N'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 3
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'C'
REMARK 3 SELECTION : CHAIN 'P'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 4
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'D'
REMARK 3 SELECTION : CHAIN 'Q'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 5
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'E'
REMARK 3 SELECTION : CHAIN 'R'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 6
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'F'
REMARK 3 SELECTION : CHAIN 'S'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 7
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'H'
REMARK 3 SELECTION : CHAIN 'W'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 8
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'I'
REMARK 3 SELECTION : CHAIN 'A'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 9
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'J'
REMARK 3 SELECTION : CHAIN 'B'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 10
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'K'
REMARK 3 SELECTION : CHAIN 'C'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 11
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'L'
REMARK 3 SELECTION : CHAIN 'D'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 12
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'M'
REMARK 3 SELECTION : CHAIN 'E'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 13
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'O'
REMARK 3 SELECTION : CHAIN 'F'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 14
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'T'
REMARK 3 SELECTION : CHAIN 'G'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 15
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'U'
REMARK 3 SELECTION : CHAIN 'H'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 16
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'V'
REMARK 3 SELECTION : CHAIN 'I'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 17
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'X'
REMARK 3 SELECTION : CHAIN 'J'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 18
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'Z'
REMARK 3 SELECTION : CHAIN 'L'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3 NCS GROUP : 19
REMARK 3 NCS OPERATOR : 1
REMARK 3 REFERENCE SELECTION: CHAIN 'M'
REMARK 3 SELECTION : CHAIN 'Y'
REMARK 3 ATOM PAIRS NUMBER : NULL
REMARK 3 RMSD : NULL
REMARK 3
REMARK 3 OTHER REFINEMENT REMARKS: NULL
REMARK 4
REMARK 4 4TNJ COMPLIES WITH FORMAT V. 3.30, 13-JUL-11
REMARK 100
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 17-JUN-14.
REMARK 100 THE DEPOSITION ID IS D_1000201918.
REMARK 200
REMARK 200 EXPERIMENTAL DETAILS
REMARK 200 EXPERIMENT TYPE : X-RAY DIFFRACTION
REMARK 200 DATE OF DATA COLLECTION : 03-MAR-13
REMARK 200 TEMPERATURE (KELVIN) : 298
REMARK 200 PH : 7.0
REMARK 200 NUMBER OF CRYSTALS USED : 16973
REMARK 200
REMARK 200 SYNCHROTRON (Y/N) : N
REMARK 200 RADIATION SOURCE : FREE ELECTRON LASER
REMARK 200 BEAMLINE : CXI
REMARK 200 X-RAY GENERATOR MODEL : SLAC LCLS BEAMLINE CXI
REMARK 200 MONOCHROMATIC OR LAUE (M/L) : M
REMARK 200 WAVELENGTH OR RANGE (A) : 1.77
REMARK 200 MONOCHROMATOR : NO MONOCHROMATOR, FEL BEAM WITH
REMARK 200 20-30 EV BANDWIDTH
REMARK 200 OPTICS : KB MIRRORS
REMARK 200
REMARK 200 DETECTOR TYPE : PIXEL
REMARK 200 DETECTOR MANUFACTURER : CS-PAD DETECTOR
REMARK 200 INTENSITY-INTEGRATION SOFTWARE : NULL
REMARK 200 DATA SCALING SOFTWARE : NULL
REMARK 200
REMARK 200 NUMBER OF UNIQUE REFLECTIONS : 52965
REMARK 200 RESOLUTION RANGE HIGH (A) : 4.500
REMARK 200 RESOLUTION RANGE LOW (A) : 72.970
REMARK 200 REJECTION CRITERIA (SIGMA(I)) : NULL
REMARK 200
REMARK 200 OVERALL.
REMARK 200 COMPLETENESS FOR RANGE (%) : 99.5
REMARK 200 DATA REDUNDANCY : 131.4
REMARK 200 R MERGE (I) : NULL
REMARK 200 R SYM (I) : NULL
REMARK 200 <I/SIGMA(I)> FOR THE DATA SET : 52.1000
REMARK 200
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 4.50
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE LOW (A) : 4.66
REMARK 200 COMPLETENESS FOR SHELL (%) : 95.8
REMARK 200 DATA REDUNDANCY IN SHELL : 7.80
REMARK 200 R MERGE FOR SHELL (I) : NULL
REMARK 200 R SYM FOR SHELL (I) : NULL
REMARK 200 <I/SIGMA(I)> FOR SHELL : 3.700
REMARK 200
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: MOLECULAR REPLACEMENT
REMARK 200 SOFTWARE USED: NULL
REMARK 200 STARTING MODEL: 3BZ1
REMARK 200
REMARK 200 REMARK: NULL
REMARK 280
REMARK 280 CRYSTAL
REMARK 280 SOLVENT CONTENT, VS (%): 66.36
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 3.66
REMARK 280
REMARK 280 CRYSTALLIZATION CONDITIONS: 4% PEG2000, 5 MM CALCIUM CHLORIDE, 100
REMARK 280 MM PIPES, PH 7.0, BATCH, TEMPERATURE 298K
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21
REMARK 290
REMARK 290 SYMOP SYMMETRY
REMARK 290 NNNMMM OPERATOR
REMARK 290 1555 X,Y,Z
REMARK 290 2555 -X+1/2,-Y,Z+1/2
REMARK 290 3555 -X,Y+1/2,-Z+1/2
REMARK 290 4555 X+1/2,-Y+1/2,-Z
REMARK 290
REMARK 290 WHERE NNN -> OPERATOR NUMBER
REMARK 290 MMM -> TRANSLATION VECTOR
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY
REMARK 290 RELATED MOLECULES.
REMARK 290 SMTRY1 1 1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 1 0.000000 1.000000 0.000000 0.00000
REMARK 290 SMTRY3 1 0.000000 0.000000 1.000000 0.00000
REMARK 290 SMTRY1 2 -1.000000 0.000000 0.000000 66.14900
REMARK 290 SMTRY2 2 0.000000 -1.000000 0.000000 0.00000
REMARK 290 SMTRY3 2 0.000000 0.000000 1.000000 153.98800
REMARK 290 SMTRY1 3 -1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 3 0.000000 1.000000 0.000000 114.35650
REMARK 290 SMTRY3 3 0.000000 0.000000 -1.000000 153.98800
REMARK 290 SMTRY1 4 1.000000 0.000000 0.000000 66.14900
REMARK 290 SMTRY2 4 0.000000 -1.000000 0.000000 114.35650
REMARK 290 SMTRY3 4 0.000000 0.000000 -1.000000 0.00000
REMARK 290
REMARK 290 REMARK: NULL
REMARK 300
REMARK 300 BIOMOLECULE: 1
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON
REMARK 300 BURIED SURFACE AREA.
REMARK 350
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS
REMARK 350 GIVEN BELOW. BOTH NON-CRYSTALLOGRAPHIC AND
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.
REMARK 350
REMARK 350 BIOMOLECULE: 1
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: 40-MERIC
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, C, D, E, F, H, I, J, K,
REMARK 350 AND CHAINS: L, M, O, T, U, V, y, X, Y,
REMARK 350 AND CHAINS: Z, a, b, c, d, e, f, h, i, j,
REMARK 350 AND CHAINS: k, l, m, o, t, u, v, g, x,
REMARK 350 AND CHAINS: G, z
REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000
REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000
REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000
REMARK 465
REMARK 465 MISSING RESIDUES
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)
REMARK 465
REMARK 465 M RES C SSSEQI
REMARK 465 MET A 1
REMARK 465 THR A 2
REMARK 465 THR A 3
REMARK 465 THR A 4
REMARK 465 LEU A 5
REMARK 465 GLN A 6
REMARK 465 ARG A 7
REMARK 465 ARG A 8
REMARK 465 GLU A 9
REMARK 465 MET B 1
REMARK 465 GLU B 492
REMARK 465 TRP B 493
REMARK 465 GLY B 494
REMARK 465 PHE B 495
REMARK 465 TYR B 496
REMARK 465 GLN B 497
REMARK 465 LYS B 498
REMARK 465 VAL B 499
REMARK 465 GLY B 500
REMARK 465 ASP B 501
REMARK 465 VAL B 502
REMARK 465 THR B 503
REMARK 465 THR B 504
REMARK 465 ARG B 505
REMARK 465 ARG B 506
REMARK 465 LYS B 507
REMARK 465 GLU B 508
REMARK 465 ALA B 509
REMARK 465 VAL B 510
REMARK 465 MET C 13
REMARK 465 VAL C 14
REMARK 465 THR C 15
REMARK 465 LEU C 16
REMARK 465 SER C 17
REMARK 465 SER C 18
REMARK 465 ASN C 19
REMARK 465 SER C 20
REMARK 465 ILE C 21
REMARK 465 PHE C 22
REMARK 465 ALA C 23
REMARK 465 THR C 24
REMARK 465 ASN C 25
REMARK 465 ARG C 26
REMARK 465 MET D 1
REMARK 465 THR D 2
REMARK 465 ILE D 3
REMARK 465 ALA D 4
REMARK 465 ILE D 5
REMARK 465 GLY D 6
REMARK 465 ARG D 7
REMARK 465 ALA D 8
REMARK 465 PRO D 9
REMARK 465 ALA D 10
REMARK 465 GLU D 11
REMARK 465 ARG D 12
REMARK 465 MET E 1
REMARK 465 ALA E 2
REMARK 465 MET F 1
REMARK 465 THR F 2
REMARK 465 SER F 3
REMARK 465 ASN F 4
REMARK 465 THR F 5
REMARK 465 PRO F 6
REMARK 465 ASN F 7
REMARK 465 GLN F 8
REMARK 465 GLU F 9
REMARK 465 PRO F 10
REMARK 465 MET H 1
REMARK 465 ASP I 36
REMARK 465 LEU I 37
REMARK 465 GLU I 38
REMARK 465 MET J 1
REMARK 465 MET J 2
REMARK 465 SER J 3
REMARK 465 GLU J 4
REMARK 465 GLY J 5
REMARK 465 GLY J 6
REMARK 465 MET K 1
REMARK 465 ILE K 2
REMARK 465 ASP K 3
REMARK 465 ALA K 4
REMARK 465 LEU K 5
REMARK 465 VAL K 6
REMARK 465 LEU K 7
REMARK 465 VAL K 8
REMARK 465 ALA K 9
REMARK 465 SER M 35
REMARK 465 SER M 36
REMARK 465 MET O 1
REMARK 465 LYS O 2
REMARK 465 TYR O 3
REMARK 465 ARG O 4
REMARK 465 ILE O 5
REMARK 465 LEU O 6
REMARK 465 MET O 7
REMARK 465 ALA O 8
REMARK 465 THR O 9
REMARK 465 LEU O 10
REMARK 465 LEU O 11
REMARK 465 ALA O 12
REMARK 465 VAL O 13
REMARK 465 CYS O 14
REMARK 465 LEU O 15
REMARK 465 GLY O 16
REMARK 465 ILE O 17
REMARK 465 PHE O 18
REMARK 465 SER O 19
REMARK 465 LEU O 20
REMARK 465 SER O 21
REMARK 465 ALA O 22
REMARK 465 PRO O 23
REMARK 465 ALA O 24
REMARK 465 PHE O 25
REMARK 465 ALA O 26
REMARK 465 ALA O 27
REMARK 465 LYS O 28
REMARK 465 GLN O 29
REMARK 465 MET U 1
REMARK 465 GLN U 2
REMARK 465 ARG U 3
REMARK 465 LEU U 4
REMARK 465 GLY U 5
REMARK 465 ARG U 6
REMARK 465 TRP U 7
REMARK 465 LEU U 8
REMARK 465 ALA U 9
REMARK 465 LEU U 10
REMARK 465 ALA U 11
REMARK 465 TYR U 12
REMARK 465 PHE U 13
REMARK 465 VAL U 14
REMARK 465 GLY U 15
REMARK 465 VAL U 16
REMARK 465 SER U 17
REMARK 465 LEU U 18
REMARK 465 LEU U 19
REMARK 465 GLY U 20
REMARK 465 TRP U 21
REMARK 465 ILE U 22
REMARK 465 ASN U 23
REMARK 465 TRP U 24
REMARK 465 SER U 25
REMARK 465 ALA U 26
REMARK 465 PRO U 27
REMARK 465 THR U 28
REMARK 465 LEU U 29
REMARK 465 ALA U 30
REMARK 465 ALA U 31
REMARK 465 THR U 32
REMARK 465 ALA U 33
REMARK 465 SER U 34
REMARK 465 THR U 35
REMARK 465 GLU U 36
REMARK 465 GLU U 37
REMARK 465 MET V 1
REMARK 465 LEU V 2
REMARK 465 LYS V 3
REMARK 465 LYS V 4
REMARK 465 CYS V 5
REMARK 465 VAL V 6
REMARK 465 TRP V 7
REMARK 465 LEU V 8
REMARK 465 ALA V 9
REMARK 465 VAL V 10
REMARK 465 ALA V 11
REMARK 465 LEU V 12
REMARK 465 CYS V 13
REMARK 465 LEU V 14
REMARK 465 CYS V 15
REMARK 465 LEU V 16
REMARK 465 TRP V 17
REMARK 465 GLN V 18
REMARK 465 PHE V 19
REMARK 465 THR V 20
REMARK 465 MET V 21
REMARK 465 GLY V 22
REMARK 465 THR V 23
REMARK 465 ALA V 24
REMARK 465 LEU V 25
REMARK 465 ALA V 26
REMARK 465 MET y 1
REMARK 465 GLY y 2
REMARK 465 ILE y 3
REMARK 465 PHE y 4
REMARK 465 ASN y 5
REMARK 465 GLY y 6
REMARK 465 ILE y 7
REMARK 465 ILE y 8
REMARK 465 GLU y 9
REMARK 465 PHE y 10
REMARK 465 LEU y 11
REMARK 465 SER y 12
REMARK 465 ASN y 13
REMARK 465 ILE y 14
REMARK 465 ASN y 15
REMARK 465 PHE y 16
REMARK 465 GLU y 17
REMARK 465 VAL y 18
REMARK 465 MET X 10
REMARK 465 ARG X 48
REMARK 465 SER X 49
REMARK 465 LEU X 50
REMARK 465 MET a 1
REMARK 465 THR a 2
REMARK 465 THR a 3
REMARK 465 THR a 4
REMARK 465 LEU a 5
REMARK 465 GLN a 6
REMARK 465 ARG a 7
REMARK 465 ARG a 8
REMARK 465 GLU a 9
REMARK 465 MET b 1
REMARK 465 GLU b 492
REMARK 465 TRP b 493
REMARK 465 GLY b 494
REMARK 465 PHE b 495
REMARK 465 TYR b 496
REMARK 465 GLN b 497
REMARK 465 LYS b 498
REMARK 465 VAL b 499
REMARK 465 GLY b 500
REMARK 465 ASP b 501
REMARK 465 VAL b 502
REMARK 465 THR b 503
REMARK 465 THR b 504
REMARK 465 ARG b 505
REMARK 465 ARG b 506
REMARK 465 LYS b 507
REMARK 465 GLU b 508
REMARK 465 ALA b 509
REMARK 465 VAL b 510
REMARK 465 MET c 13
REMARK 465 VAL c 14
REMARK 465 THR c 15
REMARK 465 LEU c 16
REMARK 465 SER c 17
REMARK 465 SER c 18
REMARK 465 ASN c 19
REMARK 465 SER c 20
REMARK 465 ILE c 21
REMARK 465 PHE c 22
REMARK 465 ALA c 23
REMARK 465 THR c 24
REMARK 465 ASN c 25
REMARK 465 ARG c 26
REMARK 465 MET d 1
REMARK 465 THR d 2
REMARK 465 ILE d 3
REMARK 465 ALA d 4
REMARK 465 ILE d 5
REMARK 465 GLY d 6
REMARK 465 ARG d 7
REMARK 465 ALA d 8
REMARK 465 PRO d 9
REMARK 465 ALA d 10
REMARK 465 GLU d 11
REMARK 465 ARG d 12
REMARK 465 MET e 1
REMARK 465 ALA e 2
REMARK 465 MET f 1
REMARK 465 THR f 2
REMARK 465 SER f 3
REMARK 465 ASN f 4
REMARK 465 THR f 5
REMARK 465 PRO f 6
REMARK 465 ASN f 7
REMARK 465 GLN f 8
REMARK 465 GLU f 9
REMARK 465 PRO f 10
REMARK 465 MET h 1
REMARK 465 ASP i 36
REMARK 465 LEU i 37
REMARK 465 GLU i 38
REMARK 465 MET j 1
REMARK 465 MET j 2
REMARK 465 SER j 3
REMARK 465 GLU j 4
REMARK 465 GLY j 5
REMARK 465 GLY j 6
REMARK 465 MET k 1
REMARK 465 ILE k 2
REMARK 465 ASP k 3
REMARK 465 ALA k 4
REMARK 465 LEU k 5
REMARK 465 VAL k 6
REMARK 465 LEU k 7
REMARK 465 VAL k 8
REMARK 465 ALA k 9
REMARK 465 SER m 35
REMARK 465 SER m 36
REMARK 465 MET o 1
REMARK 465 LYS o 2
REMARK 465 TYR o 3
REMARK 465 ARG o 4
REMARK 465 ILE o 5
REMARK 465 LEU o 6
REMARK 465 MET o 7
REMARK 465 ALA o 8
REMARK 465 THR o 9
REMARK 465 LEU o 10
REMARK 465 LEU o 11
REMARK 465 ALA o 12
REMARK 465 VAL o 13
REMARK 465 CYS o 14
REMARK 465 LEU o 15
REMARK 465 GLY o 16
REMARK 465 ILE o 17
REMARK 465 PHE o 18
REMARK 465 SER o 19
REMARK 465 LEU o 20
REMARK 465 SER o 21
REMARK 465 ALA o 22
REMARK 465 PRO o 23
REMARK 465 ALA o 24
REMARK 465 PHE o 25
REMARK 465 ALA o 26
REMARK 465 ALA o 27
REMARK 465 LYS o 28
REMARK 465 GLN o 29
REMARK 465 MET u 1
REMARK 465 GLN u 2
REMARK 465 ARG u 3
REMARK 465 LEU u 4
REMARK 465 GLY u 5
REMARK 465 ARG u 6
REMARK 465 TRP u 7
REMARK 465 LEU u 8
REMARK 465 ALA u 9
REMARK 465 LEU u 10
REMARK 465 ALA u 11
REMARK 465 TYR u 12
REMARK 465 PHE u 13
REMARK 465 VAL u 14
REMARK 465 GLY u 15
REMARK 465 VAL u 16
REMARK 465 SER u 17
REMARK 465 LEU u 18
REMARK 465 LEU u 19
REMARK 465 GLY u 20
REMARK 465 TRP u 21
REMARK 465 ILE u 22
REMARK 465 ASN u 23
REMARK 465 TRP u 24
REMARK 465 SER u 25
REMARK 465 ALA u 26
REMARK 465 PRO u 27
REMARK 465 THR u 28
REMARK 465 LEU u 29
REMARK 465 ALA u 30
REMARK 465 ALA u 31
REMARK 465 THR u 32
REMARK 465 ALA u 33
REMARK 465 SER u 34
REMARK 465 THR u 35
REMARK 465 GLU u 36
REMARK 465 GLU u 37
REMARK 465 MET v 1
REMARK 465 LEU v 2
REMARK 465 LYS v 3
REMARK 465 LYS v 4
REMARK 465 CYS v 5
REMARK 465 VAL v 6
REMARK 465 TRP v 7
REMARK 465 LEU v 8
REMARK 465 ALA v 9
REMARK 465 VAL v 10
REMARK 465 ALA v 11
REMARK 465 LEU v 12
REMARK 465 CYS v 13
REMARK 465 LEU v 14
REMARK 465 CYS v 15
REMARK 465 LEU v 16
REMARK 465 TRP v 17
REMARK 465 GLN v 18
REMARK 465 PHE v 19
REMARK 465 THR v 20
REMARK 465 MET v 21
REMARK 465 GLY v 22
REMARK 465 THR v 23
REMARK 465 ALA v 24
REMARK 465 LEU v 25
REMARK 465 ALA v 26
REMARK 465 MET g 1
REMARK 465 GLY g 2
REMARK 465 ILE g 3
REMARK 465 PHE g 4
REMARK 465 ASN g 5
REMARK 465 GLY g 6
REMARK 465 ILE g 7
REMARK 465 ILE g 8
REMARK 465 GLU g 9
REMARK 465 PHE g 10
REMARK 465 LEU g 11
REMARK 465 SER g 12
REMARK 465 ASN g 13
REMARK 465 ILE g 14
REMARK 465 ASN g 15
REMARK 465 PHE g 16
REMARK 465 GLU g 17
REMARK 465 VAL g 18
REMARK 465 MET x 10
REMARK 465 ARG x 48
REMARK 465 SER x 49
REMARK 465 LEU x 50
REMARK 470
REMARK 470 MISSING ATOM
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 470 I=INSERTION CODE):
REMARK 470 M RES CSSEQI ATOMS
REMARK 470 TYR C 143 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 GLU C 462 CG CD OE1 OE2
REMARK 470 LYS H 20 CG CD CE NZ
REMARK 470 ARG O 53 CG CD NE CZ NH1 NH2
REMARK 470 GLU O 80 CG CD OE1 OE2
REMARK 470 LYS O 85 CG CD CE NZ
REMARK 470 ARG O 233 CG CD NE CZ NH1 NH2
REMARK 470 GLU V 41 CG CD OE1 OE2
REMARK 470 ARG y 43 CG CD NE CZ NH1 NH2
REMARK 470 TYR c 143 CG CD1 CD2 CE1 CE2 CZ OH
REMARK 470 GLU c 462 CG CD OE1 OE2
REMARK 470 LYS h 20 CG CD CE NZ
REMARK 470 ARG o 53 CG CD NE CZ NH1 NH2
REMARK 470 GLU o 80 CG CD OE1 OE2
REMARK 470 LYS o 85 CG CD CE NZ
REMARK 470 ARG o 233 CG CD NE CZ NH1 NH2
REMARK 470 GLU v 41 CG CD OE1 OE2
REMARK 470 ARG g 43 CG CD NE CZ NH1 NH2
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT
REMARK 500
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.
REMARK 500
REMARK 500 ATM1 RES C SSEQI ATM2 RES C SSEQI DISTANCE
REMARK 500 O TRP C 250 OG1 THR C 254 2.11
REMARK 500 O TRP c 250 OG1 THR c 254 2.12
REMARK 500 O TRP C 291 OG1 THR C 305 2.13
REMARK 500 O TRP c 291 OG1 THR c 305 2.17
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES
REMARK 500
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)
REMARK 500
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996
REMARK 500
REMARK 500 M RES CSSEQI ATM1 ATM2 ATM3
REMARK 500 PRO B 484 C - N - CA ANGL. DEV. = 13.8 DEGREES
REMARK 500 PRO b 484 C - N - CA ANGL. DEV. = 13.9 DEGREES
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: TORSION ANGLES
REMARK 500
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)
REMARK 500
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400
REMARK 500
REMARK 500 M RES CSSEQI PSI PHI
REMARK 500 ASN A 12 113.55 156.68
REMARK 500 PRO A 141 -129.69 -74.18
REMARK 500 TRP A 142 -10.47 57.87
REMARK 500 LEU A 159 -50.96 -132.18
REMARK 500 SER A 222 43.06 -109.78
REMARK 500 GLU A 226 10.06 -147.12
REMARK 500 ILE A 259 -84.54 -103.94
REMARK 500 PHE A 302 32.40 -98.39
REMARK 500 ARG A 334 -71.03 -27.38
REMARK 500 ASP B 119 55.12 -91.78
REMARK 500 ARG B 127 -71.75 -63.31
REMARK 500 PRO B 183 175.19 -59.24
REMARK 500 LEU B 218 -67.61 -95.18
REMARK 500 ARG B 230 53.37 31.50
REMARK 500 SER B 294 27.72 -79.83
REMARK 500 ASP B 313 41.82 -91.60
REMARK 500 THR B 436 -70.31 -33.73
REMARK 500 SER B 480 -12.56 70.07
REMARK 500 ILE B 482 -165.91 -117.54
REMARK 500 PRO B 484 -143.81 -7.86
REMARK 500 GLU B 485 164.38 62.54
REMARK 500 LEU B 486 68.84 -155.03
REMARK 500 PRO B 488 -108.51 5.33
REMARK 500 GLU B 489 56.92 -65.19
REMARK 500 GLN B 490 107.87 -167.15
REMARK 500 GLU C 29 -149.64 -148.47
REMARK 500 ARG C 135 -62.72 -121.66
REMARK 500 SER C 144 112.05 -179.97
REMARK 500 ASN C 201 59.14 -168.57
REMARK 500 ILE C 209 -70.11 -53.63
REMARK 500 TRP C 223 -145.28 61.06
REMARK 500 LEU C 253 30.21 -96.38
REMARK 500 PHE C 257 -145.97 -71.51
REMARK 500 ARG C 320 -71.40 -59.53
REMARK 500 PRO C 368 -9.54 -59.70
REMARK 500 LEU C 375 114.06 -34.69
REMARK 500 ASN C 382 12.46 -161.40
REMARK 500 HIS C 398 33.97 -142.05
REMARK 500 SER C 406 65.49 60.08
REMARK 500 ALA C 411 -17.37 -49.62
REMARK 500 SER C 416 -60.84 -176.83
REMARK 500 PHE C 455 23.38 -150.16
REMARK 500 GLU C 462 -76.04 -68.52
REMARK 500 ARG D 26 -165.46 -102.53
REMARK 500 VAL D 30 -83.56 -89.78
REMARK 500 LEU D 37 -71.44 -56.83
REMARK 500 SER D 65 16.45 -141.31
REMARK 500 PRO D 140 37.12 -84.86
REMARK 500 LEU D 158 -65.10 -128.95
REMARK 500 ALA D 234 28.82 -76.04
REMARK 500
REMARK 500 THIS ENTRY HAS 248 RAMACHANDRAN OUTLIERS.
REMARK 500
REMARK 500 REMARK: NULL
REMARK 610
REMARK 610 MISSING HETEROATOM
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 610 I=INSERTION CODE):
REMARK 610 M RES C SSEQI
REMARK 610 PL9 A 406
REMARK 610 DGD A 408
REMARK 610 LHG A 409
REMARK 610 LMG A 410
REMARK 610 SQD A 413
REMARK 610 LMG A 415
REMARK 610 DGD B 620
REMARK 610 LMG B 621
REMARK 610 LMG B 624
REMARK 610 DGD B 625
REMARK 610 SQD B 626
REMARK 610 DGD C 515
REMARK 610 DGD C 516
REMARK 610 LMG C 518
REMARK 610 LHG C 519
REMARK 610 LMG C 522
REMARK 610 SQD D 403
REMARK 610 LMG D 408
REMARK 610 DGD D 409
REMARK 610 LMT D 410
REMARK 610 LMG D 412
REMARK 610 LMG E 101
REMARK 610 SQD F 102
REMARK 610 LMG I 101
REMARK 610 PL9 J 101
REMARK 610 LMG M 101
REMARK 610 LMG a 402
REMARK 610 PL9 a 409
REMARK 610 DGD a 411
REMARK 610 LHG a 412
REMARK 610 LMG a 413
REMARK 610 SQD a 415
REMARK 610 DGD b 601
REMARK 610 SQD b 602
REMARK 610 DGD b 624
REMARK 610 LMG b 625
REMARK 610 LMG b 628
REMARK 610 DGD c 515
REMARK 610 DGD c 516
REMARK 610 LMG c 518
REMARK 610 LHG c 519
REMARK 610 LMG c 522
REMARK 610 SQD d 402
REMARK 610 LMG d 407
REMARK 610 DGD d 408
REMARK 610 LMT d 409
REMARK 610 LMG d 410
REMARK 610 LMG e 101
REMARK 610 SQD f 103
REMARK 610 LMG i 101
REMARK 610 PL9 j 101
REMARK 610 LMG m 101
REMARK 620
REMARK 620 METAL COORDINATION
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 CA1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP A 170 OD1
REMARK 620 2 OEX A 412 O1 124.3
REMARK 620 3 OEX A 412 O2 60.4 63.8
REMARK 620 4 OEX A 412 O5 94.8 60.5 64.3
REMARK 620 5 GLU A 189 OE1 169.0 63.7 126.7 82.8
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN4
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP A 170 OD2
REMARK 620 2 OEX A 412 O5 106.7
REMARK 620 3 OEX A 412 O4 68.1 87.4
REMARK 620 4 GLU A 333 OE2 127.5 107.3 74.7
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU A 189 OE2
REMARK 620 2 OEX A 412 O1 83.1
REMARK 620 3 OEX A 412 O5 127.5 90.7
REMARK 620 4 OEX A 412 O3 143.8 89.5 87.8
REMARK 620 5 HIS A 332 NE2 74.7 157.2 106.8 105.4
REMARK 620 6 ASP A 342 OD2 66.2 89.8 166.2 78.5 76.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FE2 A 401 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS A 215 NE2
REMARK 620 2 HIS A 272 NE2 96.4
REMARK 620 3 HIS D 214 NE2 125.2 113.8
REMARK 620 4 HIS D 268 NE2 79.8 154.9 87.8
REMARK 620 5 BCT D 404 O3 129.9 91.6 95.2 73.0
REMARK 620 6 BCT D 404 O2 84.0 81.5 142.4 73.5 48.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN3
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU A 333 OE1
REMARK 620 2 OEX A 412 O2 136.6
REMARK 620 3 OEX A 412 O3 96.8 88.6
REMARK 620 4 OEX A 412 O4 83.9 92.0 178.2
REMARK 620 5 OEX A 412 O5 107.3 115.9 89.0 89.2
REMARK 620 6 GLU C 354 OE2 67.1 74.1 71.4 110.3 158.2
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX A 412 MN2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP A 342 OD1
REMARK 620 2 OEX A 412 O1 111.4
REMARK 620 3 OEX A 412 O2 159.1 89.3
REMARK 620 4 OEX A 412 O3 93.3 87.0 85.3
REMARK 620 5 ALA A 344 OXT 98.9 130.1 67.4 130.9
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CLA C 510 MG
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASN C 39 OD1
REMARK 620 2 CLA C 510 NA 96.2
REMARK 620 3 CLA C 510 NB 75.2 92.2
REMARK 620 4 CLA C 510 NC 84.2 176.7 91.0
REMARK 620 5 CLA C 510 ND 104.1 90.7 177.0 86.0
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM F 101 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS E 23 NE2
REMARK 620 2 HEM F 101 NA 87.3
REMARK 620 3 HEM F 101 NB 104.3 89.3
REMARK 620 4 HEM F 101 NC 89.3 175.5 88.7
REMARK 620 5 HEM F 101 ND 67.2 90.4 171.6 90.9
REMARK 620 6 HIS F 24 NE2 157.7 70.4 75.3 112.9 112.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CA K 101 CA
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP K 19 OD2
REMARK 620 2 ASP K 23 OD1 132.5
REMARK 620 3 ASP K 23 OD2 124.7 46.4
REMARK 620 N 1 2
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM V 201 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS V 67 NE2
REMARK 620 2 HEM V 201 NA 86.9
REMARK 620 3 HEM V 201 NB 88.6 89.8
REMARK 620 4 HEM V 201 NC 88.5 175.4 90.1
REMARK 620 5 HEM V 201 ND 81.5 88.6 170.0 90.7
REMARK 620 6 HIS V 118 NE2 169.4 87.3 100.3 97.2 89.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 CA1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP a 170 OD1
REMARK 620 2 OEX a 414 O1 126.1
REMARK 620 3 OEX a 414 O2 62.6 63.6
REMARK 620 4 OEX a 414 O5 97.5 61.0 63.9
REMARK 620 5 GLU a 189 OE1 170.0 62.7 125.4 82.6
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN4
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP a 170 OD2
REMARK 620 2 OEX a 414 O5 110.5
REMARK 620 3 OEX a 414 O4 66.9 87.6
REMARK 620 4 GLU a 333 OE2 123.1 107.7 74.4
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU a 189 OE2
REMARK 620 2 OEX a 414 O1 85.0
REMARK 620 3 OEX a 414 O5 129.2 90.6
REMARK 620 4 OEX a 414 O3 142.5 89.4 87.7
REMARK 620 5 HIS a 332 NE2 70.8 155.4 107.6 107.2
REMARK 620 6 ASP a 342 OD2 63.0 89.8 167.7 80.0 75.9
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FE2 a 403 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS a 215 NE2
REMARK 620 2 HIS a 272 NE2 96.3
REMARK 620 3 HIS d 214 NE2 120.4 112.2
REMARK 620 4 HIS d 268 NE2 78.4 156.6 89.7
REMARK 620 5 BCT d 403 O2 87.1 85.3 143.5 71.7
REMARK 620 6 BCT d 403 O3 133.4 94.5 96.5 74.1 48.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN3
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 GLU a 333 OE1
REMARK 620 2 OEX a 414 O2 136.8
REMARK 620 3 OEX a 414 O3 98.0 88.7
REMARK 620 4 OEX a 414 O4 82.3 92.0 178.6
REMARK 620 5 OEX a 414 O5 107.6 115.2 89.1 89.5
REMARK 620 6 GLU c 354 OE2 68.4 73.2 73.0 108.4 160.4
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 OEX a 414 MN2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP a 342 OD1
REMARK 620 2 OEX a 414 O1 109.3
REMARK 620 3 OEX a 414 O2 161.2 89.3
REMARK 620 4 OEX a 414 O3 93.0 87.1 85.4
REMARK 620 5 ALA a 344 OXT 101.6 129.0 66.6 131.3
REMARK 620 6 GLU c 354 OE1 66.9 158.2 95.0 72.0 71.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CLA c 510 MG
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASN c 39 OD1
REMARK 620 2 CLA c 510 NA 95.8
REMARK 620 3 CLA c 510 NB 75.2 92.2
REMARK 620 4 CLA c 510 NC 84.5 176.7 91.0
REMARK 620 5 CLA c 510 ND 104.2 90.7 177.1 86.1
REMARK 620 N 1 2 3 4
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM f 101 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS e 23 NE2
REMARK 620 2 HEM f 101 NA 87.6
REMARK 620 3 HEM f 101 NB 103.5 89.5
REMARK 620 4 HEM f 101 NC 88.5 175.0 88.4
REMARK 620 5 HEM f 101 ND 67.4 90.2 170.8 91.2
REMARK 620 6 HIS f 24 NE2 157.7 70.2 78.1 113.7 110.3
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 CA k 101 CA
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 ASP k 19 OD2
REMARK 620 2 ASP k 23 OD1 124.2
REMARK 620 3 ASP k 23 OD2 115.3 41.7
REMARK 620 N 1 2
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM v 201 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS v 67 NE2
REMARK 620 2 HEM v 201 NA 86.2
REMARK 620 3 HEM v 201 NB 86.5 89.3
REMARK 620 4 HEM v 201 NC 89.3 175.5 90.2
REMARK 620 5 HEM v 201 ND 83.7 89.8 170.2 90.0
REMARK 620 6 HIS v 118 NE2 170.4 86.9 100.2 97.6 89.6
REMARK 620 N 1 2 3 4 5
REMARK 800
REMARK 800 SITE
REMARK 800 SITE_IDENTIFIER: AC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue FE2 A 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA A 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 A 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR A 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD A 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG A 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG A 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CL A 411
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue OEX A 412
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD A 413
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD A 414
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG A 415
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 601
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 602
REMARK 800
REMARK 800 SITE_IDENTIFIER: AD9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 603
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 604
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 605
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 606
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 607
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 608
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 609
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 610
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 611
REMARK 800
REMARK 800 SITE_IDENTIFIER: AE9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 612
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 613
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 614
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA B 615
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 616
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 617
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 618
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR B 619
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD B 620
REMARK 800
REMARK 800 SITE_IDENTIFIER: AF9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG B 621
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 622
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 623
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG B 624
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD B 625
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD B 626
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 627
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT B 628
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AG9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 503
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 504
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 505
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 506
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 507
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 508
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 509
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 510
REMARK 800
REMARK 800 SITE_IDENTIFIER: AH9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 511
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 512
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR C 513
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR C 514
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD C 515
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD C 516
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD C 517
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG C 518
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG C 519
REMARK 800
REMARK 800 SITE_IDENTIFIER: AI9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA C 520
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR C 521
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG C 522
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO D 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO D 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD D 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCT D 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA D 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA D 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AJ9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 D 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG D 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD D 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT D 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR D 411
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG D 412
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG E 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM F 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD F 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AK9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA H 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR H 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG I 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT I 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 J 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR J 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA K 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG M 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT M 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AL9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT M 103
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA O 301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM V 201
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR y 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD a 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG a 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue FE2 a 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AM9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO a 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA a 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 a 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR a 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD a 411
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG a 412
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG a 413
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue OEX a 414
REMARK 800
REMARK 800 SITE_IDENTIFIER: AN9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD a 415
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CL a 416
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD b 601
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD b 602
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 603
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 604
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 605
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 606
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 607
REMARK 800
REMARK 800 SITE_IDENTIFIER: AO9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 608
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 609
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 610
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 611
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 612
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 613
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 614
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 615
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 616
REMARK 800
REMARK 800 SITE_IDENTIFIER: AP9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 617
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 618
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA b 619
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 620
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 621
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 622
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR b 623
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD b 624
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG b 625
REMARK 800
REMARK 800 SITE_IDENTIFIER: AQ9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 626
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT b 627
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG b 628
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 503
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 504
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 505
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 506
REMARK 800
REMARK 800 SITE_IDENTIFIER: AR9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 507
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 508
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 509
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 510
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 511
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 512
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR c 513
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR c 514
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD c 515
REMARK 800
REMARK 800 SITE_IDENTIFIER: AS9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD c 516
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD c 517
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG c 518
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LHG c 519
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA c 520
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR c 521
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG c 522
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PHO d 401
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD d 402
REMARK 800
REMARK 800 SITE_IDENTIFIER: AT9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCT d 403
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA d 404
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA d 405
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 d 406
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG d 407
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue DGD d 408
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT d 409
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG d 410
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG e 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AU9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM f 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR f 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue SQD f 103
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CLA h 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG i 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMT i 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue PL9 j 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR j 102
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA k 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AV9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue LMG m 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue CA o 301
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue HEM v 201
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR g 101
REMARK 800
REMARK 800 SITE_IDENTIFIER: AW4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: binding site for residue BCR x 101
REMARK 900
REMARK 900 RELATED ENTRIES
REMARK 900 RELATED ID: 4TNH RELATED DB: PDB
REMARK 900 RT STRUCTURE OF THE DARK STATE OF PHOTOSYSTEM II
REMARK 900 RELATED ID: 4TNI RELATED DB: PDB
REMARK 900 RELATED ID: 4TNK RELATED DB: PDB
REMARK 999
REMARK 999 SEQUENCE
REMARK 999 MOLECULE 19 (PHOTOSYSTEM II PROTEIN Y): THE DEPOSITORS STATE THAT
REMARK 999 THE SAMPLE SEQUENCE IS MDWRVLVVLLPVLLAAGWAVRNILPYAVKQVQKLLQKAKAA
REMARK 999 (UNP Q8DKM3).
DBREF 4TNJ A 1 344 UNP P0A444 PSBA1_THEEB 1 344
DBREF 4TNJ B 1 510 UNP Q8DIQ1 Q8DIQ1_THEEB 1 510
DBREF 4TNJ C 13 473 UNP Q8DIF8 Q8DIF8_THEEB 1 461
DBREF 4TNJ D 1 352 UNP Q8CM25 PSBD_THEEB 1 352
DBREF 4TNJ E 1 84 UNP Q8DIP0 PSBE_THEEB 1 84
DBREF 4TNJ F 1 45 UNP Q8DIN9 PSBF_THEEB 1 45
DBREF 4TNJ H 1 66 UNP Q8DJ43 PSBH_THEEB 1 66
DBREF 4TNJ I 1 38 UNP Q8DJZ6 PSBI_THEEB 1 38
DBREF 4TNJ J 1 40 UNP P59087 PSBJ_THEEB 1 40
DBREF 4TNJ K 1 46 UNP Q9F1K9 PSBK_THEEB 1 46
DBREF 4TNJ L 1 37 UNP Q8DIN8 PSBL_THEEB 1 37
DBREF 4TNJ M 1 36 UNP Q8DHA7 PSBM_THEEB 1 36
DBREF 4TNJ O 1 272 UNP P0A431 PSBO_THEEB 1 272
DBREF 4TNJ T 1 32 UNP Q8DIQ0 PSBT_THEEB 1 32
DBREF 4TNJ U 1 134 UNP Q9F1L5 PSBU_THEEB 1 134
DBREF 4TNJ V 1 163 UNP P0A386 CY550_THEEB 1 163
DBREF 4TNJ y 1 46 UNP Q8DJI1 YCF12_THEEB 1 46
DBREF 4TNJ X 10 50 UNP Q9F1R6 PSBX_THEEB 1 41
DBREF 4TNJ Y 1 28 PDB 4TNJ 4TNJ 1 28
DBREF 4TNJ Z 1 62 UNP Q8DHJ2 PSBZ_THEEB 1 62
DBREF 4TNJ a 1 344 UNP P0A444 PSBA1_THEEB 1 344
DBREF 4TNJ b 1 510 UNP Q8DIQ1 Q8DIQ1_THEEB 1 510
DBREF 4TNJ c 13 473 UNP Q8DIF8 Q8DIF8_THEEB 1 461
DBREF 4TNJ d 1 352 UNP Q8CM25 PSBD_THEEB 1 352
DBREF 4TNJ e 1 84 UNP Q8DIP0 PSBE_THEEB 1 84
DBREF 4TNJ f 1 45 UNP Q8DIN9 PSBF_THEEB 1 45
DBREF 4TNJ h 1 66 UNP Q8DJ43 PSBH_THEEB 1 66
DBREF 4TNJ i 1 38 UNP Q8DJZ6 PSBI_THEEB 1 38
DBREF 4TNJ j 1 40 UNP P59087 PSBJ_THEEB 1 40
DBREF 4TNJ k 1 46 UNP Q9F1K9 PSBK_THEEB 1 46
DBREF 4TNJ l 1 37 UNP Q8DIN8 PSBL_THEEB 1 37
DBREF 4TNJ m 1 36 UNP Q8DHA7 PSBM_THEEB 1 36
DBREF 4TNJ o 1 272 UNP P0A431 PSBO_THEEB 1 272
DBREF 4TNJ t 1 32 UNP Q8DIQ0 PSBT_THEEB 1 32
DBREF 4TNJ u 1 134 UNP Q9F1L5 PSBU_THEEB 1 134
DBREF 4TNJ v 1 163 UNP P0A386 CY550_THEEB 1 163
DBREF 4TNJ g 1 46 UNP Q8DJI1 YCF12_THEEB 1 46
DBREF 4TNJ x 10 50 UNP Q9F1R6 PSBX_THEEB 1 41
DBREF 4TNJ G 1 28 PDB 4TNJ 4TNJ 1 28
DBREF 4TNJ z 1 62 UNP Q8DHJ2 PSBZ_THEEB 1 62
SEQRES 1 A 344 MET THR THR THR LEU GLN ARG ARG GLU SER ALA ASN LEU
SEQRES 2 A 344 TRP GLU ARG PHE CYS ASN TRP VAL THR SER THR ASP ASN
SEQRES 3 A 344 ARG LEU TYR VAL GLY TRP PHE GLY VAL ILE MET ILE PRO
SEQRES 4 A 344 THR LEU LEU ALA ALA THR ILE CYS PHE VAL ILE ALA PHE
SEQRES 5 A 344 ILE ALA ALA PRO PRO VAL ASP ILE ASP GLY ILE ARG GLU
SEQRES 6 A 344 PRO VAL SER GLY SER LEU LEU TYR GLY ASN ASN ILE ILE
SEQRES 7 A 344 THR GLY ALA VAL VAL PRO SER SER ASN ALA ILE GLY LEU
SEQRES 8 A 344 HIS PHE TYR PRO ILE TRP GLU ALA ALA SER LEU ASP GLU
SEQRES 9 A 344 TRP LEU TYR ASN GLY GLY PRO TYR GLN LEU ILE ILE PHE
SEQRES 10 A 344 HIS PHE LEU LEU GLY ALA SER CYS TYR MET GLY ARG GLN
SEQRES 11 A 344 TRP GLU LEU SER TYR ARG LEU GLY MET ARG PRO TRP ILE
SEQRES 12 A 344 CYS VAL ALA TYR SER ALA PRO LEU ALA SER ALA PHE ALA
SEQRES 13 A 344 VAL PHE LEU ILE TYR PRO ILE GLY GLN GLY SER PHE SER
SEQRES 14 A 344 ASP GLY MET PRO LEU GLY ILE SER GLY THR PHE ASN PHE
SEQRES 15 A 344 MET ILE VAL PHE GLN ALA GLU HIS ASN ILE LEU MET HIS
SEQRES 16 A 344 PRO PHE HIS GLN LEU GLY VAL ALA GLY VAL PHE GLY GLY
SEQRES 17 A 344 ALA LEU PHE CYS ALA MET HIS GLY SER LEU VAL THR SER
SEQRES 18 A 344 SER LEU ILE ARG GLU THR THR GLU THR GLU SER ALA ASN
SEQRES 19 A 344 TYR GLY TYR LYS PHE GLY GLN GLU GLU GLU THR TYR ASN
SEQRES 20 A 344 ILE VAL ALA ALA HIS GLY TYR PHE GLY ARG LEU ILE PHE
SEQRES 21 A 344 GLN TYR ALA SER PHE ASN ASN SER ARG SER LEU HIS PHE
SEQRES 22 A 344 PHE LEU ALA ALA TRP PRO VAL VAL GLY VAL TRP PHE THR
SEQRES 23 A 344 ALA LEU GLY ILE SER THR MET ALA PHE ASN LEU ASN GLY
SEQRES 24 A 344 PHE ASN PHE ASN HIS SER VAL ILE ASP ALA LYS GLY ASN
SEQRES 25 A 344 VAL ILE ASN THR TRP ALA ASP ILE ILE ASN ARG ALA ASN
SEQRES 26 A 344 LEU GLY MET GLU VAL MET HIS GLU ARG ASN ALA HIS ASN
SEQRES 27 A 344 PHE PRO LEU ASP LEU ALA
SEQRES 1 B 510 MET GLY LEU PRO TRP TYR ARG VAL HIS THR VAL LEU ILE
SEQRES 2 B 510 ASN ASP PRO GLY ARG LEU ILE ALA ALA HIS LEU MET HIS
SEQRES 3 B 510 THR ALA LEU VAL ALA GLY TRP ALA GLY SER MET ALA LEU
SEQRES 4 B 510 TYR GLU LEU ALA THR PHE ASP PRO SER ASP PRO VAL LEU
SEQRES 5 B 510 ASN PRO MET TRP ARG GLN GLY MET PHE VAL LEU PRO PHE
SEQRES 6 B 510 MET ALA ARG LEU GLY VAL THR GLY SER TRP SER GLY TRP
SEQRES 7 B 510 SER ILE THR GLY GLU THR GLY ILE ASP PRO GLY PHE TRP
SEQRES 8 B 510 SER PHE GLU GLY VAL ALA LEU ALA HIS ILE VAL LEU SER
SEQRES 9 B 510 GLY LEU LEU PHE LEU ALA ALA CYS TRP HIS TRP VAL TYR
SEQRES 10 B 510 TRP ASP LEU GLU LEU PHE ARG ASP PRO ARG THR GLY GLU
SEQRES 11 B 510 PRO ALA LEU ASP LEU PRO LYS MET PHE GLY ILE HIS LEU
SEQRES 12 B 510 PHE LEU ALA GLY LEU LEU CYS PHE GLY PHE GLY ALA PHE
SEQRES 13 B 510 HIS LEU THR GLY LEU PHE GLY PRO GLY MET TRP VAL SER
SEQRES 14 B 510 ASP PRO TYR GLY LEU THR GLY SER VAL GLN PRO VAL ALA
SEQRES 15 B 510 PRO GLU TRP GLY PRO ASP GLY PHE ASN PRO TYR ASN PRO
SEQRES 16 B 510 GLY GLY VAL VAL ALA HIS HIS ILE ALA ALA GLY ILE VAL
SEQRES 17 B 510 GLY ILE ILE ALA GLY LEU PHE HIS ILE LEU VAL ARG PRO
SEQRES 18 B 510 PRO GLN ARG LEU TYR LYS ALA LEU ARG MET GLY ASN ILE
SEQRES 19 B 510 GLU THR VAL LEU SER SER SER ILE ALA ALA VAL PHE PHE
SEQRES 20 B 510 ALA ALA PHE VAL VAL ALA GLY THR MET TRP TYR GLY SER
SEQRES 21 B 510 ALA THR THR PRO ILE GLU LEU PHE GLY PRO THR ARG TYR
SEQRES 22 B 510 GLN TRP ASP SER SER TYR PHE GLN GLN GLU ILE ASN ARG
SEQRES 23 B 510 ARG VAL GLN ALA SER LEU ALA SER GLY ALA THR LEU GLU
SEQRES 24 B 510 GLU ALA TRP SER ALA ILE PRO GLU LYS LEU ALA PHE TYR
SEQRES 25 B 510 ASP TYR ILE GLY ASN ASN PRO ALA LYS GLY GLY LEU PHE
SEQRES 26 B 510 ARG THR GLY PRO MET ASN LYS GLY ASP GLY ILE ALA GLN
SEQRES 27 B 510 ALA TRP LYS GLY HIS ALA VAL PHE ARG ASN LYS GLU GLY
SEQRES 28 B 510 GLU GLU LEU PHE VAL ARG ARG MET PRO ALA PHE PHE GLU
SEQRES 29 B 510 SER PHE PRO VAL ILE LEU THR ASP LYS ASN GLY VAL VAL
SEQRES 30 B 510 LYS ALA ASP ILE PRO PHE ARG ARG ALA GLU SER LYS TYR
SEQRES 31 B 510 SER PHE GLU GLN GLN GLY VAL THR VAL SER PHE TYR GLY
SEQRES 32 B 510 GLY GLU LEU ASN GLY GLN THR PHE THR ASP PRO PRO THR
SEQRES 33 B 510 VAL LYS SER TYR ALA ARG LYS ALA ILE PHE GLY GLU ILE
SEQRES 34 B 510 PHE GLU PHE ASP THR GLU THR LEU ASN SER ASP GLY ILE
SEQRES 35 B 510 PHE ARG THR SER PRO ARG GLY TRP PHE THR PHE ALA HIS
SEQRES 36 B 510 ALA VAL PHE ALA LEU LEU PHE PHE PHE GLY HIS ILE TRP
SEQRES 37 B 510 HIS GLY ALA ARG THR LEU PHE ARG ASP VAL PHE SER GLY
SEQRES 38 B 510 ILE ASP PRO GLU LEU SER PRO GLU GLN VAL GLU TRP GLY
SEQRES 39 B 510 PHE TYR GLN LYS VAL GLY ASP VAL THR THR ARG ARG LYS
SEQRES 40 B 510 GLU ALA VAL
SEQRES 1 C 461 MET VAL THR LEU SER SER ASN SER ILE PHE ALA THR ASN
SEQRES 2 C 461 ARG ASP GLN GLU SER SER GLY PHE ALA TRP TRP ALA GLY
SEQRES 3 C 461 ASN ALA ARG LEU ILE ASN LEU SER GLY LYS LEU LEU GLY
SEQRES 4 C 461 ALA HIS VAL ALA HIS ALA GLY LEU ILE VAL PHE TRP ALA
SEQRES 5 C 461 GLY ALA MET THR LEU PHE GLU LEU ALA HIS PHE ILE PRO
SEQRES 6 C 461 GLU LYS PRO MET TYR GLU GLN GLY LEU ILE LEU ILE PRO
SEQRES 7 C 461 HIS ILE ALA THR LEU GLY TRP GLY VAL GLY PRO GLY GLY
SEQRES 8 C 461 GLU VAL VAL ASP THR PHE PRO PHE PHE VAL VAL GLY VAL
SEQRES 9 C 461 VAL HIS LEU ILE SER SER ALA VAL LEU GLY PHE GLY GLY
SEQRES 10 C 461 VAL TYR HIS ALA ILE ARG GLY PRO GLU THR LEU GLU GLU
SEQRES 11 C 461 TYR SER SER PHE PHE GLY TYR ASP TRP LYS ASP LYS ASN
SEQRES 12 C 461 LYS MET THR THR ILE LEU GLY PHE HIS LEU ILE VAL LEU
SEQRES 13 C 461 GLY ILE GLY ALA LEU LEU LEU VAL ALA LYS ALA MET PHE
SEQRES 14 C 461 PHE GLY GLY LEU TYR ASP THR TRP ALA PRO GLY GLY GLY
SEQRES 15 C 461 ASP VAL ARG VAL ILE THR ASN PRO THR LEU ASP PRO ARG
SEQRES 16 C 461 VAL ILE PHE GLY TYR LEU LEU LYS SER PRO PHE GLY GLY
SEQRES 17 C 461 GLU GLY TRP ILE VAL SER VAL ASN ASN LEU GLU ASP VAL
SEQRES 18 C 461 VAL GLY GLY HIS ILE TRP ILE GLY LEU ILE CYS ILE ALA
SEQRES 19 C 461 GLY GLY ILE TRP HIS ILE LEU THR THR PRO PHE GLY TRP
SEQRES 20 C 461 ALA ARG ARG ALA PHE ILE TRP SER GLY GLU ALA TYR LEU
SEQRES 21 C 461 SER TYR SER LEU GLY ALA LEU SER MET MET GLY PHE ILE
SEQRES 22 C 461 ALA THR CYS PHE VAL TRP PHE ASN ASN THR VAL TYR PRO
SEQRES 23 C 461 SER GLU PHE TYR GLY PRO THR GLY PRO GLU ALA SER GLN
SEQRES 24 C 461 ALA GLN ALA MET THR PHE LEU ILE ARG ASP GLN LYS LEU
SEQRES 25 C 461 GLY ALA ASN VAL GLY SER ALA GLN GLY PRO THR GLY LEU
SEQRES 26 C 461 GLY LYS TYR LEU MET ARG SER PRO THR GLY GLU ILE ILE
SEQRES 27 C 461 PHE GLY GLY GLU THR MET ARG PHE TRP ASP PHE ARG GLY
SEQRES 28 C 461 PRO TRP LEU GLU PRO LEU ARG GLY PRO ASN GLY LEU ASP
SEQRES 29 C 461 LEU ASN LYS ILE LYS ASN ASP ILE GLN PRO TRP GLN GLU
SEQRES 30 C 461 ARG ARG ALA ALA GLU TYR MET THR HIS ALA PRO LEU GLY
SEQRES 31 C 461 SER LEU ASN SER VAL GLY GLY VAL ALA THR GLU ILE ASN
SEQRES 32 C 461 SER VAL ASN PHE VAL SER PRO ARG SER TRP LEU ALA THR
SEQRES 33 C 461 SER HIS PHE VAL LEU ALA PHE PHE PHE LEU VAL GLY HIS
SEQRES 34 C 461 LEU TRP HIS ALA GLY ARG ALA ARG ALA ALA ALA ALA GLY
SEQRES 35 C 461 PHE GLU LYS GLY ILE ASP ARG GLU SER GLU PRO VAL LEU
SEQRES 36 C 461 SER MET PRO SER LEU ASP
SEQRES 1 D 352 MET THR ILE ALA ILE GLY ARG ALA PRO ALA GLU ARG GLY
SEQRES 2 D 352 TRP PHE ASP ILE LEU ASP ASP TRP LEU LYS ARG ASP ARG
SEQRES 3 D 352 PHE VAL PHE VAL GLY TRP SER GLY ILE LEU LEU PHE PRO
SEQRES 4 D 352 CYS ALA TYR LEU ALA LEU GLY GLY TRP LEU THR GLY THR
SEQRES 5 D 352 THR PHE VAL THR SER TRP TYR THR HIS GLY LEU ALA SER
SEQRES 6 D 352 SER TYR LEU GLU GLY CYS ASN PHE LEU THR VAL ALA VAL
SEQRES 7 D 352 SER THR PRO ALA ASN SER MET GLY HIS SER LEU LEU LEU
SEQRES 8 D 352 LEU TRP GLY PRO GLU ALA GLN GLY ASP PHE THR ARG TRP
SEQRES 9 D 352 CYS GLN LEU GLY GLY LEU TRP THR PHE ILE ALA LEU HIS
SEQRES 10 D 352 GLY ALA PHE GLY LEU ILE GLY PHE MET LEU ARG GLN PHE
SEQRES 11 D 352 GLU ILE ALA ARG LEU VAL GLY VAL ARG PRO TYR ASN ALA
SEQRES 12 D 352 ILE ALA PHE SER ALA PRO ILE ALA VAL PHE VAL SER VAL
SEQRES 13 D 352 PHE LEU ILE TYR PRO LEU GLY GLN SER SER TRP PHE PHE
SEQRES 14 D 352 ALA PRO SER PHE GLY VAL ALA ALA ILE PHE ARG PHE LEU
SEQRES 15 D 352 LEU PHE PHE GLN GLY PHE HIS ASN TRP THR LEU ASN PRO
SEQRES 16 D 352 PHE HIS MET MET GLY VAL ALA GLY VAL LEU GLY GLY ALA
SEQRES 17 D 352 LEU LEU CYS ALA ILE HIS GLY ALA THR VAL GLU ASN THR
SEQRES 18 D 352 LEU PHE GLN ASP GLY GLU GLY ALA SER THR PHE ARG ALA
SEQRES 19 D 352 PHE ASN PRO THR GLN ALA GLU GLU THR TYR SER MET VAL
SEQRES 20 D 352 THR ALA ASN ARG PHE TRP SER GLN ILE PHE GLY ILE ALA
SEQRES 21 D 352 PHE SER ASN LYS ARG TRP LEU HIS PHE PHE MET LEU PHE
SEQRES 22 D 352 VAL PRO VAL THR GLY LEU TRP MET SER ALA ILE GLY VAL
SEQRES 23 D 352 VAL GLY LEU ALA LEU ASN LEU ARG SER TYR ASP PHE ILE
SEQRES 24 D 352 SER GLN GLU ILE ARG ALA ALA GLU ASP PRO GLU PHE GLU
SEQRES 25 D 352 THR PHE TYR THR LYS ASN LEU LEU LEU ASN GLU GLY ILE
SEQRES 26 D 352 ARG ALA TRP MET ALA PRO GLN ASP GLN PRO HIS GLU ASN
SEQRES 27 D 352 PHE VAL PHE PRO GLU GLU VAL LEU PRO ARG GLY ASN ALA
SEQRES 28 D 352 LEU
SEQRES 1 E 84 MET ALA GLY THR THR GLY GLU ARG PRO PHE SER ASP ILE
SEQRES 2 E 84 ILE THR SER VAL ARG TYR TRP VAL ILE HIS SER ILE THR
SEQRES 3 E 84 ILE PRO ALA LEU PHE ILE ALA GLY TRP LEU PHE VAL SER
SEQRES 4 E 84 THR GLY LEU ALA TYR ASP VAL PHE GLY THR PRO ARG PRO
SEQRES 5 E 84 ASP SER TYR TYR ALA GLN GLU GLN ARG SER ILE PRO LEU
SEQRES 6 E 84 VAL THR ASP ARG PHE GLU ALA LYS GLN GLN VAL GLU THR
SEQRES 7 E 84 PHE LEU GLU GLN LEU LYS
SEQRES 1 F 45 MET THR SER ASN THR PRO ASN GLN GLU PRO VAL SER TYR
SEQRES 2 F 45 PRO ILE PHE THR VAL ARG TRP VAL ALA VAL HIS THR LEU
SEQRES 3 F 45 ALA VAL PRO THR ILE PHE PHE LEU GLY ALA ILE ALA ALA
SEQRES 4 F 45 MET GLN PHE ILE GLN ARG
SEQRES 1 H 66 MET ALA ARG ARG THR TRP LEU GLY ASP ILE LEU ARG PRO
SEQRES 2 H 66 LEU ASN SER GLU TYR GLY LYS VAL ALA PRO GLY TRP GLY
SEQRES 3 H 66 THR THR PRO LEU MET ALA VAL PHE MET GLY LEU PHE LEU
SEQRES 4 H 66 VAL PHE LEU LEU ILE ILE LEU GLU ILE TYR ASN SER THR
SEQRES 5 H 66 LEU ILE LEU ASP GLY VAL ASN VAL SER TRP LYS ALA LEU
SEQRES 6 H 66 GLY
SEQRES 1 I 38 MET GLU THR LEU LYS ILE THR VAL TYR ILE VAL VAL THR
SEQRES 2 I 38 PHE PHE VAL LEU LEU PHE VAL PHE GLY PHE LEU SER GLY
SEQRES 3 I 38 ASP PRO ALA ARG ASN PRO LYS ARG LYS ASP LEU GLU
SEQRES 1 J 40 MET MET SER GLU GLY GLY ARG ILE PRO LEU TRP ILE VAL
SEQRES 2 J 40 ALA THR VAL ALA GLY MET GLY VAL ILE VAL ILE VAL GLY
SEQRES 3 J 40 LEU PHE PHE TYR GLY ALA TYR ALA GLY LEU GLY SER SER
SEQRES 4 J 40 LEU
SEQRES 1 K 46 MET ILE ASP ALA LEU VAL LEU VAL ALA LYS LEU PRO GLU
SEQRES 2 K 46 ALA TYR ALA ILE PHE ASP PRO LEU VAL ASP VAL LEU PRO
SEQRES 3 K 46 VAL ILE PRO VAL LEU PHE LEU ALA LEU ALA PHE VAL TRP
SEQRES 4 K 46 GLN ALA ALA VAL GLY PHE ARG
SEQRES 1 L 37 MET GLU PRO ASN PRO ASN ARG GLN PRO VAL GLU LEU ASN
SEQRES 2 L 37 ARG THR SER LEU TYR LEU GLY LEU LEU LEU ILE LEU VAL
SEQRES 3 L 37 LEU ALA LEU LEU PHE SER SER TYR PHE PHE ASN
SEQRES 1 M 36 MET GLU VAL ASN GLN LEU GLY LEU ILE ALA THR ALA LEU
SEQRES 2 M 36 PHE VAL LEU VAL PRO SER VAL PHE LEU ILE ILE LEU TYR
SEQRES 3 M 36 VAL GLN THR GLU SER GLN GLN LYS SER SER
SEQRES 1 O 272 MET LYS TYR ARG ILE LEU MET ALA THR LEU LEU ALA VAL
SEQRES 2 O 272 CYS LEU GLY ILE PHE SER LEU SER ALA PRO ALA PHE ALA
SEQRES 3 O 272 ALA LYS GLN THR LEU THR TYR ASP ASP ILE VAL GLY THR
SEQRES 4 O 272 GLY LEU ALA ASN LYS CYS PRO THR LEU ASP ASP THR ALA
SEQRES 5 O 272 ARG GLY ALA TYR PRO ILE ASP SER SER GLN THR TYR ARG
SEQRES 6 O 272 ILE ALA ARG LEU CYS LEU GLN PRO THR THR PHE LEU VAL
SEQRES 7 O 272 LYS GLU GLU PRO LYS ASN LYS ARG GLN GLU ALA GLU PHE
SEQRES 8 O 272 VAL PRO THR LYS LEU VAL THR ARG GLU THR THR SER LEU
SEQRES 9 O 272 ASP GLN ILE GLN GLY GLU LEU LYS VAL ASN SER ASP GLY
SEQRES 10 O 272 SER LEU THR PHE VAL GLU GLU ASP GLY ILE ASP PHE GLN
SEQRES 11 O 272 PRO VAL THR VAL GLN MET ALA GLY GLY GLU ARG ILE PRO
SEQRES 12 O 272 LEU LEU PHE THR VAL LYS ASN LEU VAL ALA SER THR GLN
SEQRES 13 O 272 PRO ASN VAL THR SER ILE THR THR SER THR ASP PHE LYS
SEQRES 14 O 272 GLY GLU PHE ASN VAL PRO SER TYR ARG THR ALA ASN PHE
SEQRES 15 O 272 LEU ASP PRO LYS GLY ARG GLY LEU ALA SER GLY TYR ASP
SEQRES 16 O 272 SER ALA ILE ALA LEU PRO GLN ALA LYS GLU GLU GLU LEU
SEQRES 17 O 272 ALA ARG ALA ASN VAL LYS ARG PHE SER LEU THR LYS GLY
SEQRES 18 O 272 GLN ILE SER LEU ASN VAL ALA LYS VAL ASP GLY ARG THR
SEQRES 19 O 272 GLY GLU ILE ALA GLY THR PHE GLU SER GLU GLN LEU SER
SEQRES 20 O 272 ASP ASP ASP MET GLY ALA HIS GLU PRO HIS GLU VAL LYS
SEQRES 21 O 272 ILE GLN GLY VAL PHE TYR ALA SER ILE GLU PRO ALA
SEQRES 1 T 32 MET GLU THR ILE THR TYR VAL PHE ILE PHE ALA CYS ILE
SEQRES 2 T 32 ILE ALA LEU PHE PHE PHE ALA ILE PHE PHE ARG GLU PRO
SEQRES 3 T 32 PRO ARG ILE THR LYS LYS
SEQRES 1 U 134 MET GLN ARG LEU GLY ARG TRP LEU ALA LEU ALA TYR PHE
SEQRES 2 U 134 VAL GLY VAL SER LEU LEU GLY TRP ILE ASN TRP SER ALA
SEQRES 3 U 134 PRO THR LEU ALA ALA THR ALA SER THR GLU GLU GLU LEU
SEQRES 4 U 134 VAL ASN VAL VAL ASP GLU LYS LEU GLY THR ALA TYR GLY
SEQRES 5 U 134 GLU LYS ILE ASP LEU ASN ASN THR ASN ILE ALA ALA PHE
SEQRES 6 U 134 ILE GLN TYR ARG GLY LEU TYR PRO THR LEU ALA LYS LEU
SEQRES 7 U 134 ILE VAL LYS ASN ALA PRO TYR GLU SER VAL GLU ASP VAL
SEQRES 8 U 134 LEU ASN ILE PRO GLY LEU THR GLU ARG GLN LYS GLN ILE
SEQRES 9 U 134 LEU ARG GLU ASN LEU GLU HIS PHE THR VAL THR GLU VAL
SEQRES 10 U 134 GLU THR ALA LEU VAL GLU GLY GLY ASP ARG TYR ASN ASN
SEQRES 11 U 134 GLY LEU TYR LYS
SEQRES 1 V 163 MET LEU LYS LYS CYS VAL TRP LEU ALA VAL ALA LEU CYS
SEQRES 2 V 163 LEU CYS LEU TRP GLN PHE THR MET GLY THR ALA LEU ALA
SEQRES 3 V 163 ALA GLU LEU THR PRO GLU VAL LEU THR VAL PRO LEU ASN
SEQRES 4 V 163 SER GLU GLY LYS THR ILE THR LEU THR GLU LYS GLN TYR
SEQRES 5 V 163 LEU GLU GLY LYS ARG LEU PHE GLN TYR ALA CYS ALA SER
SEQRES 6 V 163 CYS HIS VAL GLY GLY ILE THR LYS THR ASN PRO SER LEU
SEQRES 7 V 163 ASP LEU ARG THR GLU THR LEU ALA LEU ALA THR PRO PRO
SEQRES 8 V 163 ARG ASP ASN ILE GLU GLY LEU VAL ASP TYR MET LYS ASN
SEQRES 9 V 163 PRO THR THR TYR ASP GLY GLU GLN GLU ILE ALA GLU VAL
SEQRES 10 V 163 HIS PRO SER LEU ARG SER ALA ASP ILE PHE PRO LYS MET
SEQRES 11 V 163 ARG ASN LEU THR GLU LYS ASP LEU VAL ALA ILE ALA GLY
SEQRES 12 V 163 HIS ILE LEU VAL GLU PRO LYS ILE LEU GLY ASP LYS TRP
SEQRES 13 V 163 GLY GLY GLY LYS VAL TYR TYR
SEQRES 1 y 46 MET GLY ILE PHE ASN GLY ILE ILE GLU PHE LEU SER ASN
SEQRES 2 y 46 ILE ASN PHE GLU VAL ILE ALA GLN LEU THR MET ILE ALA
SEQRES 3 y 46 MET ILE GLY ILE ALA GLY PRO MET ILE ILE PHE LEU LEU
SEQRES 4 y 46 ALA VAL ARG ARG GLY ASN LEU
SEQRES 1 X 41 MET THR ILE THR PRO SER LEU LYS GLY PHE PHE ILE GLY
SEQRES 2 X 41 LEU LEU SER GLY ALA VAL VAL LEU GLY LEU THR PHE ALA
SEQRES 3 X 41 VAL LEU ILE ALA ILE SER GLN ILE ASP LYS VAL GLN ARG
SEQRES 4 X 41 SER LEU
SEQRES 1 Y 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 Y 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 3 Y 28 UNK UNK
SEQRES 1 Z 62 MET THR ILE LEU PHE GLN LEU ALA LEU ALA ALA LEU VAL
SEQRES 2 Z 62 ILE LEU SER PHE VAL MET VAL ILE GLY VAL PRO VAL ALA
SEQRES 3 Z 62 TYR ALA SER PRO GLN ASP TRP ASP ARG SER LYS GLN LEU
SEQRES 4 Z 62 ILE PHE LEU GLY SER GLY LEU TRP ILE ALA LEU VAL LEU
SEQRES 5 Z 62 VAL VAL GLY VAL LEU ASN PHE PHE VAL VAL
SEQRES 1 a 344 MET THR THR THR LEU GLN ARG ARG GLU SER ALA ASN LEU
SEQRES 2 a 344 TRP GLU ARG PHE CYS ASN TRP VAL THR SER THR ASP ASN
SEQRES 3 a 344 ARG LEU TYR VAL GLY TRP PHE GLY VAL ILE MET ILE PRO
SEQRES 4 a 344 THR LEU LEU ALA ALA THR ILE CYS PHE VAL ILE ALA PHE
SEQRES 5 a 344 ILE ALA ALA PRO PRO VAL ASP ILE ASP GLY ILE ARG GLU
SEQRES 6 a 344 PRO VAL SER GLY SER LEU LEU TYR GLY ASN ASN ILE ILE
SEQRES 7 a 344 THR GLY ALA VAL VAL PRO SER SER ASN ALA ILE GLY LEU
SEQRES 8 a 344 HIS PHE TYR PRO ILE TRP GLU ALA ALA SER LEU ASP GLU
SEQRES 9 a 344 TRP LEU TYR ASN GLY GLY PRO TYR GLN LEU ILE ILE PHE
SEQRES 10 a 344 HIS PHE LEU LEU GLY ALA SER CYS TYR MET GLY ARG GLN
SEQRES 11 a 344 TRP GLU LEU SER TYR ARG LEU GLY MET ARG PRO TRP ILE
SEQRES 12 a 344 CYS VAL ALA TYR SER ALA PRO LEU ALA SER ALA PHE ALA
SEQRES 13 a 344 VAL PHE LEU ILE TYR PRO ILE GLY GLN GLY SER PHE SER
SEQRES 14 a 344 ASP GLY MET PRO LEU GLY ILE SER GLY THR PHE ASN PHE
SEQRES 15 a 344 MET ILE VAL PHE GLN ALA GLU HIS ASN ILE LEU MET HIS
SEQRES 16 a 344 PRO PHE HIS GLN LEU GLY VAL ALA GLY VAL PHE GLY GLY
SEQRES 17 a 344 ALA LEU PHE CYS ALA MET HIS GLY SER LEU VAL THR SER
SEQRES 18 a 344 SER LEU ILE ARG GLU THR THR GLU THR GLU SER ALA ASN
SEQRES 19 a 344 TYR GLY TYR LYS PHE GLY GLN GLU GLU GLU THR TYR ASN
SEQRES 20 a 344 ILE VAL ALA ALA HIS GLY TYR PHE GLY ARG LEU ILE PHE
SEQRES 21 a 344 GLN TYR ALA SER PHE ASN ASN SER ARG SER LEU HIS PHE
SEQRES 22 a 344 PHE LEU ALA ALA TRP PRO VAL VAL GLY VAL TRP PHE THR
SEQRES 23 a 344 ALA LEU GLY ILE SER THR MET ALA PHE ASN LEU ASN GLY
SEQRES 24 a 344 PHE ASN PHE ASN HIS SER VAL ILE ASP ALA LYS GLY ASN
SEQRES 25 a 344 VAL ILE ASN THR TRP ALA ASP ILE ILE ASN ARG ALA ASN
SEQRES 26 a 344 LEU GLY MET GLU VAL MET HIS GLU ARG ASN ALA HIS ASN
SEQRES 27 a 344 PHE PRO LEU ASP LEU ALA
SEQRES 1 b 510 MET GLY LEU PRO TRP TYR ARG VAL HIS THR VAL LEU ILE
SEQRES 2 b 510 ASN ASP PRO GLY ARG LEU ILE ALA ALA HIS LEU MET HIS
SEQRES 3 b 510 THR ALA LEU VAL ALA GLY TRP ALA GLY SER MET ALA LEU
SEQRES 4 b 510 TYR GLU LEU ALA THR PHE ASP PRO SER ASP PRO VAL LEU
SEQRES 5 b 510 ASN PRO MET TRP ARG GLN GLY MET PHE VAL LEU PRO PHE
SEQRES 6 b 510 MET ALA ARG LEU GLY VAL THR GLY SER TRP SER GLY TRP
SEQRES 7 b 510 SER ILE THR GLY GLU THR GLY ILE ASP PRO GLY PHE TRP
SEQRES 8 b 510 SER PHE GLU GLY VAL ALA LEU ALA HIS ILE VAL LEU SER
SEQRES 9 b 510 GLY LEU LEU PHE LEU ALA ALA CYS TRP HIS TRP VAL TYR
SEQRES 10 b 510 TRP ASP LEU GLU LEU PHE ARG ASP PRO ARG THR GLY GLU
SEQRES 11 b 510 PRO ALA LEU ASP LEU PRO LYS MET PHE GLY ILE HIS LEU
SEQRES 12 b 510 PHE LEU ALA GLY LEU LEU CYS PHE GLY PHE GLY ALA PHE
SEQRES 13 b 510 HIS LEU THR GLY LEU PHE GLY PRO GLY MET TRP VAL SER
SEQRES 14 b 510 ASP PRO TYR GLY LEU THR GLY SER VAL GLN PRO VAL ALA
SEQRES 15 b 510 PRO GLU TRP GLY PRO ASP GLY PHE ASN PRO TYR ASN PRO
SEQRES 16 b 510 GLY GLY VAL VAL ALA HIS HIS ILE ALA ALA GLY ILE VAL
SEQRES 17 b 510 GLY ILE ILE ALA GLY LEU PHE HIS ILE LEU VAL ARG PRO
SEQRES 18 b 510 PRO GLN ARG LEU TYR LYS ALA LEU ARG MET GLY ASN ILE
SEQRES 19 b 510 GLU THR VAL LEU SER SER SER ILE ALA ALA VAL PHE PHE
SEQRES 20 b 510 ALA ALA PHE VAL VAL ALA GLY THR MET TRP TYR GLY SER
SEQRES 21 b 510 ALA THR THR PRO ILE GLU LEU PHE GLY PRO THR ARG TYR
SEQRES 22 b 510 GLN TRP ASP SER SER TYR PHE GLN GLN GLU ILE ASN ARG
SEQRES 23 b 510 ARG VAL GLN ALA SER LEU ALA SER GLY ALA THR LEU GLU
SEQRES 24 b 510 GLU ALA TRP SER ALA ILE PRO GLU LYS LEU ALA PHE TYR
SEQRES 25 b 510 ASP TYR ILE GLY ASN ASN PRO ALA LYS GLY GLY LEU PHE
SEQRES 26 b 510 ARG THR GLY PRO MET ASN LYS GLY ASP GLY ILE ALA GLN
SEQRES 27 b 510 ALA TRP LYS GLY HIS ALA VAL PHE ARG ASN LYS GLU GLY
SEQRES 28 b 510 GLU GLU LEU PHE VAL ARG ARG MET PRO ALA PHE PHE GLU
SEQRES 29 b 510 SER PHE PRO VAL ILE LEU THR ASP LYS ASN GLY VAL VAL
SEQRES 30 b 510 LYS ALA ASP ILE PRO PHE ARG ARG ALA GLU SER LYS TYR
SEQRES 31 b 510 SER PHE GLU GLN GLN GLY VAL THR VAL SER PHE TYR GLY
SEQRES 32 b 510 GLY GLU LEU ASN GLY GLN THR PHE THR ASP PRO PRO THR
SEQRES 33 b 510 VAL LYS SER TYR ALA ARG LYS ALA ILE PHE GLY GLU ILE
SEQRES 34 b 510 PHE GLU PHE ASP THR GLU THR LEU ASN SER ASP GLY ILE
SEQRES 35 b 510 PHE ARG THR SER PRO ARG GLY TRP PHE THR PHE ALA HIS
SEQRES 36 b 510 ALA VAL PHE ALA LEU LEU PHE PHE PHE GLY HIS ILE TRP
SEQRES 37 b 510 HIS GLY ALA ARG THR LEU PHE ARG ASP VAL PHE SER GLY
SEQRES 38 b 510 ILE ASP PRO GLU LEU SER PRO GLU GLN VAL GLU TRP GLY
SEQRES 39 b 510 PHE TYR GLN LYS VAL GLY ASP VAL THR THR ARG ARG LYS
SEQRES 40 b 510 GLU ALA VAL
SEQRES 1 c 461 MET VAL THR LEU SER SER ASN SER ILE PHE ALA THR ASN
SEQRES 2 c 461 ARG ASP GLN GLU SER SER GLY PHE ALA TRP TRP ALA GLY
SEQRES 3 c 461 ASN ALA ARG LEU ILE ASN LEU SER GLY LYS LEU LEU GLY
SEQRES 4 c 461 ALA HIS VAL ALA HIS ALA GLY LEU ILE VAL PHE TRP ALA
SEQRES 5 c 461 GLY ALA MET THR LEU PHE GLU LEU ALA HIS PHE ILE PRO
SEQRES 6 c 461 GLU LYS PRO MET TYR GLU GLN GLY LEU ILE LEU ILE PRO
SEQRES 7 c 461 HIS ILE ALA THR LEU GLY TRP GLY VAL GLY PRO GLY GLY
SEQRES 8 c 461 GLU VAL VAL ASP THR PHE PRO PHE PHE VAL VAL GLY VAL
SEQRES 9 c 461 VAL HIS LEU ILE SER SER ALA VAL LEU GLY PHE GLY GLY
SEQRES 10 c 461 VAL TYR HIS ALA ILE ARG GLY PRO GLU THR LEU GLU GLU
SEQRES 11 c 461 TYR SER SER PHE PHE GLY TYR ASP TRP LYS ASP LYS ASN
SEQRES 12 c 461 LYS MET THR THR ILE LEU GLY PHE HIS LEU ILE VAL LEU
SEQRES 13 c 461 GLY ILE GLY ALA LEU LEU LEU VAL ALA LYS ALA MET PHE
SEQRES 14 c 461 PHE GLY GLY LEU TYR ASP THR TRP ALA PRO GLY GLY GLY
SEQRES 15 c 461 ASP VAL ARG VAL ILE THR ASN PRO THR LEU ASP PRO ARG
SEQRES 16 c 461 VAL ILE PHE GLY TYR LEU LEU LYS SER PRO PHE GLY GLY
SEQRES 17 c 461 GLU GLY TRP ILE VAL SER VAL ASN ASN LEU GLU ASP VAL
SEQRES 18 c 461 VAL GLY GLY HIS ILE TRP ILE GLY LEU ILE CYS ILE ALA
SEQRES 19 c 461 GLY GLY ILE TRP HIS ILE LEU THR THR PRO PHE GLY TRP
SEQRES 20 c 461 ALA ARG ARG ALA PHE ILE TRP SER GLY GLU ALA TYR LEU
SEQRES 21 c 461 SER TYR SER LEU GLY ALA LEU SER MET MET GLY PHE ILE
SEQRES 22 c 461 ALA THR CYS PHE VAL TRP PHE ASN ASN THR VAL TYR PRO
SEQRES 23 c 461 SER GLU PHE TYR GLY PRO THR GLY PRO GLU ALA SER GLN
SEQRES 24 c 461 ALA GLN ALA MET THR PHE LEU ILE ARG ASP GLN LYS LEU
SEQRES 25 c 461 GLY ALA ASN VAL GLY SER ALA GLN GLY PRO THR GLY LEU
SEQRES 26 c 461 GLY LYS TYR LEU MET ARG SER PRO THR GLY GLU ILE ILE
SEQRES 27 c 461 PHE GLY GLY GLU THR MET ARG PHE TRP ASP PHE ARG GLY
SEQRES 28 c 461 PRO TRP LEU GLU PRO LEU ARG GLY PRO ASN GLY LEU ASP
SEQRES 29 c 461 LEU ASN LYS ILE LYS ASN ASP ILE GLN PRO TRP GLN GLU
SEQRES 30 c 461 ARG ARG ALA ALA GLU TYR MET THR HIS ALA PRO LEU GLY
SEQRES 31 c 461 SER LEU ASN SER VAL GLY GLY VAL ALA THR GLU ILE ASN
SEQRES 32 c 461 SER VAL ASN PHE VAL SER PRO ARG SER TRP LEU ALA THR
SEQRES 33 c 461 SER HIS PHE VAL LEU ALA PHE PHE PHE LEU VAL GLY HIS
SEQRES 34 c 461 LEU TRP HIS ALA GLY ARG ALA ARG ALA ALA ALA ALA GLY
SEQRES 35 c 461 PHE GLU LYS GLY ILE ASP ARG GLU SER GLU PRO VAL LEU
SEQRES 36 c 461 SER MET PRO SER LEU ASP
SEQRES 1 d 352 MET THR ILE ALA ILE GLY ARG ALA PRO ALA GLU ARG GLY
SEQRES 2 d 352 TRP PHE ASP ILE LEU ASP ASP TRP LEU LYS ARG ASP ARG
SEQRES 3 d 352 PHE VAL PHE VAL GLY TRP SER GLY ILE LEU LEU PHE PRO
SEQRES 4 d 352 CYS ALA TYR LEU ALA LEU GLY GLY TRP LEU THR GLY THR
SEQRES 5 d 352 THR PHE VAL THR SER TRP TYR THR HIS GLY LEU ALA SER
SEQRES 6 d 352 SER TYR LEU GLU GLY CYS ASN PHE LEU THR VAL ALA VAL
SEQRES 7 d 352 SER THR PRO ALA ASN SER MET GLY HIS SER LEU LEU LEU
SEQRES 8 d 352 LEU TRP GLY PRO GLU ALA GLN GLY ASP PHE THR ARG TRP
SEQRES 9 d 352 CYS GLN LEU GLY GLY LEU TRP THR PHE ILE ALA LEU HIS
SEQRES 10 d 352 GLY ALA PHE GLY LEU ILE GLY PHE MET LEU ARG GLN PHE
SEQRES 11 d 352 GLU ILE ALA ARG LEU VAL GLY VAL ARG PRO TYR ASN ALA
SEQRES 12 d 352 ILE ALA PHE SER ALA PRO ILE ALA VAL PHE VAL SER VAL
SEQRES 13 d 352 PHE LEU ILE TYR PRO LEU GLY GLN SER SER TRP PHE PHE
SEQRES 14 d 352 ALA PRO SER PHE GLY VAL ALA ALA ILE PHE ARG PHE LEU
SEQRES 15 d 352 LEU PHE PHE GLN GLY PHE HIS ASN TRP THR LEU ASN PRO
SEQRES 16 d 352 PHE HIS MET MET GLY VAL ALA GLY VAL LEU GLY GLY ALA
SEQRES 17 d 352 LEU LEU CYS ALA ILE HIS GLY ALA THR VAL GLU ASN THR
SEQRES 18 d 352 LEU PHE GLN ASP GLY GLU GLY ALA SER THR PHE ARG ALA
SEQRES 19 d 352 PHE ASN PRO THR GLN ALA GLU GLU THR TYR SER MET VAL
SEQRES 20 d 352 THR ALA ASN ARG PHE TRP SER GLN ILE PHE GLY ILE ALA
SEQRES 21 d 352 PHE SER ASN LYS ARG TRP LEU HIS PHE PHE MET LEU PHE
SEQRES 22 d 352 VAL PRO VAL THR GLY LEU TRP MET SER ALA ILE GLY VAL
SEQRES 23 d 352 VAL GLY LEU ALA LEU ASN LEU ARG SER TYR ASP PHE ILE
SEQRES 24 d 352 SER GLN GLU ILE ARG ALA ALA GLU ASP PRO GLU PHE GLU
SEQRES 25 d 352 THR PHE TYR THR LYS ASN LEU LEU LEU ASN GLU GLY ILE
SEQRES 26 d 352 ARG ALA TRP MET ALA PRO GLN ASP GLN PRO HIS GLU ASN
SEQRES 27 d 352 PHE VAL PHE PRO GLU GLU VAL LEU PRO ARG GLY ASN ALA
SEQRES 28 d 352 LEU
SEQRES 1 e 84 MET ALA GLY THR THR GLY GLU ARG PRO PHE SER ASP ILE
SEQRES 2 e 84 ILE THR SER VAL ARG TYR TRP VAL ILE HIS SER ILE THR
SEQRES 3 e 84 ILE PRO ALA LEU PHE ILE ALA GLY TRP LEU PHE VAL SER
SEQRES 4 e 84 THR GLY LEU ALA TYR ASP VAL PHE GLY THR PRO ARG PRO
SEQRES 5 e 84 ASP SER TYR TYR ALA GLN GLU GLN ARG SER ILE PRO LEU
SEQRES 6 e 84 VAL THR ASP ARG PHE GLU ALA LYS GLN GLN VAL GLU THR
SEQRES 7 e 84 PHE LEU GLU GLN LEU LYS
SEQRES 1 f 45 MET THR SER ASN THR PRO ASN GLN GLU PRO VAL SER TYR
SEQRES 2 f 45 PRO ILE PHE THR VAL ARG TRP VAL ALA VAL HIS THR LEU
SEQRES 3 f 45 ALA VAL PRO THR ILE PHE PHE LEU GLY ALA ILE ALA ALA
SEQRES 4 f 45 MET GLN PHE ILE GLN ARG
SEQRES 1 h 66 MET ALA ARG ARG THR TRP LEU GLY ASP ILE LEU ARG PRO
SEQRES 2 h 66 LEU ASN SER GLU TYR GLY LYS VAL ALA PRO GLY TRP GLY
SEQRES 3 h 66 THR THR PRO LEU MET ALA VAL PHE MET GLY LEU PHE LEU
SEQRES 4 h 66 VAL PHE LEU LEU ILE ILE LEU GLU ILE TYR ASN SER THR
SEQRES 5 h 66 LEU ILE LEU ASP GLY VAL ASN VAL SER TRP LYS ALA LEU
SEQRES 6 h 66 GLY
SEQRES 1 i 38 MET GLU THR LEU LYS ILE THR VAL TYR ILE VAL VAL THR
SEQRES 2 i 38 PHE PHE VAL LEU LEU PHE VAL PHE GLY PHE LEU SER GLY
SEQRES 3 i 38 ASP PRO ALA ARG ASN PRO LYS ARG LYS ASP LEU GLU
SEQRES 1 j 40 MET MET SER GLU GLY GLY ARG ILE PRO LEU TRP ILE VAL
SEQRES 2 j 40 ALA THR VAL ALA GLY MET GLY VAL ILE VAL ILE VAL GLY
SEQRES 3 j 40 LEU PHE PHE TYR GLY ALA TYR ALA GLY LEU GLY SER SER
SEQRES 4 j 40 LEU
SEQRES 1 k 46 MET ILE ASP ALA LEU VAL LEU VAL ALA LYS LEU PRO GLU
SEQRES 2 k 46 ALA TYR ALA ILE PHE ASP PRO LEU VAL ASP VAL LEU PRO
SEQRES 3 k 46 VAL ILE PRO VAL LEU PHE LEU ALA LEU ALA PHE VAL TRP
SEQRES 4 k 46 GLN ALA ALA VAL GLY PHE ARG
SEQRES 1 l 37 MET GLU PRO ASN PRO ASN ARG GLN PRO VAL GLU LEU ASN
SEQRES 2 l 37 ARG THR SER LEU TYR LEU GLY LEU LEU LEU ILE LEU VAL
SEQRES 3 l 37 LEU ALA LEU LEU PHE SER SER TYR PHE PHE ASN
SEQRES 1 m 36 MET GLU VAL ASN GLN LEU GLY LEU ILE ALA THR ALA LEU
SEQRES 2 m 36 PHE VAL LEU VAL PRO SER VAL PHE LEU ILE ILE LEU TYR
SEQRES 3 m 36 VAL GLN THR GLU SER GLN GLN LYS SER SER
SEQRES 1 o 272 MET LYS TYR ARG ILE LEU MET ALA THR LEU LEU ALA VAL
SEQRES 2 o 272 CYS LEU GLY ILE PHE SER LEU SER ALA PRO ALA PHE ALA
SEQRES 3 o 272 ALA LYS GLN THR LEU THR TYR ASP ASP ILE VAL GLY THR
SEQRES 4 o 272 GLY LEU ALA ASN LYS CYS PRO THR LEU ASP ASP THR ALA
SEQRES 5 o 272 ARG GLY ALA TYR PRO ILE ASP SER SER GLN THR TYR ARG
SEQRES 6 o 272 ILE ALA ARG LEU CYS LEU GLN PRO THR THR PHE LEU VAL
SEQRES 7 o 272 LYS GLU GLU PRO LYS ASN LYS ARG GLN GLU ALA GLU PHE
SEQRES 8 o 272 VAL PRO THR LYS LEU VAL THR ARG GLU THR THR SER LEU
SEQRES 9 o 272 ASP GLN ILE GLN GLY GLU LEU LYS VAL ASN SER ASP GLY
SEQRES 10 o 272 SER LEU THR PHE VAL GLU GLU ASP GLY ILE ASP PHE GLN
SEQRES 11 o 272 PRO VAL THR VAL GLN MET ALA GLY GLY GLU ARG ILE PRO
SEQRES 12 o 272 LEU LEU PHE THR VAL LYS ASN LEU VAL ALA SER THR GLN
SEQRES 13 o 272 PRO ASN VAL THR SER ILE THR THR SER THR ASP PHE LYS
SEQRES 14 o 272 GLY GLU PHE ASN VAL PRO SER TYR ARG THR ALA ASN PHE
SEQRES 15 o 272 LEU ASP PRO LYS GLY ARG GLY LEU ALA SER GLY TYR ASP
SEQRES 16 o 272 SER ALA ILE ALA LEU PRO GLN ALA LYS GLU GLU GLU LEU
SEQRES 17 o 272 ALA ARG ALA ASN VAL LYS ARG PHE SER LEU THR LYS GLY
SEQRES 18 o 272 GLN ILE SER LEU ASN VAL ALA LYS VAL ASP GLY ARG THR
SEQRES 19 o 272 GLY GLU ILE ALA GLY THR PHE GLU SER GLU GLN LEU SER
SEQRES 20 o 272 ASP ASP ASP MET GLY ALA HIS GLU PRO HIS GLU VAL LYS
SEQRES 21 o 272 ILE GLN GLY VAL PHE TYR ALA SER ILE GLU PRO ALA
SEQRES 1 t 32 MET GLU THR ILE THR TYR VAL PHE ILE PHE ALA CYS ILE
SEQRES 2 t 32 ILE ALA LEU PHE PHE PHE ALA ILE PHE PHE ARG GLU PRO
SEQRES 3 t 32 PRO ARG ILE THR LYS LYS
SEQRES 1 u 134 MET GLN ARG LEU GLY ARG TRP LEU ALA LEU ALA TYR PHE
SEQRES 2 u 134 VAL GLY VAL SER LEU LEU GLY TRP ILE ASN TRP SER ALA
SEQRES 3 u 134 PRO THR LEU ALA ALA THR ALA SER THR GLU GLU GLU LEU
SEQRES 4 u 134 VAL ASN VAL VAL ASP GLU LYS LEU GLY THR ALA TYR GLY
SEQRES 5 u 134 GLU LYS ILE ASP LEU ASN ASN THR ASN ILE ALA ALA PHE
SEQRES 6 u 134 ILE GLN TYR ARG GLY LEU TYR PRO THR LEU ALA LYS LEU
SEQRES 7 u 134 ILE VAL LYS ASN ALA PRO TYR GLU SER VAL GLU ASP VAL
SEQRES 8 u 134 LEU ASN ILE PRO GLY LEU THR GLU ARG GLN LYS GLN ILE
SEQRES 9 u 134 LEU ARG GLU ASN LEU GLU HIS PHE THR VAL THR GLU VAL
SEQRES 10 u 134 GLU THR ALA LEU VAL GLU GLY GLY ASP ARG TYR ASN ASN
SEQRES 11 u 134 GLY LEU TYR LYS
SEQRES 1 v 163 MET LEU LYS LYS CYS VAL TRP LEU ALA VAL ALA LEU CYS
SEQRES 2 v 163 LEU CYS LEU TRP GLN PHE THR MET GLY THR ALA LEU ALA
SEQRES 3 v 163 ALA GLU LEU THR PRO GLU VAL LEU THR VAL PRO LEU ASN
SEQRES 4 v 163 SER GLU GLY LYS THR ILE THR LEU THR GLU LYS GLN TYR
SEQRES 5 v 163 LEU GLU GLY LYS ARG LEU PHE GLN TYR ALA CYS ALA SER
SEQRES 6 v 163 CYS HIS VAL GLY GLY ILE THR LYS THR ASN PRO SER LEU
SEQRES 7 v 163 ASP LEU ARG THR GLU THR LEU ALA LEU ALA THR PRO PRO
SEQRES 8 v 163 ARG ASP ASN ILE GLU GLY LEU VAL ASP TYR MET LYS ASN
SEQRES 9 v 163 PRO THR THR TYR ASP GLY GLU GLN GLU ILE ALA GLU VAL
SEQRES 10 v 163 HIS PRO SER LEU ARG SER ALA ASP ILE PHE PRO LYS MET
SEQRES 11 v 163 ARG ASN LEU THR GLU LYS ASP LEU VAL ALA ILE ALA GLY
SEQRES 12 v 163 HIS ILE LEU VAL GLU PRO LYS ILE LEU GLY ASP LYS TRP
SEQRES 13 v 163 GLY GLY GLY LYS VAL TYR TYR
SEQRES 1 g 46 MET GLY ILE PHE ASN GLY ILE ILE GLU PHE LEU SER ASN
SEQRES 2 g 46 ILE ASN PHE GLU VAL ILE ALA GLN LEU THR MET ILE ALA
SEQRES 3 g 46 MET ILE GLY ILE ALA GLY PRO MET ILE ILE PHE LEU LEU
SEQRES 4 g 46 ALA VAL ARG ARG GLY ASN LEU
SEQRES 1 x 41 MET THR ILE THR PRO SER LEU LYS GLY PHE PHE ILE GLY
SEQRES 2 x 41 LEU LEU SER GLY ALA VAL VAL LEU GLY LEU THR PHE ALA
SEQRES 3 x 41 VAL LEU ILE ALA ILE SER GLN ILE ASP LYS VAL GLN ARG
SEQRES 4 x 41 SER LEU
SEQRES 1 G 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 G 28 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 3 G 28 UNK UNK
SEQRES 1 z 62 MET THR ILE LEU PHE GLN LEU ALA LEU ALA ALA LEU VAL
SEQRES 2 z 62 ILE LEU SER PHE VAL MET VAL ILE GLY VAL PRO VAL ALA
SEQRES 3 z 62 TYR ALA SER PRO GLN ASP TRP ASP ARG SER LYS GLN LEU
SEQRES 4 z 62 ILE PHE LEU GLY SER GLY LEU TRP ILE ALA LEU VAL LEU
SEQRES 5 z 62 VAL VAL GLY VAL LEU ASN PHE PHE VAL VAL
HET FE2 A 401 1
HET CLA A 402 65
HET CLA A 403 65
HET CLA A 404 65
HET CLA A 405 65
HET PL9 A 406 45
HET BCR A 407 40
HET DGD A 408 56
HET LHG A 409 39
HET LMG A 410 51
HET CL A 411 1
HET OEX A 412 10
HET SQD A 413 51
HET SQD A 414 54
HET LMG A 415 42
HET CLA B 601 65
HET CLA B 602 65
HET CLA B 603 65
HET CLA B 604 65
HET CLA B 605 65
HET CLA B 606 65
HET CLA B 607 65
HET CLA B 608 65
HET CLA B 609 65
HET CLA B 610 65
HET CLA B 611 65
HET CLA B 612 65
HET CLA B 613 65
HET CLA B 614 65
HET CLA B 615 65
HET BCR B 616 40
HET BCR B 617 40
HET BCR B 618 40
HET BCR B 619 40
HET DGD B 620 58
HET LMG B 621 49
HET LMT B 622 35
HET LMT B 623 35
HET LMG B 624 49
HET DGD B 625 52
HET SQD B 626 47
HET LMT B 627 35
HET LMT B 628 35
HET CLA C 501 65
HET CLA C 502 65
HET CLA C 503 65
HET CLA C 504 65
HET CLA C 505 65
HET CLA C 506 65
HET CLA C 507 65
HET CLA C 508 65
HET CLA C 509 65
HET CLA C 510 65
HET CLA C 511 65
HET CLA C 512 65
HET BCR C 513 40
HET BCR C 514 40
HET DGD C 515 53
HET DGD C 516 62
HET DGD C 517 66
HET LMG C 518 45
HET LHG C 519 37
HET CLA C 520 65
HET BCR C 521 40
HET LMG C 522 48
HET PHO D 401 64
HET PHO D 402 64
HET SQD D 403 43
HET BCT D 404 4
HET CLA D 405 65
HET CLA D 406 65
HET PL9 D 407 55
HET LMG D 408 48
HET DGD D 409 63
HET LMT D 410 31
HET BCR D 411 40
HET LMG D 412 46
HET LMG E 101 44
HET HEM F 101 43
HET SQD F 102 45
HET CLA H 101 65
HET BCR H 102 40
HET LMG I 101 43
HET LMT I 102 35
HET PL9 J 101 35
HET BCR J 102 40
HET CA K 101 1
HET LMG M 101 42
HET LMT M 102 35
HET LMT M 103 35
HET CA O 301 1
HET HEM V 201 43
HET BCR y 101 40
HET SQD a 401 54
HET LMG a 402 42
HET FE2 a 403 1
HET CLA a 404 65
HET CLA a 405 65
HET CLA a 406 65
HET PHO a 407 64
HET CLA a 408 65
HET PL9 a 409 45
HET BCR a 410 40
HET DGD a 411 56
HET LHG a 412 39
HET LMG a 413 51
HET OEX a 414 10
HET SQD a 415 51
HET CL a 416 1
HET DGD b 601 52
HET SQD b 602 47
HET LMT b 603 35
HET LMT b 604 35
HET CLA b 605 65
HET CLA b 606 65
HET CLA b 607 65
HET CLA b 608 65
HET CLA b 609 65
HET CLA b 610 65
HET CLA b 611 65
HET CLA b 612 65
HET CLA b 613 65
HET CLA b 614 65
HET CLA b 615 65
HET CLA b 616 65
HET CLA b 617 65
HET CLA b 618 65
HET CLA b 619 65
HET BCR b 620 40
HET BCR b 621 40
HET BCR b 622 40
HET BCR b 623 40
HET DGD b 624 58
HET LMG b 625 49
HET LMT b 626 35
HET LMT b 627 35
HET LMG b 628 49
HET CLA c 501 65
HET CLA c 502 65
HET CLA c 503 65
HET CLA c 504 65
HET CLA c 505 65
HET CLA c 506 65
HET CLA c 507 65
HET CLA c 508 65
HET CLA c 509 65
HET CLA c 510 65
HET CLA c 511 65
HET CLA c 512 65
HET BCR c 513 40
HET BCR c 514 40
HET DGD c 515 53
HET DGD c 516 62
HET DGD c 517 66
HET LMG c 518 45
HET LHG c 519 37
HET CLA c 520 65
HET BCR c 521 40
HET LMG c 522 48
HET PHO d 401 64
HET SQD d 402 43
HET BCT d 403 4
HET CLA d 404 65
HET CLA d 405 65
HET PL9 d 406 55
HET LMG d 407 48
HET DGD d 408 63
HET LMT d 409 31
HET LMG d 410 46
HET LMG e 101 44
HET HEM f 101 43
HET BCR f 102 40
HET SQD f 103 45
HET CLA h 101 65
HET LMG i 101 43
HET LMT i 102 35
HET PL9 j 101 35
HET BCR j 102 40
HET CA k 101 1
HET LMG m 101 42
HET CA o 301 1
HET HEM v 201 43
HET BCR g 101 40
HET BCR x 101 40
HETNAM FE2 FE (II) ION
HETNAM CLA CHLOROPHYLL A
HETNAM PL9 2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,
HETNAM 2 PL9 6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-
HETNAM 3 PL9 CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-
HETNAM 4 PL9 BENZOQUINONE
HETNAM BCR BETA-CAROTENE
HETNAM DGD DIGALACTOSYL DIACYL GLYCEROL (DGDG)
HETNAM LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
HETNAM LMG 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
HETNAM CL CHLORIDE ION
HETNAM OEX CA-MN4-O5 CLUSTER
HETNAM SQD 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-
HETNAM 2 SQD GLUCOPYRANOSYL]-SN-GLYCEROL
HETNAM LMT DODECYL-BETA-D-MALTOSIDE
HETNAM PHO PHEOPHYTIN A
HETNAM BCT BICARBONATE ION
HETNAM HEM PROTOPORPHYRIN IX CONTAINING FE
HETNAM CA CALCIUM ION
HETSYN PL9 PLASTOQUINONE 9
HETSYN SQD SULFOQUINOVOSYLDIACYLGLYCEROL
HETSYN HEM HEME
FORMUL 41 FE2 2(FE 2+)
FORMUL 42 CLA 70(C55 H72 MG N4 O5 2+)
FORMUL 46 PL9 6(C53 H80 O2)
FORMUL 47 BCR 24(C40 H56)
FORMUL 48 DGD 14(C51 H96 O15)
FORMUL 49 LHG 4(C38 H75 O10 P)
FORMUL 50 LMG 22(C45 H86 O10)
FORMUL 51 CL 2(CL 1-)
FORMUL 52 OEX 2(CA MN4 O5)
FORMUL 53 SQD 10(C41 H78 O12 S)
FORMUL 77 LMT 14(C24 H46 O11)
FORMUL 06 PHO 4(C55 H74 N4 O5)
FORMUL 09 BCT 2(C H O3 1-)
FORMUL 19 HEM 4(C34 H32 FE N4 O4)
FORMUL 27 CA 4(CA 2+)
HELIX 1 AA1 ASN A 12 THR A 22 1 11
HELIX 2 AA2 PHE A 33 ALA A 55 1 23
HELIX 3 AA3 SER A 70 GLY A 74 5 5
HELIX 4 AA4 PRO A 95 ALA A 99 5 5
HELIX 5 AA5 SER A 101 ASN A 108 1 8
HELIX 6 AA6 GLY A 109 LEU A 137 1 29
HELIX 7 AA7 TRP A 142 TYR A 147 1 6
HELIX 8 AA8 TYR A 147 LEU A 159 1 13
HELIX 9 AA9 LEU A 159 GLY A 166 1 8
HELIX 10 AB1 SER A 167 GLY A 171 5 5
HELIX 11 AB2 ILE A 176 ASN A 191 1 16
HELIX 12 AB3 ILE A 192 MET A 194 5 3
HELIX 13 AB4 HIS A 195 SER A 222 1 28
HELIX 14 AB5 SER A 232 TYR A 237 5 6
HELIX 15 AB6 ASN A 247 ILE A 259 1 13
HELIX 16 AB7 PHE A 260 SER A 264 5 5
HELIX 17 AB8 ASN A 267 MET A 293 1 27
HELIX 18 AB9 THR A 316 HIS A 332 1 17
HELIX 19 AC1 GLU A 333 HIS A 337 5 5
HELIX 20 AC2 PRO B 4 ILE B 13 5 10
HELIX 21 AC3 ASP B 15 ALA B 43 1 29
HELIX 22 AC4 PRO B 54 GLN B 58 5 5
HELIX 23 AC5 VAL B 62 ARG B 68 1 7
HELIX 24 AC6 SER B 92 TYR B 117 1 26
HELIX 25 AC7 LEU B 120 ARG B 124 5 5
HELIX 26 AC8 ASP B 134 PHE B 156 1 23
HELIX 27 AC9 GLY B 186 ASN B 191 5 6
HELIX 28 AD1 ASN B 194 VAL B 219 1 26
HELIX 29 AD2 PRO B 222 LEU B 229 1 8
HELIX 30 AD3 ASN B 233 GLU B 235 5 3
HELIX 31 AD4 THR B 236 TYR B 258 1 23
HELIX 32 AD5 PRO B 264 GLY B 269 1 6
HELIX 33 AD6 THR B 271 SER B 277 1 7
HELIX 34 AD7 SER B 278 SER B 294 1 17
HELIX 35 AD8 THR B 297 ILE B 305 1 9
HELIX 36 AD9 PRO B 306 TYR B 312 1 7
HELIX 37 AE1 ASP B 313 ASN B 318 5 6
HELIX 38 AE2 PRO B 329 GLY B 333 5 5
HELIX 39 AE3 ARG B 384 SER B 388 5 5
HELIX 40 AE4 SER B 391 GLY B 396 1 6
HELIX 41 AE5 ASP B 413 ILE B 425 1 13
HELIX 42 AE6 SER B 446 PHE B 475 1 30
HELIX 43 AE7 ALA C 34 ILE C 43 5 10
HELIX 44 AE8 LEU C 45 PHE C 75 1 31
HELIX 45 AE9 PRO C 80 GLN C 84 5 5
HELIX 46 AF1 LEU C 88 LEU C 95 1 8
HELIX 47 AF2 GLY C 100 GLU C 104 5 5
HELIX 48 AF3 THR C 108 ARG C 135 1 28
HELIX 49 AF4 ASP C 153 PHE C 181 1 29
HELIX 50 AF5 ASP C 205 PHE C 210 1 6
HELIX 51 AF6 GLY C 211 LYS C 215 5 5
HELIX 52 AF7 GLY C 222 VAL C 227 5 6
HELIX 53 AF8 ASN C 229 LEU C 253 1 25
HELIX 54 AF9 GLY C 258 PHE C 264 1 7
HELIX 55 AG1 SER C 267 ASN C 293 1 27
HELIX 56 AG2 THR C 305 LEU C 324 1 20
HELIX 57 AG3 ASN C 327 ALA C 331 5 5
HELIX 58 AG4 GLY C 353 TRP C 359 5 7
HELIX 59 AG5 LEU C 366 PRO C 368 5 3
HELIX 60 AG6 ASP C 376 ASP C 383 1 8
HELIX 61 AG7 GLN C 385 THR C 397 1 13
HELIX 62 AG8 SER C 421 GLY C 454 1 34
HELIX 63 AG9 GLU C 464 MET C 469 5 6
HELIX 64 AH1 TRP D 14 LYS D 23 1 10
HELIX 65 AH2 VAL D 30 PHE D 54 1 25
HELIX 66 AH3 SER D 57 GLY D 62 1 6
HELIX 67 AH4 SER D 66 GLY D 70 5 5
HELIX 68 AH5 ASP D 100 LEU D 107 1 8
HELIX 69 AH6 GLY D 108 GLY D 137 1 30
HELIX 70 AH7 PRO D 140 PHE D 146 1 7
HELIX 71 AH8 PHE D 146 LEU D 158 1 13
HELIX 72 AH9 LEU D 158 GLN D 164 1 7
HELIX 73 AI1 SER D 166 ALA D 170 5 5
HELIX 74 AI2 VAL D 175 ASN D 190 1 16
HELIX 75 AI3 TRP D 191 LEU D 193 5 3
HELIX 76 AI4 ASN D 194 ASN D 220 1 27
HELIX 77 AI5 SER D 245 PHE D 257 1 13
HELIX 78 AI6 ASN D 263 LEU D 291 1 29
HELIX 79 AI7 PHE D 298 ASP D 308 1 11
HELIX 80 AI8 THR D 313 GLN D 334 1 22
HELIX 81 AI9 PRO D 335 ASN D 338 5 4
HELIX 82 AJ1 PRO D 342 LEU D 346 5 5
HELIX 83 AJ2 PRO E 9 SER E 16 1 8
HELIX 84 AJ3 SER E 16 THR E 40 1 25
HELIX 85 AJ4 GLY E 41 PHE E 47 1 7
HELIX 86 AJ5 GLU E 71 GLN E 82 1 12
HELIX 87 AJ6 THR F 17 GLN F 41 1 25
HELIX 88 AJ7 THR H 5 LEU H 11 1 7
HELIX 89 AJ8 THR H 27 ASN H 50 1 24
HELIX 90 AJ9 GLU I 2 SER I 25 1 24
HELIX 91 AK1 PRO J 9 ALA J 32 1 24
HELIX 92 AK2 ALA K 14 ILE K 17 5 4
HELIX 93 AK3 PHE K 18 ASP K 23 1 6
HELIX 94 AK4 VAL K 24 PRO K 26 5 3
HELIX 95 AK5 VAL K 27 VAL K 43 1 17
HELIX 96 AK6 ASN L 13 ASN L 37 1 25
HELIX 97 AK7 LEU M 6 SER M 31 1 26
HELIX 98 AK8 GLY O 40 LYS O 44 5 5
HELIX 99 AK9 LEU O 208 VAL O 213 1 6
HELIX 100 AL1 GLU T 2 PHE T 23 1 22
HELIX 101 AL2 ASN U 41 LEU U 47 1 7
HELIX 102 AL3 ASN U 61 TYR U 68 5 8
HELIX 103 AL4 PRO U 73 ASN U 82 1 10
HELIX 104 AL5 SER U 87 ILE U 94 5 8
HELIX 105 AL6 THR U 98 LEU U 109 1 12
HELIX 106 AL7 GLU U 118 GLU U 123 1 6
HELIX 107 AL8 GLY U 124 ASP U 126 5 3
HELIX 108 AL9 THR V 48 CYS V 63 1 16
HELIX 109 AM1 CYS V 63 VAL V 68 1 6
HELIX 110 AM2 GLY V 69 ILE V 71 5 3
HELIX 111 AM3 ARG V 81 LEU V 87 1 7
HELIX 112 AM4 ASN V 94 MET V 102 1 9
HELIX 113 AM5 SER V 120 ALA V 124 5 5
HELIX 114 AM6 PRO V 128 LEU V 133 1 6
HELIX 115 AM7 THR V 134 GLY V 153 1 20
HELIX 116 AM8 GLY V 153 GLY V 158 1 6
HELIX 117 AM9 GLY V 159 TYR V 163 5 5
HELIX 118 AN1 GLN y 21 ARG y 42 1 22
HELIX 119 AN2 THR X 13 GLN X 42 1 30
HELIX 120 AN3 UNK Y 2 UNK Y 13 1 12
HELIX 121 AN4 UNK Y 14 UNK Y 25 1 12
HELIX 122 AN5 THR Z 2 SER Z 29 1 28
HELIX 123 AN6 ARG Z 35 VAL Z 62 1 28
HELIX 124 AN7 ASN a 12 THR a 22 1 11
HELIX 125 AN8 PHE a 33 ALA a 55 1 23
HELIX 126 AN9 SER a 70 GLY a 74 5 5
HELIX 127 AO1 PRO a 95 ALA a 99 5 5
HELIX 128 AO2 SER a 101 ASN a 108 1 8
HELIX 129 AO3 GLY a 109 LEU a 137 1 29
HELIX 130 AO4 TRP a 142 TYR a 147 1 6
HELIX 131 AO5 TYR a 147 LEU a 159 1 13
HELIX 132 AO6 LEU a 159 GLY a 166 1 8
HELIX 133 AO7 SER a 167 GLY a 171 5 5
HELIX 134 AO8 ILE a 176 ASN a 191 1 16
HELIX 135 AO9 ILE a 192 MET a 194 5 3
HELIX 136 AP1 HIS a 195 SER a 222 1 28
HELIX 137 AP2 SER a 232 TYR a 237 5 6
HELIX 138 AP3 ASN a 247 ILE a 259 1 13
HELIX 139 AP4 PHE a 260 SER a 264 5 5
HELIX 140 AP5 ASN a 267 MET a 293 1 27
HELIX 141 AP6 THR a 316 HIS a 332 1 17
HELIX 142 AP7 GLU a 333 HIS a 337 5 5
HELIX 143 AP8 PRO b 4 ILE b 13 5 10
HELIX 144 AP9 ASP b 15 ALA b 43 1 29
HELIX 145 AQ1 PRO b 54 GLN b 58 5 5
HELIX 146 AQ2 VAL b 62 ARG b 68 1 7
HELIX 147 AQ3 SER b 92 TYR b 117 1 26
HELIX 148 AQ4 LEU b 120 ARG b 124 5 5
HELIX 149 AQ5 ASP b 134 PHE b 156 1 23
HELIX 150 AQ6 GLY b 186 ASN b 191 5 6
HELIX 151 AQ7 ASN b 194 VAL b 219 1 26
HELIX 152 AQ8 PRO b 222 LEU b 229 1 8
HELIX 153 AQ9 ASN b 233 GLU b 235 5 3
HELIX 154 AR1 THR b 236 TYR b 258 1 23
HELIX 155 AR2 PRO b 264 GLY b 269 1 6
HELIX 156 AR3 THR b 271 SER b 277 1 7
HELIX 157 AR4 SER b 278 SER b 294 1 17
HELIX 158 AR5 THR b 297 ILE b 305 1 9
HELIX 159 AR6 PRO b 306 TYR b 312 1 7
HELIX 160 AR7 ASP b 313 ASN b 318 5 6
HELIX 161 AR8 PRO b 329 GLY b 333 5 5
HELIX 162 AR9 ARG b 384 SER b 388 5 5
HELIX 163 AS1 SER b 391 GLY b 396 1 6
HELIX 164 AS2 ASP b 413 ILE b 425 1 13
HELIX 165 AS3 SER b 446 PHE b 475 1 30
HELIX 166 AS4 ALA c 34 ILE c 43 5 10
HELIX 167 AS5 LEU c 45 PHE c 75 1 31
HELIX 168 AS6 PRO c 80 GLN c 84 5 5
HELIX 169 AS7 LEU c 88 LEU c 95 1 8
HELIX 170 AS8 GLY c 100 GLU c 104 5 5
HELIX 171 AS9 THR c 108 ARG c 135 1 28
HELIX 172 AT1 ASP c 153 PHE c 181 1 29
HELIX 173 AT2 ASP c 205 PHE c 210 1 6
HELIX 174 AT3 GLY c 211 LYS c 215 5 5
HELIX 175 AT4 GLY c 222 VAL c 227 5 6
HELIX 176 AT5 ASN c 229 LEU c 253 1 25
HELIX 177 AT6 GLY c 258 PHE c 264 1 7
HELIX 178 AT7 SER c 267 ASN c 293 1 27
HELIX 179 AT8 THR c 305 LEU c 324 1 20
HELIX 180 AT9 ASN c 327 ALA c 331 5 5
HELIX 181 AU1 GLY c 353 TRP c 359 5 7
HELIX 182 AU2 LEU c 366 PRO c 368 5 3
HELIX 183 AU3 ASP c 376 ASP c 383 1 8
HELIX 184 AU4 GLN c 385 THR c 397 1 13
HELIX 185 AU5 SER c 421 GLY c 454 1 34
HELIX 186 AU6 GLU c 464 MET c 469 5 6
HELIX 187 AU7 TRP d 14 LYS d 23 1 10
HELIX 188 AU8 VAL d 30 PHE d 54 1 25
HELIX 189 AU9 SER d 57 GLY d 62 1 6
HELIX 190 AV1 SER d 66 GLY d 70 5 5
HELIX 191 AV2 ASP d 100 LEU d 107 1 8
HELIX 192 AV3 GLY d 108 GLY d 137 1 30
HELIX 193 AV4 PRO d 140 PHE d 146 1 7
HELIX 194 AV5 PHE d 146 LEU d 158 1 13
HELIX 195 AV6 LEU d 158 GLN d 164 1 7
HELIX 196 AV7 SER d 166 ALA d 170 5 5
HELIX 197 AV8 VAL d 175 ASN d 190 1 16
HELIX 198 AV9 TRP d 191 LEU d 193 5 3
HELIX 199 AW1 ASN d 194 ASN d 220 1 27
HELIX 200 AW2 SER d 245 PHE d 257 1 13
HELIX 201 AW3 ASN d 263 LEU d 291 1 29
HELIX 202 AW4 PHE d 298 ASP d 308 1 11
HELIX 203 AW5 THR d 313 GLN d 334 1 22
HELIX 204 AW6 PRO d 335 ASN d 338 5 4
HELIX 205 AW7 PRO d 342 LEU d 346 5 5
HELIX 206 AW8 PRO e 9 SER e 16 1 8
HELIX 207 AW9 SER e 16 THR e 40 1 25
HELIX 208 AX1 GLY e 41 PHE e 47 1 7
HELIX 209 AX2 GLU e 71 GLN e 82 1 12
HELIX 210 AX3 THR f 17 GLN f 41 1 25
HELIX 211 AX4 THR h 5 LEU h 11 1 7
HELIX 212 AX5 THR h 27 ASN h 50 1 24
HELIX 213 AX6 GLU i 2 SER i 25 1 24
HELIX 214 AX7 PRO j 9 ALA j 32 1 24
HELIX 215 AX8 ALA k 14 ILE k 17 5 4
HELIX 216 AX9 PHE k 18 ASP k 23 1 6
HELIX 217 AY1 VAL k 24 PRO k 26 5 3
HELIX 218 AY2 VAL k 27 VAL k 43 1 17
HELIX 219 AY3 ASN l 13 ASN l 37 1 25
HELIX 220 AY4 LEU m 6 SER m 31 1 26
HELIX 221 AY5 GLY o 40 LYS o 44 5 5
HELIX 222 AY6 LEU o 208 VAL o 213 1 6
HELIX 223 AY7 GLU t 2 PHE t 23 1 22
HELIX 224 AY8 ASN u 41 LEU u 47 1 7
HELIX 225 AY9 ASN u 61 TYR u 68 5 8
HELIX 226 AZ1 PRO u 73 ASN u 82 1 10
HELIX 227 AZ2 SER u 87 ILE u 94 5 8
HELIX 228 AZ3 THR u 98 LEU u 109 1 12
HELIX 229 AZ4 GLU u 118 GLU u 123 1 6
HELIX 230 AZ5 GLY u 124 ASP u 126 5 3
HELIX 231 AZ6 THR v 48 CYS v 63 1 16
HELIX 232 AZ7 CYS v 63 VAL v 68 1 6
HELIX 233 AZ8 GLY v 69 ILE v 71 5 3
HELIX 234 AZ9 ARG v 81 LEU v 87 1 7
HELIX 235 BA1 ASN v 94 MET v 102 1 9
HELIX 236 BA2 SER v 120 ALA v 124 5 5
HELIX 237 BA3 PRO v 128 LEU v 133 1 6
HELIX 238 BA4 THR v 134 GLY v 153 1 20
HELIX 239 BA5 GLY v 153 GLY v 158 1 6
HELIX 240 BA6 GLY v 159 TYR v 163 5 5
HELIX 241 BA7 GLN g 21 ARG g 42 1 22
HELIX 242 BA8 THR x 13 GLN x 42 1 30
HELIX 243 BA9 UNK G 2 UNK G 12 1 11
HELIX 244 BB1 UNK G 14 UNK G 25 1 12
HELIX 245 BB2 THR z 2 SER z 29 1 28
HELIX 246 BB3 ARG z 35 VAL z 62 1 28
SHEET 1 AA1 2 ALA A 81 VAL A 82 0
SHEET 2 AA1 2 LEU A 174 GLY A 175 -1 O LEU A 174 N VAL A 82
SHEET 1 AA2 2 LEU A 297 ASN A 298 0
SHEET 2 AA2 2 GLY C 402 SER C 403 1 O GLY C 402 N ASN A 298
SHEET 1 AA3 2 MET B 166 VAL B 168 0
SHEET 2 AA3 2 SER B 177 GLN B 179 -1 O SER B 177 N VAL B 168
SHEET 1 AA4 6 VAL B 377 ASP B 380 0
SHEET 2 AA4 6 ILE B 369 THR B 371 -1 N LEU B 370 O ALA B 379
SHEET 3 AA4 6 GLU B 353 VAL B 356 -1 N PHE B 355 O THR B 371
SHEET 4 AA4 6 ILE B 336 ARG B 347 -1 N PHE B 346 O LEU B 354
SHEET 5 AA4 6 THR B 398 TYR B 402 -1 O THR B 398 N ARG B 347
SHEET 6 AA4 6 THR B 410 PHE B 411 -1 O PHE B 411 N VAL B 399
SHEET 1 AA5 5 VAL B 377 ASP B 380 0
SHEET 2 AA5 5 ILE B 369 THR B 371 -1 N LEU B 370 O ALA B 379
SHEET 3 AA5 5 GLU B 353 VAL B 356 -1 N PHE B 355 O THR B 371
SHEET 4 AA5 5 ILE B 336 ARG B 347 -1 N PHE B 346 O LEU B 354
SHEET 5 AA5 5 ILE B 429 ASP B 433 -1 O GLU B 431 N GLN B 338
SHEET 1 AA6 2 LEU C 185 ASP C 187 0
SHEET 2 AA6 2 ASP C 195 ARG C 197 -1 O ARG C 197 N LEU C 185
SHEET 1 AA7 2 LEU C 341 ARG C 343 0
SHEET 2 AA7 2 ILE C 349 PHE C 351 -1 O ILE C 350 N MET C 342
SHEET 1 AA8 2 ARG C 370 GLY C 371 0
SHEET 2 AA8 2 GLY C 374 LEU C 375 -1 O GLY C 374 N GLY C 371
SHEET 1 AA9 2 ALA D 77 VAL D 78 0
SHEET 2 AA9 2 PHE D 173 GLY D 174 -1 O PHE D 173 N VAL D 78
SHEET 1 AB1 2 TYR O 56 PRO O 57 0
SHEET 2 AB1 2 SER O 161 ILE O 162 -1 O ILE O 162 N TYR O 56
SHEET 1 AB210 PHE O 91 PRO O 93 0
SHEET 2 AB210 ARG O 65 LYS O 79 -1 N VAL O 78 O VAL O 92
SHEET 3 AB210 GLU O 258 GLU O 270 -1 O LYS O 260 N LEU O 77
SHEET 4 AB210 GLU O 236 LEU O 246 -1 N SER O 243 O ILE O 261
SHEET 5 AB210 LEU O 218 LYS O 229 -1 N ALA O 228 O ALA O 238
SHEET 6 AB210 PHE O 168 PRO O 175 -1 N VAL O 174 O THR O 219
SHEET 7 AB210 VAL O 152 SER O 154 -1 N SER O 154 O LYS O 169
SHEET 8 AB210 LEU O 119 ILE O 127 -1 N PHE O 121 O ALA O 153
SHEET 9 AB210 LEU O 104 VAL O 113 -1 N GLN O 108 O GLU O 124
SHEET 10 AB210 ARG O 65 LYS O 79 -1 N LEU O 71 O LEU O 104
SHEET 1 AB3 3 LYS O 95 LEU O 96 0
SHEET 2 AB3 3 PHE O 129 GLN O 135 -1 O GLN O 135 N LYS O 95
SHEET 3 AB3 3 ARG O 141 THR O 147 -1 O ILE O 142 N VAL O 134
SHEET 1 AB4 2 ILE U 55 ASP U 56 0
SHEET 2 AB4 2 PHE U 112 THR U 113 1 O THR U 113 N ILE U 55
SHEET 1 AB5 2 THR V 35 PRO V 37 0
SHEET 2 AB5 2 THR V 44 THR V 46 -1 O ILE V 45 N VAL V 36
SHEET 1 AB6 2 ALA a 81 VAL a 82 0
SHEET 2 AB6 2 LEU a 174 GLY a 175 -1 O LEU a 174 N VAL a 82
SHEET 1 AB7 2 LEU a 297 ASN a 298 0
SHEET 2 AB7 2 GLY c 402 SER c 403 1 O GLY c 402 N ASN a 298
SHEET 1 AB8 2 MET b 166 VAL b 168 0
SHEET 2 AB8 2 SER b 177 GLN b 179 -1 O SER b 177 N VAL b 168
SHEET 1 AB9 6 VAL b 377 ASP b 380 0
SHEET 2 AB9 6 ILE b 369 THR b 371 -1 N LEU b 370 O ALA b 379
SHEET 3 AB9 6 GLU b 353 VAL b 356 -1 N PHE b 355 O THR b 371
SHEET 4 AB9 6 ILE b 336 ARG b 347 -1 N PHE b 346 O LEU b 354
SHEET 5 AB9 6 THR b 398 TYR b 402 -1 O THR b 398 N ARG b 347
SHEET 6 AB9 6 THR b 410 PHE b 411 -1 O PHE b 411 N VAL b 399
SHEET 1 AC1 5 VAL b 377 ASP b 380 0
SHEET 2 AC1 5 ILE b 369 THR b 371 -1 N LEU b 370 O ALA b 379
SHEET 3 AC1 5 GLU b 353 VAL b 356 -1 N PHE b 355 O THR b 371
SHEET 4 AC1 5 ILE b 336 ARG b 347 -1 N PHE b 346 O LEU b 354
SHEET 5 AC1 5 ILE b 429 ASP b 433 -1 O GLU b 431 N GLN b 338
SHEET 1 AC2 2 LEU c 185 ASP c 187 0
SHEET 2 AC2 2 ASP c 195 ARG c 197 -1 O ARG c 197 N LEU c 185
SHEET 1 AC3 2 LEU c 341 ARG c 343 0
SHEET 2 AC3 2 ILE c 349 PHE c 351 -1 O ILE c 350 N MET c 342
SHEET 1 AC4 2 ARG c 370 GLY c 371 0
SHEET 2 AC4 2 GLY c 374 LEU c 375 -1 O GLY c 374 N GLY c 371
SHEET 1 AC5 2 ALA d 77 VAL d 78 0
SHEET 2 AC5 2 PHE d 173 GLY d 174 -1 O PHE d 173 N VAL d 78
SHEET 1 AC6 2 TYR o 56 PRO o 57 0
SHEET 2 AC6 2 SER o 161 ILE o 162 -1 O ILE o 162 N TYR o 56
SHEET 1 AC710 PHE o 91 PRO o 93 0
SHEET 2 AC710 ARG o 65 LYS o 79 -1 N VAL o 78 O VAL o 92
SHEET 3 AC710 GLU o 258 GLU o 270 -1 O LYS o 260 N LEU o 77
SHEET 4 AC710 GLU o 236 LEU o 246 -1 N SER o 243 O ILE o 261
SHEET 5 AC710 LEU o 218 LYS o 229 -1 N ALA o 228 O ALA o 238
SHEET 6 AC710 PHE o 168 PRO o 175 -1 N VAL o 174 O THR o 219
SHEET 7 AC710 LYS o 149 SER o 154 -1 N LYS o 149 O ASN o 173
SHEET 8 AC710 LEU o 119 ILE o 127 -1 N PHE o 121 O ALA o 153
SHEET 9 AC710 LEU o 104 VAL o 113 -1 N GLN o 108 O GLU o 124
SHEET 10 AC710 ARG o 65 LYS o 79 -1 N LEU o 71 O LEU o 104
SHEET 1 AC8 3 LYS o 95 LEU o 96 0
SHEET 2 AC8 3 PHE o 129 GLN o 135 -1 O GLN o 135 N LYS o 95
SHEET 3 AC8 3 ARG o 141 THR o 147 -1 O ILE o 142 N VAL o 134
SHEET 1 AC9 2 ILE u 55 ASP u 56 0
SHEET 2 AC9 2 PHE u 112 THR u 113 1 O THR u 113 N ILE u 55
SHEET 1 AD1 2 THR v 35 PRO v 37 0
SHEET 2 AD1 2 THR v 44 THR v 46 -1 O ILE v 45 N VAL v 36
SSBOND 1 CYS O 45 CYS O 70 1555 1555 2.03
SSBOND 2 CYS o 45 CYS o 70 1555 1555 2.03
LINK OD1 ASP A 170 CA1 OEX A 412 1555 1555 3.20
LINK OD2 ASP A 170 MN4 OEX A 412 1555 1555 2.75
LINK OE1 GLU A 189 CA1 OEX A 412 1555 1555 3.08
LINK OE2 GLU A 189 MN1 OEX A 412 1555 1555 2.48
LINK NE2 HIS A 215 FE FE2 A 401 1555 1555 2.53
LINK NE2 HIS A 272 FE FE2 A 401 1555 1555 2.54
LINK NE2 HIS A 332 MN1 OEX A 412 1555 1555 2.54
LINK OE1 GLU A 333 MN3 OEX A 412 1555 1555 2.51
LINK OE2 GLU A 333 MN4 OEX A 412 1555 1555 2.73
LINK OD1 ASP A 342 MN2 OEX A 412 1555 1555 2.60
LINK OD2 ASP A 342 MN1 OEX A 412 1555 1555 2.78
LINK OXT ALA A 344 MN2 OEX A 412 1555 1555 2.58
LINK OD1 ASN C 39 MG CLA C 510 1555 1555 2.88
LINK OE2 GLU C 354 MN3 OEX A 412 1555 1555 2.70
LINK NE2 HIS D 214 FE FE2 A 401 1555 1555 2.51
LINK NE2 HIS D 268 FE FE2 A 401 1555 1555 2.67
LINK NE2 HIS E 23 FE HEM F 101 1555 1555 2.61
LINK NE2 HIS F 24 FE HEM F 101 1555 1555 2.63
LINK OD2 ASP K 19 CA CA K 101 1555 1555 2.59
LINK OD1 ASP K 23 CA CA K 101 1555 1555 2.88
LINK OD2 ASP K 23 CA CA K 101 1555 1555 2.67
LINK OE1 GLU O 140 CA CA O 301 1555 1555 2.60
LINK NE2 HIS V 67 FE HEM V 201 1555 1555 2.50
LINK NE2 HIS V 118 FE HEM V 201 1555 1555 2.58
LINK C UNK Y 1 N UNK Y 2 1555 1555 1.33
LINK C UNK Y 2 N UNK Y 3 1555 1555 1.33
LINK C UNK Y 3 N UNK Y 4 1555 1555 1.33
LINK C UNK Y 4 N UNK Y 5 1555 1555 1.33
LINK C UNK Y 5 N UNK Y 6 1555 1555 1.33
LINK C UNK Y 6 N UNK Y 7 1555 1555 1.33
LINK C UNK Y 7 N UNK Y 8 1555 1555 1.33
LINK C UNK Y 8 N UNK Y 9 1555 1555 1.33
LINK C UNK Y 9 N UNK Y 10 1555 1555 1.33
LINK C UNK Y 10 N UNK Y 11 1555 1555 1.33
LINK C UNK Y 11 N UNK Y 12 1555 1555 1.33
LINK C UNK Y 12 N UNK Y 13 1555 1555 1.33
LINK C UNK Y 13 N UNK Y 14 1555 1555 1.33
LINK C UNK Y 14 N UNK Y 15 1555 1555 1.33
LINK C UNK Y 15 N UNK Y 16 1555 1555 1.33
LINK C UNK Y 16 N UNK Y 17 1555 1555 1.33
LINK C UNK Y 17 N UNK Y 18 1555 1555 1.33
LINK C UNK Y 18 N UNK Y 19 1555 1555 1.33
LINK C UNK Y 19 N UNK Y 20 1555 1555 1.33
LINK C UNK Y 20 N UNK Y 21 1555 1555 1.33
LINK C UNK Y 21 N UNK Y 22 1555 1555 1.33
LINK C UNK Y 22 N UNK Y 23 1555 1555 1.33
LINK C UNK Y 23 N UNK Y 24 1555 1555 1.33
LINK C UNK Y 24 N UNK Y 25 1555 1555 1.33
LINK C UNK Y 25 N UNK Y 26 1555 1555 1.33
LINK C UNK Y 26 N UNK Y 27 1555 1555 1.33
LINK C UNK Y 27 N UNK Y 28 1555 1555 1.33
LINK OD1 ASP a 170 CA1 OEX a 414 1555 1555 3.00
LINK OD2 ASP a 170 MN4 OEX a 414 1555 1555 2.74
LINK OE1 GLU a 189 CA1 OEX a 414 1555 1555 3.06
LINK OE2 GLU a 189 MN1 OEX a 414 1555 1555 2.52
LINK NE2 HIS a 215 FE FE2 a 403 1555 1555 2.58
LINK NE2 HIS a 272 FE FE2 a 403 1555 1555 2.57
LINK NE2 HIS a 332 MN1 OEX a 414 1555 1555 2.53
LINK OE1 GLU a 333 MN3 OEX a 414 1555 1555 2.53
LINK OE2 GLU a 333 MN4 OEX a 414 1555 1555 2.79
LINK OD1 ASP a 342 MN2 OEX a 414 1555 1555 2.59
LINK OD2 ASP a 342 MN1 OEX a 414 1555 1555 2.79
LINK OXT ALA a 344 MN2 OEX a 414 1555 1555 2.59
LINK OD1 ASN c 39 MG CLA c 510 1555 1555 2.94
LINK OE1 GLU c 354 MN2 OEX a 414 1555 1555 2.72
LINK OE2 GLU c 354 MN3 OEX a 414 1555 1555 2.65
LINK NE2 HIS d 214 FE FE2 a 403 1555 1555 2.55
LINK NE2 HIS d 268 FE FE2 a 403 1555 1555 2.68
LINK NE2 HIS e 23 FE HEM f 101 1555 1555 2.60
LINK NE2 HIS f 24 FE HEM f 101 1555 1555 2.64
LINK OD2 ASP k 19 CA CA k 101 1555 1555 2.56
LINK OD1 ASP k 23 CA CA k 101 1555 1555 3.17
LINK OD2 ASP k 23 CA CA k 101 1555 1555 2.99
LINK OE1 GLU o 140 CA CA o 301 1555 1555 2.57
LINK NE2 HIS v 67 FE HEM v 201 1555 1555 2.53
LINK NE2 HIS v 118 FE HEM v 201 1555 1555 2.62
LINK C UNK G 1 N UNK G 2 1555 1555 1.33
LINK C UNK G 2 N UNK G 3 1555 1555 1.33
LINK C UNK G 3 N UNK G 4 1555 1555 1.33
LINK C UNK G 4 N UNK G 5 1555 1555 1.33
LINK C UNK G 5 N UNK G 6 1555 1555 1.33
LINK C UNK G 6 N UNK G 7 1555 1555 1.33
LINK C UNK G 7 N UNK G 8 1555 1555 1.33
LINK C UNK G 8 N UNK G 9 1555 1555 1.33
LINK C UNK G 9 N UNK G 10 1555 1555 1.33
LINK C UNK G 10 N UNK G 11 1555 1555 1.33
LINK C UNK G 11 N UNK G 12 1555 1555 1.33
LINK C UNK G 12 N UNK G 13 1555 1555 1.33
LINK C UNK G 13 N UNK G 14 1555 1555 1.33
LINK C UNK G 14 N UNK G 15 1555 1555 1.33
LINK C UNK G 15 N UNK G 16 1555 1555 1.33
LINK C UNK G 16 N UNK G 17 1555 1555 1.33
LINK C UNK G 17 N UNK G 18 1555 1555 1.33
LINK C UNK G 18 N UNK G 19 1555 1555 1.33
LINK C UNK G 19 N UNK G 20 1555 1555 1.33
LINK C UNK G 20 N UNK G 21 1555 1555 1.33
LINK C UNK G 21 N UNK G 22 1555 1555 1.33
LINK C UNK G 22 N UNK G 23 1555 1555 1.33
LINK C UNK G 23 N UNK G 24 1555 1555 1.33
LINK C UNK G 24 N UNK G 25 1555 1555 1.33
LINK C UNK G 25 N UNK G 26 1555 1555 1.33
LINK C UNK G 26 N UNK G 27 1555 1555 1.33
LINK C UNK G 27 N UNK G 28 1555 1555 1.33
LINK FE FE2 A 401 O3 BCT D 404 1555 1555 2.67
LINK FE FE2 A 401 O2 BCT D 404 1555 1555 2.68
LINK FE FE2 a 403 O2 BCT d 403 1555 1555 2.65
LINK FE FE2 a 403 O3 BCT d 403 1555 1555 2.67
CISPEP 1 THR V 89 PRO V 90 0 -0.74
CISPEP 2 THR v 89 PRO v 90 0 -0.81
SITE 1 AC1 5 HIS A 215 HIS A 272 HIS D 214 HIS D 268
SITE 2 AC1 5 BCT D 404
SITE 1 AC2 23 PHE A 119 TYR A 147 PRO A 150 SER A 153
SITE 2 AC2 23 VAL A 157 MET A 183 PHE A 186 GLN A 187
SITE 3 AC2 23 LEU A 193 HIS A 198 GLY A 201 VAL A 205
SITE 4 AC2 23 PHE A 206 VAL A 283 THR A 286 ILE A 290
SITE 5 AC2 23 CLA A 403 CLA A 404 LEU D 182 LEU D 205
SITE 6 AC2 23 PHO D 401 CLA D 405 PHE T 17
SITE 1 AC3 14 THR A 45 VAL A 157 PHE A 158 MET A 172
SITE 2 AC3 14 ILE A 176 THR A 179 MET A 183 CLA A 402
SITE 3 AC3 14 MET D 198 VAL D 201 ALA D 202 PHO D 401
SITE 4 AC3 14 CLA D 405 PL9 D 407
SITE 1 AC4 15 GLN A 199 VAL A 202 ALA A 203 LEU A 210
SITE 2 AC4 15 TRP A 278 CLA A 402 PL9 A 406 PHE D 157
SITE 3 AC4 15 VAL D 175 ILE D 178 PHE D 179 PHE D 181
SITE 4 AC4 15 LEU D 182 PHO D 402 CLA D 405
SITE 1 AC5 14 ILE A 36 PRO A 39 THR A 40 PHE A 93
SITE 2 AC5 14 PRO A 95 ILE A 96 TRP A 97 LEU A 114
SITE 3 AC5 14 HIS A 118 LEU A 121 BCR A 407 DGD A 408
SITE 4 AC5 14 TYR I 9 PHE I 15
SITE 1 AC6 15 HIS A 215 LEU A 218 HIS A 252 PHE A 255
SITE 2 AC6 15 SER A 264 PHE A 265 LEU A 271 PHE A 274
SITE 3 AC6 15 CLA A 404 PHE D 38 ALA D 41 TYR D 42
SITE 4 AC6 15 ALA F 22 THR F 25 PL9 J 101
SITE 1 AC7 8 ILE A 38 LEU A 42 ALA A 43 TRP A 105
SITE 2 AC7 8 CLA A 405 SQD A 414 PHE I 15 LMT b 603
SITE 1 AC8 13 PHE A 93 TRP A 97 GLU A 98 CLA A 405
SITE 2 AC8 13 LEU C 214 LYS C 215 SER C 216 PRO C 217
SITE 3 AC8 13 TRP C 223 PHE C 284 LYS I 5 TYR I 9
SITE 4 AC8 13 GLY O 38
SITE 1 AC9 14 ARG A 140 TRP A 142 PHE A 273 SQD A 413
SITE 2 AC9 14 TRP C 36 TRP C 443 ARG C 447 CLA C 507
SITE 3 AC9 14 CLA C 520 ASN D 220 ALA D 229 SER D 230
SITE 4 AC9 14 THR D 231 PHE D 232
SITE 1 AD1 12 SER A 232 ASN A 234 TRP B 5 TYR B 6
SITE 2 AD1 12 LMG B 624 TRP D 266 PHE D 269 PHE D 273
SITE 3 AD1 12 PL9 D 407 GLU L 11 ASN L 13 SER L 16
SITE 1 AD2 2 ASN A 181 LYS D 317
SITE 1 AD3 9 ASP A 170 GLU A 189 HIS A 332 GLU A 333
SITE 2 AD3 9 HIS A 337 ASP A 342 ALA A 344 GLU C 354
SITE 3 AD3 9 ARG C 357
SITE 1 AD4 14 ASN A 267 SER A 270 PHE A 273 PHE A 274
SITE 2 AD4 14 TRP A 278 LHG A 409 TRP C 36 DGD C 516
SITE 3 AD4 14 DGD C 517 LHG C 519 PHE D 232 ARG D 233
SITE 4 AD4 14 BCR J 102 PHE K 37
SITE 1 AD5 13 TRP A 20 ASN A 26 ARG A 27 LEU A 28
SITE 2 AD5 13 VAL A 30 THR A 45 BCR A 407 PHO D 401
SITE 3 AD5 13 TRP b 113 TYR b 117 CLA b 609 CLA b 619
SITE 4 AD5 13 BCR b 623
SITE 1 AD6 9 LEU A 72 LEU A 102 ASP A 103 ARG D 304
SITE 2 AD6 9 GLY O 138 ALA b 43 TRP b 75 SER b 76
SITE 3 AD6 9 LEU b 98
SITE 1 AD7 9 TRP B 185 PRO B 187 PHE B 190 ILE B 207
SITE 2 AD7 9 VAL B 208 PHE H 41 ILE H 44 CLA H 101
SITE 3 AD7 9 BCR H 102
SITE 1 AD8 20 ARG B 68 LEU B 69 ALA B 146 LEU B 149
SITE 2 AD8 20 CYS B 150 PHE B 153 VAL B 198 HIS B 201
SITE 3 AD8 20 HIS B 202 PHE B 247 ALA B 248 VAL B 252
SITE 4 AD8 20 THR B 262 CLA B 603 CLA B 604 CLA B 605
SITE 5 AD8 20 CLA B 608 PHE H 38 LEU H 42 CLA H 101
SITE 1 AD9 20 TRP B 33 PHE B 61 PHE B 65 ARG B 68
SITE 2 AD9 20 VAL B 245 ALA B 248 ALA B 249 VAL B 252
SITE 3 AD9 20 PHE B 451 HIS B 455 PHE B 458 ALA B 459
SITE 4 AD9 20 PHE B 462 CLA B 602 CLA B 604 CLA B 606
SITE 5 AD9 20 CLA B 610 CLA B 611 CLA B 612 CLA B 614
SITE 1 AE1 18 THR B 27 VAL B 30 ALA B 31 TRP B 33
SITE 2 AE1 18 ALA B 34 VAL B 62 PHE B 65 MET B 66
SITE 3 AE1 18 ARG B 68 LEU B 69 HIS B 100 LEU B 103
SITE 4 AE1 18 ALA B 205 CLA B 602 CLA B 603 CLA B 605
SITE 5 AE1 18 CLA B 609 CLA B 611
SITE 1 AE2 17 LEU B 69 TRP B 91 ALA B 99 LEU B 103
SITE 2 AE2 17 LEU B 106 GLY B 152 PHE B 153 PHE B 156
SITE 3 AE2 17 HIS B 157 PHE B 162 PRO B 164 CLA B 602
SITE 4 AE2 17 CLA B 604 CLA B 615 BCR B 619 LMT B 622
SITE 5 AE2 17 SQD a 401
SITE 1 AE3 20 TRP B 33 MET B 37 TYR B 40 GLN B 58
SITE 2 AE3 20 GLY B 59 PHE B 61 THR B 327 GLY B 328
SITE 3 AE3 20 PRO B 329 TRP B 450 ALA B 454 CLA B 603
SITE 4 AE3 20 BCR B 616 BCR B 617 BCR B 618 LMG B 621
SITE 5 AE3 20 LMG B 624 MET D 281 LEU L 27 PHE M 14
SITE 1 AE4 17 THR B 236 SER B 239 ALA B 243 PHE B 246
SITE 2 AE4 17 PHE B 247 PHE B 463 HIS B 466 LEU B 474
SITE 3 AE4 17 CLA B 608 CLA B 609 PHE D 120 ILE D 123
SITE 4 AE4 17 MET D 126 LEU D 127 PHE D 130 SQD D 403
SITE 5 AE4 17 LEU H 43
SITE 1 AE5 16 PHE B 139 ALA B 212 PHE B 215 HIS B 216
SITE 2 AE5 16 PRO B 221 PRO B 222 LEU B 229 CLA B 602
SITE 3 AE5 16 CLA B 607 CLA B 609 THR H 27 THR H 28
SITE 4 AE5 16 MET H 31 PHE H 34 MET H 35 BCR H 102
SITE 1 AE6 12 PHE B 139 HIS B 142 LEU B 143 ALA B 146
SITE 2 AE6 12 VAL B 237 SER B 240 CLA B 604 CLA B 607
SITE 3 AE6 12 CLA B 608 CLA B 611 CLA B 614 BCR H 102
SITE 1 AE7 17 TRP B 5 TYR B 6 ARG B 7 VAL B 8
SITE 2 AE7 17 HIS B 9 ILE B 242 LEU B 461 PHE B 462
SITE 3 AE7 17 GLY B 465 TRP B 468 HIS B 469 ARG B 472
SITE 4 AE7 17 CLA B 603 CLA B 611 CLA B 612 CLA B 613
SITE 5 AE7 17 LMG B 624
SITE 1 AE8 17 HIS B 9 LEU B 19 HIS B 23 HIS B 26
SITE 2 AE8 17 THR B 27 ILE B 234 VAL B 237 LEU B 238
SITE 3 AE8 17 SER B 241 VAL B 245 CLA B 603 CLA B 604
SITE 4 AE8 17 CLA B 609 CLA B 610 CLA B 612 CLA B 613
SITE 5 AE8 17 CLA B 614
SITE 1 AE9 10 HIS B 9 HIS B 26 VAL B 30 PHE B 462
SITE 2 AE9 10 CLA B 603 CLA B 610 CLA B 611 CLA B 613
SITE 3 AE9 10 BCR B 618 LMG B 624
SITE 1 AF1 14 VAL B 8 HIS B 9 VAL B 11 LEU B 12
SITE 2 AF1 14 LEU B 29 TRP B 115 CLA B 610 CLA B 611
SITE 3 AF1 14 CLA B 612 BCR B 616 SQD B 626 VAL L 10
SITE 4 AF1 14 LMG m 101 PHE t 8
SITE 1 AF2 12 HIS B 23 MET B 138 ILE B 141 HIS B 142
SITE 2 AF2 12 LEU B 145 CLA B 603 CLA B 609 CLA B 611
SITE 3 AF2 12 CLA B 615 BCR B 619 LEU H 14 ASN H 15
SITE 1 AF3 9 LEU B 24 ALA B 110 TRP B 113 HIS B 114
SITE 2 AF3 9 CLA B 605 CLA B 614 THR H 5 LEU H 7
SITE 3 AF3 9 SQD a 401
SITE 1 AF4 10 MET B 25 LEU B 29 TRP B 115 CLA B 606
SITE 2 AF4 10 CLA B 613 BCR B 617 BCR B 618 SQD B 626
SITE 3 AF4 10 LEU M 13 PHE t 19
SITE 1 AF5 12 TRP B 33 SER B 36 MET B 37 CLA B 606
SITE 2 AF5 12 BCR B 616 BCR B 618 LMT B 628 ILE t 4
SITE 3 AF5 12 PHE t 8 ALA t 11 PHE t 17 ILE t 21
SITE 1 AF6 9 LEU B 29 GLY B 32 TRP B 33 GLY B 105
SITE 2 AF6 9 CLA B 606 CLA B 612 BCR B 616 BCR B 617
SITE 3 AF6 9 DGD B 625
SITE 1 AF7 8 LEU B 109 CYS B 112 TYR B 117 CLA B 605
SITE 2 AF7 8 CLA B 614 SQD a 401 PHE t 18 PHE t 22
SITE 1 AF8 13 TYR B 193 PHE B 250 TYR B 258 TYR B 273
SITE 2 AF8 13 SER B 277 HIS D 87 LEU D 162 TYR H 49
SITE 3 AF8 13 ASN H 50 VAL H 60 SER H 61 TRP H 62
SITE 4 AF8 13 CLA H 101
SITE 1 AF9 10 THR B 327 GLY B 328 PRO B 329 LYS B 332
SITE 2 AF9 10 CLA B 606 ILE D 284 PHE L 35 ASN M 4
SITE 3 AF9 10 LEU M 6 LMT M 103
SITE 1 AG1 4 TRP B 91 PHE B 162 CLA B 605 DGD B 625
SITE 1 AG2 7 ARG B 224 LYS B 227 ASP D 16 ASP D 19
SITE 2 AG2 7 SQD D 403 ALA H 32 MET H 35
SITE 1 AG3 14 ASN A 234 LMG A 410 TRP B 5 TYR B 6
SITE 2 AG3 14 ARG B 7 PHE B 464 TRP B 468 CLA B 606
SITE 3 AG3 14 CLA B 610 CLA B 612 ARG D 139 TYR D 141
SITE 4 AG3 14 PHE D 269 PHE D 273
SITE 1 AG4 9 TRP B 75 ASP B 87 GLY B 89 PHE B 90
SITE 2 AG4 9 BCR B 618 LMT B 622 LMT B 627 ILE a 46
SITE 3 AG4 9 LMG i 101
SITE 1 AG5 13 ARG B 18 LEU B 29 SER B 104 PHE B 108
SITE 2 AG5 13 TRP B 115 CLA B 613 BCR B 616 ASN L 4
SITE 3 AG5 13 ARG l 14 TYR l 18 TYR m 26 PHE t 19
SITE 4 AG5 13 PHE t 23
SITE 1 AG6 8 GLY B 85 ASP B 87 DGD B 625 ALA a 100
SITE 2 AG6 8 BCR a 410 MET i 1 LMG i 101 LYS o 95
SITE 1 AG7 4 ALA B 43 LEU B 437 BCR B 617 VAL t 7
SITE 1 AG8 17 LEU C 95 LEU C 168 GLY C 171 ALA C 172
SITE 2 AG8 17 ILE C 224 VAL C 233 HIS C 237 ILE C 240
SITE 3 AG8 17 ALA C 278 MET C 282 PHE C 289 VAL C 296
SITE 4 AG8 17 TYR C 297 CLA C 502 CLA C 503 CLA C 506
SITE 5 AG8 17 BCR C 514
SITE 1 AG9 17 TRP C 63 HIS C 91 TRP C 97 LEU C 174
SITE 2 AG9 17 LYS C 178 PHE C 182 LEU C 279 MET C 282
SITE 3 AG9 17 ALA C 286 TYR C 297 HIS C 430 LEU C 433
SITE 4 AG9 17 PHE C 437 CLA C 501 CLA C 503 CLA C 508
SITE 5 AG9 17 CLA C 509
SITE 1 AH1 14 ILE C 60 VAL C 61 ALA C 64 THR C 68
SITE 2 AH1 14 LEU C 88 HIS C 91 ILE C 92 VAL C 114
SITE 3 AH1 14 HIS C 118 CLA C 501 CLA C 502 CLA C 509
SITE 4 AH1 14 CLA C 511 LMG C 518
SITE 1 AH2 16 PHE A 33 MET A 127 TRP A 131 PHE C 264
SITE 2 AH2 16 ILE C 265 TYR C 274 GLY C 277 ALA C 278
SITE 3 AH2 16 MET C 281 HIS C 441 LEU C 442 ALA C 445
SITE 4 AH2 16 ARG C 449 CLA C 506 BCR C 514 PHE I 23
SITE 1 AH3 13 LEU C 165 LEU C 213 ILE C 243 GLY C 247
SITE 2 AH3 13 TRP C 250 HIS C 251 THR C 255 PRO C 256
SITE 3 AH3 13 PHE C 257 TRP C 259 ALA C 260 PHE C 264
SITE 4 AH3 13 CLA C 506
SITE 1 AH4 15 MET C 157 LEU C 161 HIS C 164 ILE C 240
SITE 2 AH4 15 PHE C 264 TRP C 266 TYR C 271 TYR C 274
SITE 3 AH4 15 SER C 275 LEU C 279 CLA C 501 CLA C 504
SITE 4 AH4 15 CLA C 505 CLA C 508 BCR C 514
SITE 1 AH5 18 LHG A 409 TRP C 36 ALA C 37 ASN C 39
SITE 2 AH5 18 ALA C 40 GLU C 269 LEU C 276 PHE C 436
SITE 3 AH5 18 PHE C 437 GLY C 440 TRP C 443 HIS C 444
SITE 4 AH5 18 ARG C 447 CLA C 508 CLA C 509 DGD C 516
SITE 5 AH5 18 CLA C 520 VAL K 30
SITE 1 AH6 18 ASN C 39 LEU C 42 LEU C 49 ALA C 52
SITE 2 AH6 18 HIS C 53 HIS C 56 TYR C 149 GLY C 268
SITE 3 AH6 18 TYR C 271 LEU C 272 SER C 275 LEU C 279
SITE 4 AH6 18 CLA C 502 CLA C 506 CLA C 507 CLA C 509
SITE 5 AH6 18 CLA C 510 CLA C 511
SITE 1 AH7 15 ASN C 39 HIS C 56 LEU C 59 LEU C 279
SITE 2 AH7 15 PHE C 436 PHE C 437 CLA C 502 CLA C 503
SITE 3 AH7 15 CLA C 507 CLA C 508 CLA C 510 CLA C 520
SITE 4 AH7 15 PRO K 29 VAL K 30 LEU K 33
SITE 1 AH8 21 GLN C 28 TRP C 35 GLY C 38 ASN C 39
SITE 2 AH8 21 ARG C 41 LEU C 42 LYS C 48 ALA C 52
SITE 3 AH8 21 PHE C 127 ILE C 134 CLA C 508 CLA C 509
SITE 4 AH8 21 BCR C 513 PHE K 32 TRP K 39 GLN K 40
SITE 5 AH8 21 MET Z 19 VAL Z 20 PRO Z 24 ILE y 35
SITE 6 AH8 21 LEU y 46
SITE 1 AH9 12 HIS C 53 ALA C 57 PHE C 147 PHE C 163
SITE 2 AH9 12 HIS C 164 VAL C 167 ILE C 170 LEU C 174
SITE 3 AH9 12 CLA C 503 CLA C 508 CLA C 512 BCR C 521
SITE 1 AI1 9 LEU C 50 VAL C 124 GLY C 128 TYR C 131
SITE 2 AI1 9 HIS C 132 PRO C 137 PHE C 147 CLA C 511
SITE 3 AI1 9 BCR C 521
SITE 1 AI2 11 ALA C 55 LEU C 59 VAL C 116 LEU C 119
SITE 2 AI2 11 SER C 122 ALA C 123 CLA C 510 BCR C 521
SITE 3 AI2 11 PHE K 32 VAL Z 13 BCR y 101
SITE 1 AI3 11 ILE C 209 TYR C 212 LEU C 213 VAL C 227
SITE 2 AI3 11 ASP C 232 VAL C 233 ILE C 240 PHE C 264
SITE 3 AI3 11 CLA C 501 CLA C 504 CLA C 506
SITE 1 AI4 16 LEU A 91 PHE A 155 ILE A 163 PRO C 217
SITE 2 AI4 16 PHE C 218 GLY C 219 GLY C 220 VAL C 225
SITE 3 AI4 16 SER C 226 PHE C 284 CYS C 288 PHE C 292
SITE 4 AI4 16 ASN C 294 PRO C 307 PHE C 361 ARG C 362
SITE 1 AI5 20 PHE A 197 SQD A 413 TYR C 82 GLU C 83
SITE 2 AI5 20 GLN C 84 GLY C 85 LEU C 404 SER C 406
SITE 3 AI5 20 ASN C 418 PHE C 419 VAL C 420 TRP C 425
SITE 4 AI5 20 SER C 429 CLA C 507 DGD C 517 LHG C 519
SITE 5 AI5 20 CLA C 520 LMG C 522 TYR J 33 BCR J 102
SITE 1 AI6 20 LEU A 200 TRP A 278 PHE A 300 ASN A 301
SITE 2 AI6 20 SER A 305 SQD A 413 ASN C 405 VAL C 407
SITE 3 AI6 20 ASN C 415 SER C 416 ASN C 418 DGD C 516
SITE 4 AI6 20 CLA C 520 PHE J 29 ALA J 32 TYR J 33
SITE 5 AI6 20 GLY J 37 SER J 38 SER J 39 GLN V 60
SITE 1 AI7 7 TRP C 97 PHE C 109 VAL C 113 VAL C 117
SITE 2 AI7 7 HIS C 118 CLA C 503 PHE Z 59
SITE 1 AI8 8 TYR A 262 ASN A 266 SQD A 413 TRP C 35
SITE 2 AI8 8 DGD C 516 LMG E 101 BCR J 102 PHE K 45
SITE 1 AI9 17 PHE A 285 LHG A 409 TRP C 63 MET C 67
SITE 2 AI9 17 PHE C 70 GLN C 84 GLY C 85 ILE C 87
SITE 3 AI9 17 TRP C 425 SER C 429 CLA C 507 CLA C 509
SITE 4 AI9 17 DGD C 516 DGD C 517 LMG C 522 PRO K 26
SITE 5 AI9 17 VAL K 30
SITE 1 AJ1 11 PHE C 112 VAL C 116 SER C 121 VAL C 124
SITE 2 AJ1 11 CLA C 511 CLA C 512 BCR C 513 TYR K 15
SITE 3 AJ1 11 VAL Z 54 GLY Z 55 ASN Z 58
SITE 1 AJ2 7 HIS C 74 DGD C 516 CLA C 520 BCR J 102
SITE 2 AJ2 7 ASP K 23 VAL K 27 ILE y 25
SITE 1 AJ3 19 LEU A 41 ALA A 44 THR A 45 ILE A 115
SITE 2 AJ3 19 TYR A 126 GLN A 130 ALA A 146 TYR A 147
SITE 3 AJ3 19 VAL A 283 CLA A 402 CLA A 403 SQD A 414
SITE 4 AJ3 19 LEU D 205 ALA D 208 LEU D 209 ALA D 212
SITE 5 AJ3 19 ILE D 213 TRP D 253 PHE D 257
SITE 1 AJ4 20 PHE A 206 ALA A 209 LEU A 210 MET A 214
SITE 2 AJ4 20 LEU A 258 CLA A 404 ALA D 41 LEU D 45
SITE 3 AJ4 20 TRP D 48 GLY D 118 LEU D 122 PHE D 125
SITE 4 AJ4 20 GLN D 129 ASN D 142 PHE D 146 PHE D 153
SITE 5 AJ4 20 PHE D 173 PRO D 275 LEU D 279 CLA D 405
SITE 1 AJ5 10 LYS B 227 ALA B 228 ARG B 230 LEU B 474
SITE 2 AJ5 10 CLA B 607 LMT B 623 LYS D 23 TRP D 32
SITE 3 AJ5 10 ARG D 134 LEU D 135
SITE 1 AJ6 8 HIS A 215 GLU A 244 TYR A 246 HIS A 272
SITE 2 AJ6 8 FE2 A 401 TYR D 244 LYS D 264 HIS D 268
SITE 1 AJ7 22 PHE A 206 CLA A 402 CLA A 403 CLA A 404
SITE 2 AJ7 22 LEU D 122 VAL D 152 PHE D 153 VAL D 156
SITE 3 AJ7 22 LEU D 182 PHE D 185 GLN D 186 TRP D 191
SITE 4 AJ7 22 THR D 192 HIS D 197 GLY D 200 VAL D 201
SITE 5 AJ7 22 VAL D 204 LEU D 279 SER D 282 ALA D 283
SITE 6 AJ7 22 VAL D 286 PHO D 402
SITE 1 AJ8 14 LEU D 43 LEU D 89 LEU D 90 LEU D 91
SITE 2 AJ8 14 LEU D 92 TRP D 93 THR D 112 PHE D 113
SITE 3 AJ8 14 HIS D 117 PHE D 120 LMT D 410 GLY X 22
SITE 4 AJ8 14 LEU X 23 GLY X 26
SITE 1 AJ9 18 PHE A 52 ILE A 77 CLA A 403 LMG A 410
SITE 2 AJ9 18 MET D 199 LEU D 209 HIS D 214 THR D 217
SITE 3 AJ9 18 TRP D 253 ALA D 260 PHE D 261 LEU D 267
SITE 4 AJ9 18 PHE D 270 PHE D 273 VAL D 274 LMG D 408
SITE 5 AJ9 18 VAL L 26 PHE T 10
SITE 1 AK1 13 PHE D 257 ILE D 259 ALA D 260 PHE D 261
SITE 2 AK1 13 SER D 262 ASN D 263 TRP D 266 PL9 D 407
SITE 3 AK1 13 THR L 15 TYR L 18 LEU L 19 PHE T 17
SITE 4 AK1 13 ALA T 20
SITE 1 AK2 6 ASP D 100 PHE D 101 THR D 102 LMT D 410
SITE 2 AK2 6 ASP E 45 VAL E 46
SITE 1 AK3 8 LEU D 92 TRP D 93 GLY D 99 CLA D 406
SITE 2 AK3 8 DGD D 409 ILE X 21 SER X 25 GLY X 26
SITE 1 AK4 11 TYR D 42 GLY D 47 LEU D 49 THR D 50
SITE 2 AK4 11 PHE D 101 LMG D 412 PRO F 29 PHE F 33
SITE 3 AK4 11 VAL J 21 VAL J 25 PL9 J 101
SITE 1 AK5 13 TYR D 67 GLY D 70 CYS D 71 ASN D 72
SITE 2 AK5 13 PHE D 73 BCR D 411 ILE F 37 MET F 40
SITE 3 AK5 13 GLN F 41 PHE J 28 GLY J 31 ALA J 32
SITE 4 AK5 13 GLY J 37
SITE 1 AK6 7 TYR A 262 LHG C 519 PHE D 27 PRO E 9
SITE 2 AK6 7 PHE E 10 SER E 11 PL9 J 101
SITE 1 AK7 15 ARG E 8 PHE E 10 ILE E 13 ARG E 18
SITE 2 AK7 15 TYR E 19 HIS E 23 THR E 26 LEU E 30
SITE 3 AK7 15 ILE F 15 ARG F 19 TRP F 20 VAL F 23
SITE 4 AK7 15 HIS F 24 ALA F 27 ILE F 31
SITE 1 AK8 9 TRP D 21 ARG D 24 ARG D 26 GLU E 7
SITE 2 AK8 9 PHE F 16 THR F 17 VAL F 18 THR X 33
SITE 3 AK8 9 ASP X 44
SITE 1 AK9 16 GLU B 184 GLY B 189 GLY B 197 HIS B 201
SITE 2 AK9 16 ALA B 204 ALA B 205 VAL B 208 PHE B 247
SITE 3 AK9 16 CLA B 601 CLA B 602 DGD B 620 VAL D 154
SITE 4 AK9 16 PHE H 38 PHE H 41 ILE H 45 TYR H 49
SITE 1 AL1 10 CLA B 601 CLA B 608 CLA B 609 PHE H 34
SITE 2 AL1 10 MET H 35 LEU H 37 PHE H 38 PHE H 41
SITE 3 AL1 10 THR X 11 LEU X 16
SITE 1 AL2 6 MET I 1 THR I 3 LEU I 4 LMT I 102
SITE 2 AL2 6 DGD b 601 LMT b 603
SITE 1 AL3 4 THR I 3 ILE I 6 ILE I 10 LMG I 101
SITE 1 AL4 4 PL9 A 406 BCR D 411 LMG E 101 VAL J 16
SITE 1 AL5 6 SQD A 413 DGD C 516 LHG C 519 LMG C 522
SITE 2 AL5 6 PHE J 29 TYR J 33
SITE 1 AL6 2 ASP K 19 ASP K 23
SITE 1 AL7 9 GLU M 30 SER M 31 SQD b 602 CLA b 617
SITE 2 AL7 9 PRO l 9 VAL l 10 ILE m 24 GLN m 28
SITE 3 AL7 9 GLN m 32
SITE 1 AL8 7 MET M 1 GLU M 2 MET T 1 ILE T 4
SITE 2 AL8 7 TYR b 40 LMG b 625 GLN m 5
SITE 1 AL9 6 TYR B 40 LMG B 621 GLN M 5 MET m 1
SITE 2 AL9 6 GLU m 2 MET t 1
SITE 1 AM1 2 GLU O 140 HIS O 257
SITE 1 AM2 14 ALA V 62 CYS V 63 CYS V 66 HIS V 67
SITE 2 AM2 14 THR V 74 LEU V 78 ASP V 79 THR V 84
SITE 3 AM2 14 LEU V 85 TYR V 101 MET V 102 TYR V 108
SITE 4 AM2 14 HIS V 118 PRO V 119
SITE 1 AM3 14 BCR C 513 ALA J 14 THR J 15 MET J 19
SITE 2 AM3 14 ILE K 28 LEU K 31 ALA K 34 PHE K 37
SITE 3 AM3 14 VAL K 38 VAL Z 13 PHE Z 17 ILE y 28
SITE 4 AM3 14 GLY y 29 GLY y 32
SITE 1 AM4 13 TRP B 113 TYR B 117 CLA B 605 CLA B 615
SITE 2 AM4 13 BCR B 619 TRP a 20 ASN a 26 ARG a 27
SITE 3 AM4 13 LEU a 28 VAL a 30 THR a 45 BCR a 410
SITE 4 AM4 13 PHO d 401
SITE 1 AM5 8 ALA B 43 TRP B 75 SER B 76 LEU B 98
SITE 2 AM5 8 LEU a 72 ASP a 103 ARG d 304 GLY o 138
SITE 1 AM6 5 HIS a 215 HIS a 272 HIS d 214 HIS d 268
SITE 2 AM6 5 BCT d 403
SITE 1 AM7 24 PHE a 119 TYR a 147 PRO a 150 SER a 153
SITE 2 AM7 24 VAL a 157 MET a 183 PHE a 186 GLN a 187
SITE 3 AM7 24 LEU a 193 HIS a 198 GLY a 201 VAL a 205
SITE 4 AM7 24 PHE a 206 VAL a 283 THR a 286 ILE a 290
SITE 5 AM7 24 CLA a 405 CLA a 406 LEU d 182 LEU d 205
SITE 6 AM7 24 PHO d 401 CLA d 404 LMG d 407 PHE t 17
SITE 1 AM8 14 THR a 45 VAL a 157 PHE a 158 MET a 172
SITE 2 AM8 14 ILE a 176 THR a 179 PHE a 180 MET a 183
SITE 3 AM8 14 CLA a 404 MET d 198 VAL d 201 PHO d 401
SITE 4 AM8 14 CLA d 404 PL9 d 406
SITE 1 AM9 13 GLN a 199 VAL a 202 ALA a 203 TRP a 278
SITE 2 AM9 13 CLA a 404 PHO a 407 PHE d 157 VAL d 175
SITE 3 AM9 13 ILE d 178 PHE d 179 PHE d 181 LEU d 182
SITE 4 AM9 13 CLA d 404
SITE 1 AN1 21 PHE a 206 ALA a 209 LEU a 210 MET a 214
SITE 2 AN1 21 LEU a 258 CLA a 406 ALA d 41 TRP d 48
SITE 3 AN1 21 GLY d 118 LEU d 122 PHE d 125 GLN d 129
SITE 4 AN1 21 ASN d 142 ALA d 145 PHE d 146 ALA d 148
SITE 5 AN1 21 PHE d 153 PHE d 173 PRO d 275 LEU d 279
SITE 6 AN1 21 CLA d 404
SITE 1 AN2 14 ILE a 36 PRO a 39 THR a 40 PHE a 93
SITE 2 AN2 14 PRO a 95 ILE a 96 TRP a 97 LEU a 114
SITE 3 AN2 14 HIS a 118 LEU a 121 BCR a 410 DGD a 411
SITE 4 AN2 14 TYR i 9 PHE i 15
SITE 1 AN3 13 HIS a 215 LEU a 218 HIS a 252 PHE a 255
SITE 2 AN3 13 SER a 264 PHE a 265 LEU a 271 PHE a 274
SITE 3 AN3 13 PHE d 38 ALA d 41 TYR d 42 THR f 25
SITE 4 AN3 13 PL9 j 101
SITE 1 AN4 8 LMT B 627 LEU a 42 ALA a 43 TRP a 105
SITE 2 AN4 8 LEU a 106 SQD a 401 CLA a 408 PHE i 15
SITE 1 AN5 13 PHE a 93 TRP a 97 GLU a 98 CLA a 408
SITE 2 AN5 13 LEU c 214 LYS c 215 SER c 216 PRO c 217
SITE 3 AN5 13 TRP c 223 PHE c 284 LYS i 5 TYR i 9
SITE 4 AN5 13 GLY o 38
SITE 1 AN6 15 ARG a 140 TRP a 142 PHE a 273 SQD a 415
SITE 2 AN6 15 TRP c 36 PHE c 436 TRP c 443 ARG c 447
SITE 3 AN6 15 CLA c 507 CLA c 520 ASN d 220 ALA d 229
SITE 4 AN6 15 SER d 230 THR d 231 PHE d 232
SITE 1 AN7 13 SER a 232 ASN a 234 TRP b 5 TYR b 6
SITE 2 AN7 13 LMG b 628 TRP d 266 PHE d 269 PHE d 273
SITE 3 AN7 13 PL9 d 406 GLU l 11 ASN l 13 SER l 16
SITE 4 AN7 13 VAL l 26
SITE 1 AN8 9 ASP a 170 GLU a 189 HIS a 332 GLU a 333
SITE 2 AN8 9 HIS a 337 ASP a 342 ALA a 344 GLU c 354
SITE 3 AN8 9 ARG c 357
SITE 1 AN9 14 ASN a 267 SER a 270 PHE a 273 PHE a 274
SITE 2 AN9 14 TRP a 278 LHG a 412 TRP c 36 DGD c 516
SITE 3 AN9 14 DGD c 517 LHG c 519 PHE d 232 ARG d 233
SITE 4 AN9 14 BCR j 102 PHE k 37
SITE 1 AO1 3 ASN a 181 GLU a 333 LYS d 317
SITE 1 AO2 8 ILE A 46 LMG I 101 TRP b 75 ASP b 87
SITE 2 AO2 8 GLY b 89 PHE b 90 LMT b 603 LMT b 626
SITE 1 AO3 13 ARG L 14 TYR L 18 TYR M 26 LMG M 101
SITE 2 AO3 13 PHE T 19 PHE T 23 ARG b 18 LEU b 29
SITE 3 AO3 13 SER b 104 TRP b 115 CLA b 617 BCR b 620
SITE 4 AO3 13 ASN l 4
SITE 1 AO4 7 BCR A 407 MET I 1 LMG I 101 LYS O 95
SITE 2 AO4 7 GLY b 85 ASP b 87 DGD b 601
SITE 1 AO5 4 VAL T 7 ALA b 43 LEU b 437 BCR b 621
SITE 1 AO6 8 TRP b 185 PRO b 187 PHE b 190 ILE b 207
SITE 2 AO6 8 PHE h 41 ILE h 44 CLA h 101 BCR x 101
SITE 1 AO7 19 ARG b 68 LEU b 69 ALA b 146 LEU b 149
SITE 2 AO7 19 CYS b 150 PHE b 153 VAL b 198 HIS b 201
SITE 3 AO7 19 HIS b 202 PHE b 247 ALA b 248 VAL b 252
SITE 4 AO7 19 THR b 262 CLA b 607 CLA b 608 CLA b 609
SITE 5 AO7 19 CLA b 612 PHE h 38 CLA h 101
SITE 1 AO8 20 TRP b 33 PHE b 61 PHE b 65 ARG b 68
SITE 2 AO8 20 VAL b 245 ALA b 248 ALA b 249 VAL b 252
SITE 3 AO8 20 PHE b 451 HIS b 455 PHE b 458 ALA b 459
SITE 4 AO8 20 PHE b 462 CLA b 606 CLA b 608 CLA b 610
SITE 5 AO8 20 CLA b 614 CLA b 615 CLA b 616 CLA b 618
SITE 1 AO9 20 THR b 27 VAL b 30 ALA b 31 TRP b 33
SITE 2 AO9 20 ALA b 34 VAL b 62 PHE b 65 MET b 66
SITE 3 AO9 20 ARG b 68 LEU b 69 VAL b 96 HIS b 100
SITE 4 AO9 20 LEU b 103 ALA b 205 CLA b 606 CLA b 607
SITE 5 AO9 20 CLA b 609 CLA b 612 CLA b 613 CLA b 615
SITE 1 AP1 16 SQD A 414 LEU b 69 TRP b 91 ALA b 99
SITE 2 AP1 16 LEU b 103 LEU b 106 GLY b 152 PHE b 153
SITE 3 AP1 16 PHE b 156 HIS b 157 PHE b 162 PRO b 164
SITE 4 AP1 16 CLA b 606 CLA b 608 BCR b 623 LMT b 626
SITE 1 AP2 18 TRP b 33 TYR b 40 GLN b 58 GLY b 59
SITE 2 AP2 18 PHE b 61 THR b 327 GLY b 328 PRO b 329
SITE 3 AP2 18 TRP b 450 ALA b 454 CLA b 607 BCR b 620
SITE 4 AP2 18 BCR b 621 BCR b 622 LMG b 625 LMG b 628
SITE 5 AP2 18 MET d 281 LEU l 27
SITE 1 AP3 15 THR b 236 SER b 239 ALA b 243 PHE b 246
SITE 2 AP3 15 PHE b 247 HIS b 466 LEU b 474 CLA b 612
SITE 3 AP3 15 CLA b 613 PHE d 120 ILE d 123 MET d 126
SITE 4 AP3 15 LEU d 127 PHE d 130 SQD d 402
SITE 1 AP4 17 PHE b 139 ALA b 212 PHE b 215 HIS b 216
SITE 2 AP4 17 PRO b 221 PRO b 222 LEU b 229 CLA b 606
SITE 3 AP4 17 CLA b 608 CLA b 611 CLA b 613 THR h 27
SITE 4 AP4 17 THR h 28 MET h 31 PHE h 34 MET h 35
SITE 5 AP4 17 BCR x 101
SITE 1 AP5 13 LEU b 135 PHE b 139 HIS b 142 LEU b 143
SITE 2 AP5 13 THR b 236 VAL b 237 SER b 240 CLA b 608
SITE 3 AP5 13 CLA b 611 CLA b 612 CLA b 615 CLA b 618
SITE 4 AP5 13 BCR x 101
SITE 1 AP6 18 TRP b 5 TYR b 6 ARG b 7 VAL b 8
SITE 2 AP6 18 HIS b 9 THR b 10 ILE b 242 LEU b 461
SITE 3 AP6 18 PHE b 462 GLY b 465 TRP b 468 HIS b 469
SITE 4 AP6 18 ARG b 472 CLA b 607 CLA b 615 CLA b 616
SITE 5 AP6 18 CLA b 617 LMG b 628
SITE 1 AP7 17 HIS b 9 LEU b 19 HIS b 23 HIS b 26
SITE 2 AP7 17 THR b 27 ILE b 234 VAL b 237 LEU b 238
SITE 3 AP7 17 SER b 241 VAL b 245 CLA b 607 CLA b 608
SITE 4 AP7 17 CLA b 613 CLA b 614 CLA b 616 CLA b 617
SITE 5 AP7 17 CLA b 618
SITE 1 AP8 8 HIS b 9 HIS b 26 PHE b 462 CLA b 607
SITE 2 AP8 8 CLA b 614 CLA b 615 CLA b 617 LMG b 628
SITE 1 AP9 12 LMG M 101 PHE T 8 VAL b 8 HIS b 9
SITE 2 AP9 12 VAL b 11 TRP b 115 SQD b 602 CLA b 614
SITE 3 AP9 12 CLA b 615 CLA b 616 BCR b 620 VAL l 10
SITE 1 AQ1 11 HIS b 23 MET b 138 ILE b 141 HIS b 142
SITE 2 AQ1 11 LEU b 145 CLA b 607 CLA b 613 CLA b 615
SITE 3 AQ1 11 CLA b 619 BCR b 623 LEU h 14
SITE 1 AQ2 8 SQD A 414 LEU b 24 ALA b 110 TRP b 113
SITE 2 AQ2 8 HIS b 114 CLA b 618 THR h 5 LEU h 7
SITE 1 AQ3 11 PHE T 19 MET b 25 LEU b 29 TRP b 115
SITE 2 AQ3 11 SQD b 602 CLA b 610 CLA b 617 BCR b 621
SITE 3 AQ3 11 BCR b 622 ALA m 10 LEU m 13
SITE 1 AQ4 14 ILE T 4 PHE T 8 ALA T 11 PHE T 17
SITE 2 AQ4 14 PHE T 18 ILE T 21 PHE T 22 TRP b 33
SITE 3 AQ4 14 SER b 36 MET b 37 LMT b 604 CLA b 610
SITE 4 AQ4 14 BCR b 620 BCR b 622
SITE 1 AQ5 6 GLY b 32 TRP b 33 GLY b 105 CLA b 610
SITE 2 AQ5 6 BCR b 620 BCR b 621
SITE 1 AQ6 9 SQD A 414 PHE T 22 LEU b 106 LEU b 109
SITE 2 AQ6 9 ALA b 110 CYS b 112 TYR b 117 CLA b 609
SITE 3 AQ6 9 CLA b 618
SITE 1 AQ7 13 TYR b 193 PHE b 250 TYR b 258 TYR b 273
SITE 2 AQ7 13 SER b 277 HIS d 87 LEU d 162 TYR h 49
SITE 3 AQ7 13 ASN h 50 VAL h 60 SER h 61 TRP h 62
SITE 4 AQ7 13 CLA h 101
SITE 1 AQ8 11 LMT M 102 THR b 327 GLY b 328 PRO b 329
SITE 2 AQ8 11 LYS b 332 PHE b 453 CLA b 610 ILE d 284
SITE 3 AQ8 11 PHE l 35 ASN m 4 LEU m 6
SITE 1 AQ9 4 TRP b 91 PHE b 162 DGD b 601 CLA b 609
SITE 1 AR1 7 ARG b 224 LYS b 227 ASP d 16 ASP d 19
SITE 2 AR1 7 SQD d 402 ALA h 32 MET h 35
SITE 1 AR2 13 ASN a 234 LMG a 413 TRP b 5 TYR b 6
SITE 2 AR2 13 ARG b 7 PHE b 464 TRP b 468 CLA b 610
SITE 3 AR2 13 CLA b 614 CLA b 616 ARG d 139 TYR d 141
SITE 4 AR2 13 PHE d 269
SITE 1 AR3 16 LEU c 95 LEU c 168 GLY c 171 ALA c 172
SITE 2 AR3 16 ILE c 224 VAL c 233 HIS c 237 ILE c 240
SITE 3 AR3 16 MET c 282 PHE c 289 VAL c 296 TYR c 297
SITE 4 AR3 16 CLA c 502 CLA c 503 CLA c 506 BCR c 514
SITE 1 AR4 15 TRP c 63 HIS c 91 TRP c 97 LYS c 178
SITE 2 AR4 15 PHE c 182 LEU c 279 MET c 282 ALA c 286
SITE 3 AR4 15 TYR c 297 HIS c 430 LEU c 433 PHE c 437
SITE 4 AR4 15 CLA c 501 CLA c 503 CLA c 508
SITE 1 AR5 14 ILE c 60 VAL c 61 ALA c 64 THR c 68
SITE 2 AR5 14 LEU c 88 HIS c 91 ILE c 92 VAL c 114
SITE 3 AR5 14 HIS c 118 CLA c 501 CLA c 502 CLA c 509
SITE 4 AR5 14 CLA c 511 LMG c 518
SITE 1 AR6 17 PHE a 33 MET a 127 TRP a 131 PHE c 264
SITE 2 AR6 17 ILE c 265 TYR c 274 GLY c 277 ALA c 278
SITE 3 AR6 17 MET c 281 HIS c 441 LEU c 442 ALA c 445
SITE 4 AR6 17 ARG c 449 CLA c 506 BCR c 514 VAL i 12
SITE 5 AR6 17 PHE i 23
SITE 1 AR7 13 LEU c 165 LEU c 213 ILE c 243 GLY c 247
SITE 2 AR7 13 TRP c 250 HIS c 251 THR c 255 PRO c 256
SITE 3 AR7 13 PHE c 257 TRP c 259 ALA c 260 PHE c 264
SITE 4 AR7 13 CLA c 506
SITE 1 AR8 13 MET c 157 LEU c 161 HIS c 164 PHE c 264
SITE 2 AR8 13 TRP c 266 TYR c 271 TYR c 274 SER c 275
SITE 3 AR8 13 LEU c 279 CLA c 501 CLA c 504 CLA c 505
SITE 4 AR8 13 CLA c 508
SITE 1 AR9 16 LHG a 412 TRP c 36 ALA c 37 ASN c 39
SITE 2 AR9 16 ALA c 40 GLU c 269 LEU c 276 PHE c 436
SITE 3 AR9 16 PHE c 437 GLY c 440 TRP c 443 HIS c 444
SITE 4 AR9 16 ARG c 447 CLA c 508 CLA c 509 DGD c 516
SITE 1 AS1 19 ASN c 39 LEU c 42 LEU c 49 ALA c 52
SITE 2 AS1 19 HIS c 53 HIS c 56 TYR c 149 TRP c 151
SITE 3 AS1 19 GLY c 268 TYR c 271 LEU c 272 SER c 275
SITE 4 AS1 19 LEU c 279 CLA c 502 CLA c 506 CLA c 507
SITE 5 AS1 19 CLA c 509 CLA c 510 CLA c 511
SITE 1 AS2 14 ASN c 39 HIS c 56 LEU c 59 LEU c 279
SITE 2 AS2 14 PHE c 436 PHE c 437 CLA c 503 CLA c 507
SITE 3 AS2 14 CLA c 508 CLA c 510 CLA c 520 PRO k 29
SITE 4 AS2 14 VAL k 30 LEU k 33
SITE 1 AS3 21 GLN c 28 TRP c 35 GLY c 38 ASN c 39
SITE 2 AS3 21 ARG c 41 LEU c 42 LYS c 48 ALA c 52
SITE 3 AS3 21 PHE c 127 ILE c 134 CLA c 508 CLA c 509
SITE 4 AS3 21 BCR c 513 ILE g 35 LEU g 46 PHE k 32
SITE 5 AS3 21 TRP k 39 GLN k 40 MET z 19 VAL z 20
SITE 6 AS3 21 PRO z 24
SITE 1 AS4 12 HIS c 53 ALA c 57 PHE c 147 PHE c 163
SITE 2 AS4 12 HIS c 164 VAL c 167 ILE c 170 LEU c 174
SITE 3 AS4 12 CLA c 503 CLA c 508 CLA c 512 BCR c 521
SITE 1 AS5 9 LEU c 50 VAL c 124 GLY c 128 TYR c 131
SITE 2 AS5 9 HIS c 132 PRO c 137 PHE c 147 CLA c 511
SITE 3 AS5 9 BCR c 521
SITE 1 AS6 10 ALA c 55 VAL c 116 LEU c 119 SER c 122
SITE 2 AS6 10 ALA c 123 CLA c 510 BCR c 521 BCR g 101
SITE 3 AS6 10 PHE k 32 VAL z 13
SITE 1 AS7 11 ILE c 209 TYR c 212 LEU c 213 VAL c 227
SITE 2 AS7 11 ASP c 232 VAL c 233 GLY c 236 ILE c 240
SITE 3 AS7 11 PHE c 264 CLA c 501 CLA c 504
SITE 1 AS8 16 LEU a 91 PHE a 155 ILE a 163 PRO c 217
SITE 2 AS8 16 PHE c 218 GLY c 219 GLY c 220 VAL c 225
SITE 3 AS8 16 SER c 226 PHE c 284 CYS c 288 PHE c 292
SITE 4 AS8 16 ASN c 294 PRO c 307 PHE c 361 ARG c 362
SITE 1 AS9 19 PHE a 197 SQD a 415 TYR c 82 GLU c 83
SITE 2 AS9 19 GLN c 84 GLY c 85 SER c 406 ASN c 418
SITE 3 AS9 19 PHE c 419 VAL c 420 TRP c 425 SER c 429
SITE 4 AS9 19 CLA c 507 DGD c 517 LHG c 519 CLA c 520
SITE 5 AS9 19 LMG c 522 TYR j 33 BCR j 102
SITE 1 AT1 22 LEU a 200 TRP a 278 PHE a 300 ASN a 301
SITE 2 AT1 22 SER a 305 SQD a 415 ASN c 405 SER c 406
SITE 3 AT1 22 VAL c 407 ASN c 415 SER c 416 ASN c 418
SITE 4 AT1 22 DGD c 516 CLA c 520 LMG d 410 PHE j 29
SITE 5 AT1 22 ALA j 32 TYR j 33 GLY j 37 SER j 38
SITE 6 AT1 22 SER j 39 GLN v 60
SITE 1 AT2 7 TRP c 97 PHE c 109 VAL c 113 VAL c 117
SITE 2 AT2 7 HIS c 118 CLA c 503 PHE z 59
SITE 1 AT3 8 TYR a 262 ASN a 266 SQD a 415 TRP c 35
SITE 2 AT3 8 DGD c 516 LMG e 101 BCR j 102 PHE k 45
SITE 1 AT4 16 PHE a 285 LHG a 412 TRP c 63 MET c 67
SITE 2 AT4 16 PHE c 70 GLN c 84 GLY c 85 ILE c 87
SITE 3 AT4 16 TRP c 425 SER c 429 CLA c 509 DGD c 516
SITE 4 AT4 16 DGD c 517 LMG c 522 PRO k 26 VAL k 30
SITE 1 AT5 10 VAL c 116 SER c 121 VAL c 124 CLA c 511
SITE 2 AT5 10 CLA c 512 BCR c 513 TYR k 15 VAL z 54
SITE 3 AT5 10 GLY z 55 ASN z 58
SITE 1 AT6 8 PHE c 70 HIS c 74 DGD c 516 CLA c 520
SITE 2 AT6 8 ILE g 25 BCR j 102 ASP k 23 VAL k 27
SITE 1 AT7 19 ALA a 44 THR a 45 ILE a 115 TYR a 126
SITE 2 AT7 19 GLN a 130 TYR a 147 PRO a 150 LEU a 174
SITE 3 AT7 19 GLY a 175 VAL a 283 SQD a 401 CLA a 404
SITE 4 AT7 19 CLA a 405 LEU d 205 ALA d 208 LEU d 209
SITE 5 AT7 19 ILE d 213 TRP d 253 PHE d 257
SITE 1 AT8 10 LYS b 227 ALA b 228 ARG b 230 LEU b 474
SITE 2 AT8 10 CLA b 611 LMT b 627 LYS d 23 TRP d 32
SITE 3 AT8 10 ARG d 134 LEU d 135
SITE 1 AT9 8 HIS a 215 GLU a 244 TYR a 246 HIS a 272
SITE 2 AT9 8 FE2 a 403 TYR d 244 LYS d 264 HIS d 268
SITE 1 AU1 22 PHE a 206 CLA a 404 CLA a 405 CLA a 406
SITE 2 AU1 22 PHO a 407 TRP d 48 VAL d 152 PHE d 153
SITE 3 AU1 22 VAL d 156 LEU d 182 PHE d 185 GLN d 186
SITE 4 AU1 22 TRP d 191 THR d 192 HIS d 197 GLY d 200
SITE 5 AU1 22 VAL d 201 VAL d 204 LEU d 279 SER d 282
SITE 6 AU1 22 ALA d 283 VAL d 286
SITE 1 AU2 14 LEU d 43 LEU d 89 LEU d 90 LEU d 91
SITE 2 AU2 14 LEU d 92 TRP d 93 THR d 112 PHE d 113
SITE 3 AU2 14 HIS d 117 PHE d 120 LMT d 409 GLY x 22
SITE 4 AU2 14 LEU x 23 GLY x 26
SITE 1 AU3 14 CLA a 405 LMG a 413 MET d 199 HIS d 214
SITE 2 AU3 14 THR d 217 TRP d 253 ILE d 259 ALA d 260
SITE 3 AU3 14 PHE d 261 LEU d 267 PHE d 273 VAL d 274
SITE 4 AU3 14 VAL l 26 PHE t 10
SITE 1 AU4 13 CLA a 404 PHE d 257 ILE d 259 ALA d 260
SITE 2 AU4 13 PHE d 261 SER d 262 ASN d 263 TRP d 266
SITE 3 AU4 13 THR l 15 TYR l 18 LEU l 19 PHE t 17
SITE 4 AU4 13 ALA t 20
SITE 1 AU5 6 ASP d 100 PHE d 101 THR d 102 LMT d 409
SITE 2 AU5 6 ASP e 45 VAL e 46
SITE 1 AU6 8 LEU d 92 TRP d 93 GLY d 99 CLA d 405
SITE 2 AU6 8 DGD d 408 ILE x 21 SER x 25 GLY x 26
SITE 1 AU7 13 DGD c 517 TYR d 67 GLY d 70 ASN d 72
SITE 2 AU7 13 PHE d 73 ILE f 37 MET f 40 GLN f 41
SITE 3 AU7 13 BCR f 102 PHE j 28 GLY j 31 ALA j 32
SITE 4 AU7 13 GLY j 37
SITE 1 AU8 7 TYR a 262 LHG c 519 PHE d 27 PRO e 9
SITE 2 AU8 7 PHE e 10 SER e 11 PL9 j 101
SITE 1 AU9 14 ARG e 8 PHE e 10 ILE e 13 ARG e 18
SITE 2 AU9 14 TYR e 19 HIS e 23 THR e 26 LEU e 30
SITE 3 AU9 14 ILE f 15 ARG f 19 TRP f 20 HIS f 24
SITE 4 AU9 14 ALA f 27 ILE f 31
SITE 1 AV1 12 TYR d 42 GLY d 46 GLY d 47 LEU d 49
SITE 2 AV1 12 THR d 50 PHE d 101 LMG d 410 PRO f 29
SITE 3 AV1 12 PHE f 33 VAL j 21 VAL j 25 PL9 j 101
SITE 1 AV2 9 TRP d 21 ARG d 24 ARG d 26 GLU e 7
SITE 2 AV2 9 PHE f 16 THR f 17 VAL f 18 THR x 33
SITE 3 AV2 9 VAL x 36
SITE 1 AV3 15 GLU b 184 GLY b 189 GLY b 197 HIS b 201
SITE 2 AV3 15 ALA b 204 VAL b 208 PHE b 247 CLA b 605
SITE 3 AV3 15 CLA b 606 DGD b 624 VAL d 154 PHE h 38
SITE 4 AV3 15 PHE h 41 ILE h 45 TYR h 49
SITE 1 AV4 6 DGD B 625 LMT B 627 MET i 1 THR i 3
SITE 2 AV4 6 LEU i 4 LMT i 102
SITE 1 AV5 5 THR i 3 ILE i 6 THR i 7 ILE i 10
SITE 2 AV5 5 LMG i 101
SITE 1 AV6 3 PL9 a 409 LMG e 101 BCR f 102
SITE 1 AV7 8 SQD a 415 DGD c 516 LHG c 519 LMG c 522
SITE 2 AV7 8 BCR g 101 PHE j 29 TYR j 30 TYR j 33
SITE 1 AV8 2 ASP k 19 ASP k 23
SITE 1 AV9 7 CLA B 613 VAL L 10 GLN M 28 GLN M 32
SITE 2 AV9 7 VAL m 27 GLU m 30 SER m 31
SITE 1 AW1 2 GLU o 140 HIS o 257
SITE 1 AW2 14 ALA v 62 CYS v 63 CYS v 66 HIS v 67
SITE 2 AW2 14 THR v 74 LEU v 78 ASP v 79 THR v 84
SITE 3 AW2 14 LEU v 85 TYR v 101 MET v 102 TYR v 108
SITE 4 AW2 14 HIS v 118 PRO v 119
SITE 1 AW3 13 BCR c 513 ILE g 28 GLY g 29 GLY g 32
SITE 2 AW3 13 ALA j 14 THR j 15 BCR j 102 ILE k 28
SITE 3 AW3 13 LEU k 31 ALA k 34 PHE k 37 VAL k 38
SITE 4 AW3 13 VAL z 13
SITE 1 AW4 10 CLA b 605 CLA b 612 CLA b 613 PHE h 34
SITE 2 AW4 10 MET h 35 LEU h 37 PHE h 38 PHE h 41
SITE 3 AW4 10 THR x 11 LEU x 16
CRYST1 132.298 228.713 307.976 90.00 90.00 90.00 P 21 21 21 8
ORIGX1 1.000000 0.000000 0.000000 0.00000
ORIGX2 0.000000 1.000000 0.000000 0.00000
ORIGX3 0.000000 0.000000 1.000000 0.00000
SCALE1 0.007559 0.000000 0.000000 0.00000
SCALE2 0.000000 0.004372 0.000000 0.00000
SCALE3 0.000000 0.000000 0.003247 0.00000
ATOM 1 N SER A 10 -71.248 44.716 -24.428 1.00174.72 N
ATOM 2 CA SER A 10 -70.417 45.132 -25.552 1.00176.16 C
ATOM 3 C SER A 10 -70.880 46.475 -26.110 1.00176.97 C
ATOM 4 O SER A 10 -72.011 46.599 -26.588 1.00178.05 O
ATOM 5 CB SER A 10 -70.435 44.067 -26.653 1.00175.02 C
ATOM 6 OG SER A 10 -69.548 44.403 -27.706 1.00173.96 O
ATOM 7 N ALA A 11 -70.005 47.477 -26.048 1.00175.99 N
ATOM 8 CA ALA A 11 -70.329 48.803 -26.567 1.00175.17 C
ATOM 9 C ALA A 11 -70.565 48.760 -28.076 1.00174.98 C
ATOM 10 O ALA A 11 -71.329 49.570 -28.607 1.00174.91 O
ATOM 11 CB ALA A 11 -69.223 49.786 -26.231 1.00173.70 C
ATOM 12 N ASN A 12 -69.928 47.776 -28.719 1.00174.80 N
ATOM 13 CA ASN A 12 -70.023 47.445 -30.148 1.00175.18 C
ATOM 14 C ASN A 12 -68.761 46.693 -30.551 1.00175.05 C
ATOM 15 O ASN A 12 -67.670 47.265 -30.531 1.00175.48 O
ATOM 16 CB ASN A 12 -70.186 48.679 -31.045 1.00175.35 C
ATOM 17 CG ASN A 12 -70.302 48.319 -32.517 1.00174.24 C
ATOM 18 OD1 ASN A 12 -69.595 48.867 -33.365 1.00173.26 O
ATOM 19 ND2 ASN A 12 -71.194 47.384 -32.825 1.00173.89 N
ATOM 20 N LEU A 13 -68.919 45.418 -30.902 1.00174.70 N
ATOM 21 CA LEU A 13 -67.812 44.548 -31.313 1.00174.26 C
ATOM 22 C LEU A 13 -66.782 45.233 -32.214 1.00173.77 C
ATOM 23 O LEU A 13 -65.606 45.328 -31.862 1.00173.79 O
ATOM 24 CB LEU A 13 -68.355 43.303 -32.023 1.00174.32 C
ATOM 25 CG LEU A 13 -68.852 42.147 -31.146 1.00175.41 C
ATOM 26 CD1 LEU A 13 -70.137 42.501 -30.396 1.00174.91 C
ATOM 27 CD2 LEU A 13 -69.036 40.881 -31.974 1.00175.33 C
ATOM 28 N TRP A 14 -67.230 45.696 -33.377 1.00173.55 N
ATOM 29 CA TRP A 14 -66.358 46.393 -34.319 1.00173.63 C
ATOM 30 C TRP A 14 -65.718 47.639 -33.706 1.00173.49 C
ATOM 31 O TRP A 14 -64.538 47.907 -33.925 1.00173.43 O
ATOM 32 CB TRP A 14 -67.137 46.773 -35.580 1.00175.30 C
ATOM 33 CG TRP A 14 -66.378 47.668 -36.514 1.00175.85 C
ATOM 34 CD1 TRP A 14 -66.486 49.026 -36.621 1.00175.96 C
ATOM 35 CD2 TRP A 14 -65.389 47.269 -37.469 1.00175.34 C
ATOM 36 NE1 TRP A 14 -65.630 49.494 -37.589 1.00174.91 N
ATOM 37 CE2 TRP A 14 -64.943 48.433 -38.125 1.00174.47 C
ATOM 38 CE3 TRP A 14 -64.837 46.037 -37.837 1.00175.24 C
ATOM 39 CZ2 TRP A 14 -63.974 48.406 -39.122 1.00174.35 C
ATOM 40 CZ3 TRP A 14 -63.875 46.011 -38.829 1.00175.50 C
ATOM 41 CH2 TRP A 14 -63.454 47.187 -39.460 1.00175.04 C
ATOM 42 N GLU A 15 -66.501 48.394 -32.940 1.00173.55 N
ATOM 43 CA GLU A 15 -65.995 49.585 -32.261 1.00174.02 C
ATOM 44 C GLU A 15 -64.905 49.222 -31.256 1.00174.12 C
ATOM 45 O GLU A 15 -63.912 49.937 -31.120 1.00173.83 O
ATOM 46 CB GLU A 15 -67.135 50.326 -31.558 1.00174.57 C
ATOM 47 CG GLU A 15 -66.716 51.589 -30.827 1.00174.59 C
ATOM 48 CD GLU A 15 -67.717 52.007 -29.764 1.00174.44 C
ATOM 49 OE1 GLU A 15 -67.878 51.266 -28.772 1.00173.28 O
ATOM 50 OE2 GLU A 15 -68.346 53.074 -29.923 1.00175.10 O
ATOM 51 N ARG A 16 -65.094 48.104 -30.563 1.00174.61 N
ATOM 52 CA ARG A 16 -64.092 47.595 -29.631 1.00174.68 C
ATOM 53 C ARG A 16 -62.856 47.110 -30.381 1.00174.75 C
ATOM 54 O ARG A 16 -61.728 47.409 -29.989 1.00174.79 O
ATOM 55 CB ARG A 16 -64.667 46.460 -28.779 1.00174.82 C
ATOM 56 CG ARG A 16 -65.892 46.837 -27.963 1.00174.56 C
ATOM 57 CD ARG A 16 -66.384 45.646 -27.163 1.00174.55 C
ATOM 58 NE ARG A 16 -65.323 45.074 -26.340 1.00175.51 N
ATOM 59 CZ ARG A 16 -65.418 43.910 -25.706 1.00176.31 C
ATOM 60 NH1 ARG A 16 -66.529 43.191 -25.800 1.00176.53 N
ATOM 61 NH2 ARG A 16 -64.403 43.464 -24.978 1.00176.19 N
ATOM 62 N PHE A 17 -63.084 46.341 -31.442 1.00174.93 N
ATOM 63 CA PHE A 17 -62.015 45.874 -32.322 1.00174.98 C
ATOM 64 C PHE A 17 -61.105 47.013 -32.771 1.00174.25 C
ATOM 65 O PHE A 17 -59.884 46.935 -32.637 1.00173.85 O
ATOM 66 CB PHE A 17 -62.605 45.167 -33.546 1.00174.96 C
ATOM 67 CG PHE A 17 -61.576 44.516 -34.426 1.00175.59 C
ATOM 68 CD1 PHE A 17 -61.170 43.214 -34.187 1.00176.08 C
ATOM 69 CD2 PHE A 17 -61.020 45.201 -35.495 1.00175.03 C
ATOM 70 CE1 PHE A 17 -60.223 42.610 -34.990 1.00176.01 C
ATOM 71 CE2 PHE A 17 -60.073 44.602 -36.303 1.00175.76 C
ATOM 72 CZ PHE A 17 -59.674 43.304 -36.050 1.00176.22 C
ATOM 73 N CYS A 18 -61.712 48.067 -33.307 1.00174.12 N
ATOM 74 CA CYS A 18 -60.971 49.242 -33.748 1.00174.16 C
ATOM 75 C CYS A 18 -60.224 49.892 -32.589 1.00174.42 C
ATOM 76 O CYS A 18 -59.162 50.481 -32.778 1.00174.19 O
ATOM 77 CB CYS A 18 -61.915 50.255 -34.398 1.00173.77 C
ATOM 78 SG CYS A 18 -62.684 49.676 -35.923 1.00172.54 S
ATOM 79 N ASN A 19 -60.784 49.775 -31.390 1.00174.60 N
ATOM 80 CA ASN A 19 -60.164 50.345 -30.201 1.00174.85 C
ATOM 81 C ASN A 19 -58.979 49.516 -29.717 1.00174.91 C
ATOM 82 O ASN A 19 -58.028 50.056 -29.153 1.00175.13 O
ATOM 83 CB ASN A 19 -61.194 50.490 -29.080 1.00174.65 C
ATOM 84 CG ASN A 19 -62.052 51.730 -29.234 1.00174.49 C
ATOM 85 OD1 ASN A 19 -61.973 52.656 -28.428 1.00176.00 O
ATOM 86 ND2 ASN A 19 -62.875 51.756 -30.275 1.00173.56 N
ATOM 87 N TRP A 20 -59.036 48.206 -29.936 1.00175.05 N
ATOM 88 CA TRP A 20 -57.929 47.330 -29.561 1.00175.48 C
ATOM 89 C TRP A 20 -56.751 47.490 -30.510 1.00175.18 C
ATOM 90 O TRP A 20 -55.606 47.608 -30.075 1.00175.74 O
ATOM 91 CB TRP A 20 -58.359 45.865 -29.539 1.00175.74 C
ATOM 92 CG TRP A 20 -57.176 44.949 -29.486 1.00175.79 C
ATOM 93 CD1 TRP A 20 -56.363 44.725 -28.415 1.00174.70 C
ATOM 94 CD2 TRP A 20 -56.654 44.156 -30.561 1.00175.51 C
ATOM 95 NE1 TRP A 20 -55.371 43.836 -28.753 1.00174.69 N
ATOM 96 CE2 TRP A 20 -55.528 43.471 -30.064 1.00175.11 C
ATOM 97 CE3 TRP A 20 -57.032 43.956 -31.892 1.00174.42 C
ATOM 98 CZ2 TRP A 20 -54.777 42.599 -30.850 1.00174.15 C
ATOM 99 CZ3 TRP A 20 -56.286 43.090 -32.672 1.00173.10 C
ATOM 100 CH2 TRP A 20 -55.171 42.423 -32.148 1.00173.25 C
ATOM 101 N VAL A 21 -57.040 47.453 -31.806 1.00174.34 N
ATOM 102 CA VAL A 21 -56.033 47.693 -32.832 1.00174.13 C
ATOM 103 C VAL A 21 -55.297 49.005 -32.571 1.00174.06 C
ATOM 104 O VAL A 21 -54.083 49.020 -32.379 1.00174.36 O
ATOM 105 CB VAL A 21 -56.659 47.725 -34.236 1.00173.99 C
ATOM 106 CG1 VAL A 21 -55.626 48.150 -35.264 1.00174.07 C
ATOM 107 CG2 VAL A 21 -57.223 46.361 -34.589 1.00173.47 C
ATOM 108 N THR A 22 -56.045 50.102 -32.545 1.00173.47 N
ATOM 109 CA THR A 22 -55.465 51.428 -32.365 1.00173.68 C
ATOM 110 C THR A 22 -54.870 51.654 -30.972 1.00174.02 C
ATOM 111 O THR A 22 -54.182 52.650 -30.748 1.00174.09 O
ATOM 112 CB THR A 22 -56.513 52.526 -32.625 1.00174.06 C
ATOM 113 OG1 THR A 22 -55.854 53.751 -32.969 1.00174.89 O
ATOM 114 CG2 THR A 22 -57.371 52.744 -31.386 1.00174.02 C
ATOM 115 N SER A 23 -55.143 50.741 -30.042 1.00174.17 N
ATOM 116 CA SER A 23 -54.710 50.894 -28.651 1.00174.08 C
ATOM 117 C SER A 23 -53.205 51.110 -28.509 1.00173.57 C
ATOM 118 O SER A 23 -52.401 50.411 -29.127 1.00173.79 O
ATOM 119 CB SER A 23 -55.126 49.675 -27.824 1.00174.25 C
ATOM 120 OG SER A 23 -54.520 49.693 -26.543 1.00173.90 O
ATOM 121 N THR A 24 -52.839 52.087 -27.687 1.00172.97 N
ATOM 122 CA THR A 24 -51.441 52.404 -27.435 1.00172.58 C
ATOM 123 C THR A 24 -50.941 51.674 -26.195 1.00172.82 C
ATOM 124 O THR A 24 -49.853 51.955 -25.695 1.00171.80 O
ATOM 125 CB THR A 24 -51.233 53.912 -27.245 1.00172.23 C
ATOM 126 OG1 THR A 24 -51.773 54.311 -25.980 1.00172.57 O
ATOM 127 CG2 THR A 24 -51.927 54.684 -28.352 1.00172.86 C
ATOM 128 N ASP A 25 -51.745 50.737 -25.704 1.00173.67 N
ATOM 129 CA ASP A 25 -51.410 50.008 -24.487 1.00174.22 C
ATOM 130 C ASP A 25 -50.958 48.592 -24.817 1.00174.24 C
ATOM 131 O ASP A 25 -50.811 47.752 -23.930 1.00174.46 O
ATOM 132 CB ASP A 25 -52.607 49.970 -23.532 1.00174.18 C
ATOM 133 CG ASP A 25 -53.019 51.350 -23.055 1.00173.76 C
ATOM 134 OD1 ASP A 25 -52.136 52.220 -22.901 1.00174.20 O
ATOM 135 OD2 ASP A 25 -54.228 51.562 -22.825 1.00171.96 O
ATOM 136 N ASN A 26 -50.736 48.337 -26.101 1.00174.47 N
ATOM 137 CA ASN A 26 -50.230 47.048 -26.548 1.00175.32 C
ATOM 138 C ASN A 26 -48.707 47.020 -26.487 1.00174.77 C
ATOM 139 O ASN A 26 -48.051 48.011 -26.811 1.00174.82 O
ATOM 140 CB ASN A 26 -50.711 46.744 -27.970 1.00175.17 C
ATOM 141 CG ASN A 26 -52.197 46.436 -28.034 1.00174.26 C
ATOM 142 OD1 ASN A 26 -52.740 45.751 -27.167 1.00174.04 O
ATOM 143 ND2 ASN A 26 -52.860 46.936 -29.070 1.00173.69 N
ATOM 144 N ARG A 27 -48.151 45.893 -26.051 1.00173.85 N
ATOM 145 CA ARG A 27 -46.703 45.714 -26.001 1.00173.22 C
ATOM 146 C ARG A 27 -46.063 46.010 -27.356 1.00173.60 C
ATOM 147 O ARG A 27 -45.033 46.676 -27.438 1.00173.39 O
ATOM 148 CB ARG A 27 -46.355 44.295 -25.555 1.00173.13 C
ATOM 149 CG ARG A 27 -44.866 44.035 -25.471 1.00173.81 C
ATOM 150 CD ARG A 27 -44.211 44.954 -24.455 1.00174.40 C
ATOM 151 NE ARG A 27 -42.753 44.902 -24.521 1.00174.65 N
ATOM 152 CZ ARG A 27 -42.027 45.467 -25.479 1.00174.54 C
ATOM 153 NH1 ARG A 27 -42.619 46.143 -26.455 1.00174.11 N
ATOM 154 NH2 ARG A 27 -40.705 45.364 -25.458 1.00175.26 N
ATOM 155 N LEU A 28 -46.687 45.502 -28.413 1.00173.80 N
ATOM 156 CA LEU A 28 -46.304 45.842 -29.777 1.00172.90 C
ATOM 157 C LEU A 28 -47.493 46.499 -30.462 1.00172.79 C
ATOM 158 O LEU A 28 -48.571 45.914 -30.536 1.00172.81 O
ATOM 159 CB LEU A 28 -45.854 44.601 -30.548 1.00172.86 C
ATOM 160 CG LEU A 28 -44.627 43.869 -30.001 1.00172.97 C
ATOM 161 CD1 LEU A 28 -44.418 42.551 -30.731 1.00173.83 C
ATOM 162 CD2 LEU A 28 -43.387 44.745 -30.098 1.00172.64 C
ATOM 163 N TYR A 29 -47.304 47.717 -30.957 1.00172.55 N
ATOM 164 CA TYR A 29 -48.413 48.457 -31.540 1.00172.43 C
ATOM 165 C TYR A 29 -48.840 47.891 -32.889 1.00172.99 C
ATOM 166 O TYR A 29 -48.340 48.308 -33.932 1.00173.38 O
ATOM 167 CB TYR A 29 -48.059 49.936 -31.698 1.00172.94 C
ATOM 168 CG TYR A 29 -49.180 50.738 -32.317 1.00173.75 C
ATOM 169 CD1 TYR A 29 -50.416 50.831 -31.692 1.00173.99 C
ATOM 170 CD2 TYR A 29 -49.010 51.386 -33.534 1.00174.41 C
ATOM 171 CE1 TYR A 29 -51.449 51.555 -32.255 1.00174.63 C
ATOM 172 CE2 TYR A 29 -50.039 52.113 -34.106 1.00174.38 C
ATOM 173 CZ TYR A 29 -51.255 52.193 -33.461 1.00174.59 C
ATOM 174 OH TYR A 29 -52.282 52.914 -34.024 1.00174.86 O
ATOM 175 N VAL A 30 -49.764 46.938 -32.867 1.00172.87 N
ATOM 176 CA VAL A 30 -50.391 46.476 -34.096 1.00173.15 C
ATOM 177 C VAL A 30 -51.371 47.543 -34.583 1.00173.28 C
ATOM 178 O VAL A 30 -52.450 47.711 -34.024 1.00173.97 O
ATOM 179 CB VAL A 30 -51.113 45.116 -33.893 1.00173.69 C
ATOM 180 CG1 VAL A 30 -51.856 45.081 -32.557 1.00173.69 C
ATOM 181 CG2 VAL A 30 -52.046 44.807 -35.062 1.00173.55 C
ATOM 182 N GLY A 31 -50.986 48.281 -35.617 1.00172.53 N
ATOM 183 CA GLY A 31 -51.816 49.369 -36.094 1.00172.52 C
ATOM 184 C GLY A 31 -52.742 48.923 -37.204 1.00172.79 C
ATOM 185 O GLY A 31 -52.972 47.730 -37.383 1.00173.14 O
ATOM 186 N TRP A 32 -53.275 49.880 -37.955 1.00173.43 N
ATOM 187 CA TRP A 32 -54.123 49.557 -39.093 1.00174.30 C
ATOM 188 C TRP A 32 -53.250 49.085 -40.244 1.00174.21 C
ATOM 189 O TRP A 32 -53.626 48.192 -41.006 1.00173.98 O
ATOM 190 CB TRP A 32 -54.967 50.760 -39.510 1.00174.67 C
ATOM 191 CG TRP A 32 -56.213 50.944 -38.689 1.00175.04 C
ATOM 192 CD1 TRP A 32 -56.634 52.099 -38.092 1.00175.11 C
ATOM 193 CD2 TRP A 32 -57.205 49.953 -38.384 1.00175.19 C
ATOM 194 NE1 TRP A 32 -57.818 51.888 -37.432 1.00175.14 N
ATOM 195 CE2 TRP A 32 -58.192 50.580 -37.596 1.00175.69 C
ATOM 196 CE3 TRP A 32 -57.355 48.597 -38.698 1.00174.43 C
ATOM 197 CZ2 TRP A 32 -59.311 49.898 -37.117 1.00175.96 C
ATOM 198 CZ3 TRP A 32 -58.467 47.923 -38.221 1.00174.49 C
ATOM 199 CH2 TRP A 32 -59.429 48.573 -37.441 1.00175.23 C
ATOM 200 N PHE A 33 -52.080 49.699 -40.363 1.00173.93 N
ATOM 201 CA PHE A 33 -51.065 49.228 -41.288 1.00173.97 C
ATOM 202 C PHE A 33 -50.550 47.874 -40.813 1.00174.25 C
ATOM 203 O PHE A 33 -50.179 47.021 -41.618 1.00174.63 O
ATOM 204 CB PHE A 33 -49.922 50.235 -41.394 1.00173.72 C
ATOM 205 CG PHE A 33 -50.231 51.407 -42.277 1.00174.23 C
ATOM 206 CD1 PHE A 33 -50.240 51.265 -43.655 1.00174.60 C
ATOM 207 CD2 PHE A 33 -50.514 52.648 -41.734 1.00173.68 C
ATOM 208 CE1 PHE A 33 -50.523 52.339 -44.474 1.00174.03 C
ATOM 209 CE2 PHE A 33 -50.797 53.726 -42.548 1.00173.71 C
ATOM 210 CZ PHE A 33 -50.801 53.570 -43.921 1.00173.81 C
ATOM 211 N GLY A 34 -50.538 47.690 -39.495 1.00174.06 N
ATOM 212 CA GLY A 34 -50.127 46.437 -38.887 1.00174.20 C
ATOM 213 C GLY A 34 -51.000 45.264 -39.289 1.00174.10 C
ATOM 214 O GLY A 34 -50.528 44.130 -39.382 1.00174.05 O
ATOM 215 N VAL A 35 -52.281 45.541 -39.517 1.00174.00 N
ATOM 216 CA VAL A 35 -53.238 44.519 -39.930 1.00173.97 C
ATOM 217 C VAL A 35 -52.826 43.910 -41.271 1.00174.24 C
ATOM 218 O VAL A 35 -53.130 42.753 -41.564 1.00174.39 O
ATOM 219 CB VAL A 35 -54.668 45.101 -40.033 1.00174.30 C
ATOM 220 CG1 VAL A 35 -55.662 44.034 -40.461 1.00174.54 C
ATOM 221 CG2 VAL A 35 -55.089 45.694 -38.701 1.00174.01 C
ATOM 222 N ILE A 36 -52.110 44.689 -42.073 1.00174.04 N
ATOM 223 CA ILE A 36 -51.587 44.199 -43.341 1.00173.61 C
ATOM 224 C ILE A 36 -50.137 43.750 -43.170 1.00173.53 C
ATOM 225 O ILE A 36 -49.716 42.740 -43.735 1.00173.44 O
ATOM 226 CB ILE A 36 -51.672 45.275 -44.440 1.00173.08 C
ATOM 227 CG1 ILE A 36 -53.130 45.661 -44.695 1.00173.72 C
ATOM 228 CG2 ILE A 36 -51.003 44.795 -45.721 1.00173.24 C
ATOM 229 CD1 ILE A 36 -53.983 44.518 -45.200 1.00174.63 C
ATOM 230 N MET A 37 -49.390 44.501 -42.365 1.00173.90 N
ATOM 231 CA MET A 37 -47.970 44.240 -42.141 1.00174.10 C
ATOM 232 C MET A 37 -47.704 42.864 -41.539 1.00173.60 C
ATOM 233 O MET A 37 -47.029 42.033 -42.148 1.00173.82 O
ATOM 234 CB MET A 37 -47.373 45.308 -41.226 1.00174.60 C
ATOM 235 CG MET A 37 -45.891 45.117 -40.969 1.00174.26 C
ATOM 236 SD MET A 37 -45.215 46.261 -39.755 1.00174.56 S
ATOM 237 CE MET A 37 -45.685 45.439 -38.237 1.00174.54 C
ATOM 238 N ILE A 38 -48.223 42.643 -40.335 1.00173.04 N
ATOM 239 CA ILE A 38 -47.987 41.409 -39.588 1.00172.81 C
ATOM 240 C ILE A 38 -48.247 40.119 -40.390 1.00173.07 C
ATOM 241 O ILE A 38 -47.423 39.207 -40.350 1.00172.88 O
ATOM 242 CB ILE A 38 -48.834 41.382 -38.292 1.00173.18 C
ATOM 243 CG1 ILE A 38 -48.418 42.525 -37.365 1.00173.76 C
ATOM 244 CG2 ILE A 38 -48.703 40.040 -37.584 1.00173.56 C
ATOM 245 CD1 ILE A 38 -49.293 42.667 -36.142 1.00174.77 C
ATOM 246 N PRO A 39 -49.374 40.032 -41.127 1.00173.31 N
ATOM 247 CA PRO A 39 -49.557 38.786 -41.881 1.00173.13 C
ATOM 248 C PRO A 39 -48.556 38.638 -43.020 1.00173.67 C
ATOM 249 O PRO A 39 -47.974 37.564 -43.185 1.00174.12 O
ATOM 250 CB PRO A 39 -50.981 38.914 -42.432 1.00172.89 C
ATOM 251 CG PRO A 39 -51.648 39.882 -41.527 1.00173.87 C
ATOM 252 CD PRO A 39 -50.580 40.875 -41.201 1.00173.76 C
ATOM 253 N THR A 40 -48.367 39.703 -43.792 1.00174.26 N
ATOM 254 CA THR A 40 -47.434 39.689 -44.914 1.00174.58 C
ATOM 255 C THR A 40 -46.000 39.398 -44.478 1.00174.34 C
ATOM 256 O THR A 40 -45.292 38.637 -45.137 1.00173.85 O
ATOM 257 CB THR A 40 -47.457 41.024 -45.682 1.00174.36 C
ATOM 258 OG1 THR A 40 -47.246 42.108 -44.769 1.00174.48 O
ATOM 259 CG2 THR A 40 -48.791 41.210 -46.385 1.00174.41 C
ATOM 260 N LEU A 41 -45.569 40.003 -43.374 1.00174.21 N
ATOM 261 CA LEU A 41 -44.213 39.771 -42.880 1.00173.91 C
ATOM 262 C LEU A 41 -44.036 38.348 -42.364 1.00174.06 C
ATOM 263 O LEU A 41 -42.957 37.772 -42.489 1.00173.96 O
ATOM 264 CB LEU A 41 -43.848 40.766 -41.776 1.00172.56 C
ATOM 265 CG LEU A 41 -43.514 42.193 -42.213 1.00172.43 C
ATOM 266 CD1 LEU A 41 -43.075 43.024 -41.019 1.00171.97 C
ATOM 267 CD2 LEU A 41 -42.446 42.195 -43.291 1.00173.55 C
ATOM 268 N LEU A 42 -45.092 37.783 -41.787 1.00174.14 N
ATOM 269 CA LEU A 42 -45.028 36.417 -41.278 1.00174.34 C
ATOM 270 C LEU A 42 -44.964 35.403 -42.415 1.00174.55 C
ATOM 271 O LEU A 42 -44.302 34.375 -42.301 1.00174.22 O
ATOM 272 CB LEU A 42 -46.226 36.116 -40.372 1.00173.98 C
ATOM 273 CG LEU A 42 -46.165 36.643 -38.936 1.00174.26 C
ATOM 274 CD1 LEU A 42 -47.294 36.057 -38.101 1.00174.28 C
ATOM 275 CD2 LEU A 42 -44.821 36.328 -38.308 1.00174.18 C
ATOM 276 N ALA A 43 -45.645 35.701 -43.515 1.00174.57 N
ATOM 277 CA ALA A 43 -45.613 34.833 -44.685 1.00173.41 C
ATOM 278 C ALA A 43 -44.235 34.874 -45.334 1.00172.90 C
ATOM 279 O ALA A 43 -43.677 33.840 -45.703 1.00172.59 O
ATOM 280 CB ALA A 43 -46.688 35.237 -45.679 1.00173.49 C
ATOM 281 N ALA A 44 -43.695 36.081 -45.469 1.00172.86 N
ATOM 282 CA ALA A 44 -42.376 36.287 -46.054 1.00173.31 C
ATOM 283 C ALA A 44 -41.278 35.558 -45.281 1.00173.63 C
ATOM 284 O ALA A 44 -40.499 34.807 -45.866 1.00174.36 O
ATOM 285 CB ALA A 44 -42.065 37.775 -46.130 1.00173.80 C
ATOM 286 N THR A 45 -41.215 35.783 -43.971 1.00173.17 N
ATOM 287 CA THR A 45 -40.151 35.207 -43.152 1.00173.05 C
ATOM 288 C THR A 45 -40.223 33.677 -43.085 1.00173.15 C
ATOM 289 O THR A 45 -39.195 33.008 -43.182 1.00173.24 O
ATOM 290 CB THR A 45 -40.151 35.795 -41.714 1.00173.27 C
ATOM 291 OG1 THR A 45 -39.057 35.246 -40.969 1.00173.73 O
ATOM 292 CG2 THR A 45 -41.454 35.507 -40.981 1.00173.93 C
ATOM 293 N ILE A 46 -41.424 33.124 -42.926 1.00172.91 N
ATOM 294 CA ILE A 46 -41.589 31.676 -42.833 1.00172.92 C
ATOM 295 C ILE A 46 -41.172 30.991 -44.128 1.00173.22 C
ATOM 296 O ILE A 46 -40.465 29.984 -44.109 1.00173.36 O
ATOM 297 CB ILE A 46 -43.044 31.292 -42.495 1.00172.83 C
ATOM 298 CG1 ILE A 46 -43.373 31.685 -41.054 1.00174.25 C
ATOM 299 CG2 ILE A 46 -43.262 29.797 -42.669 1.00173.11 C
ATOM 300 CD1 ILE A 46 -44.770 31.301 -40.625 1.00174.56 C
ATOM 301 N CYS A 47 -41.597 31.556 -45.253 1.00173.70 N
ATOM 302 CA CYS A 47 -41.241 31.016 -46.559 1.00174.46 C
ATOM 303 C CYS A 47 -39.737 31.114 -46.781 1.00174.38 C
ATOM 304 O CYS A 47 -39.115 30.187 -47.297 1.00173.77 O
ATOM 305 CB CYS A 47 -41.992 31.749 -47.673 1.00174.52 C
ATOM 306 SG CYS A 47 -41.687 31.097 -49.333 1.00173.57 S
ATOM 307 N PHE A 48 -39.163 32.245 -46.379 1.00174.54 N
ATOM 308 CA PHE A 48 -37.723 32.474 -46.470 1.00173.80 C
ATOM 309 C PHE A 48 -36.932 31.421 -45.703 1.00173.19 C
ATOM 310 O PHE A 48 -36.118 30.704 -46.285 1.00173.39 O
ATOM 311 CB PHE A 48 -37.371 33.871 -45.951 1.00173.36 C
ATOM 312 CG PHE A 48 -35.895 34.156 -45.923 1.00172.54 C
ATOM 313 CD1 PHE A 48 -35.223 34.511 -47.079 1.00172.87 C
ATOM 314 CD2 PHE A 48 -35.181 34.074 -44.738 1.00173.48 C
ATOM 315 CE1 PHE A 48 -33.866 34.773 -47.057 1.00173.37 C
ATOM 316 CE2 PHE A 48 -33.824 34.334 -44.710 1.00173.75 C
ATOM 317 CZ PHE A 48 -33.167 34.684 -45.870 1.00172.95 C
ATOM 318 N VAL A 49 -37.172 31.348 -44.397 1.00172.87 N
ATOM 319 CA VAL A 49 -36.493 30.394 -43.523 1.00173.07 C
ATOM 320 C VAL A 49 -36.538 28.966 -44.069 1.00172.78 C
ATOM 321 O VAL A 49 -35.528 28.264 -44.067 1.00172.77 O
ATOM 322 CB VAL A 49 -37.099 30.416 -42.103 1.00174.21 C
ATOM 323 CG1 VAL A 49 -36.547 29.275 -41.261 1.00175.47 C
ATOM 324 CG2 VAL A 49 -36.820 31.750 -41.433 1.00174.94 C
ATOM 325 N ILE A 50 -37.701 28.551 -44.560 1.00172.54 N
ATOM 326 CA ILE A 50 -37.856 27.204 -45.101 1.00172.54 C
ATOM 327 C ILE A 50 -37.067 27.063 -46.396 1.00172.88 C
ATOM 328 O ILE A 50 -36.365 26.072 -46.602 1.00173.43 O
ATOM 329 CB ILE A 50 -39.336 26.858 -45.360 1.00172.57 C
ATOM 330 CG1 ILE A 50 -40.111 26.811 -44.043 1.00173.56 C
ATOM 331 CG2 ILE A 50 -39.456 25.520 -46.066 1.00172.90 C
ATOM 332 CD1 ILE A 50 -41.595 26.581 -44.216 1.00173.40 C
ATOM 333 N ALA A 51 -37.184 28.063 -47.263 1.00172.62 N
ATOM 334 CA ALA A 51 -36.449 28.084 -48.522 1.00173.15 C
ATOM 335 C ALA A 51 -34.938 28.027 -48.296 1.00173.08 C
ATOM 336 O ALA A 51 -34.267 27.118 -48.781 1.00173.11 O
ATOM 337 CB ALA A 51 -36.815 29.321 -49.326 1.00173.76 C
ATOM 338 N PHE A 52 -34.416 29.003 -47.558 1.00173.32 N
ATOM 339 CA PHE A 52 -32.981 29.115 -47.280 1.00173.50 C
ATOM 340 C PHE A 52 -32.359 27.812 -46.780 1.00172.93 C
ATOM 341 O PHE A 52 -31.174 27.557 -46.992 1.00173.05 O
ATOM 342 CB PHE A 52 -32.736 30.228 -46.255 1.00173.93 C
ATOM 343 CG PHE A 52 -31.288 30.603 -46.096 1.00173.31 C
ATOM 344 CD1 PHE A 52 -30.714 31.558 -46.919 1.00173.68 C
ATOM 345 CD2 PHE A 52 -30.506 30.013 -45.117 1.00172.96 C
ATOM 346 CE1 PHE A 52 -29.386 31.908 -46.777 1.00173.86 C
ATOM 347 CE2 PHE A 52 -29.177 30.361 -44.969 1.00172.81 C
ATOM 348 CZ PHE A 52 -28.616 31.310 -45.800 1.00173.20 C
ATOM 349 N ILE A 53 -33.165 26.994 -46.114 1.00172.84 N
ATOM 350 CA ILE A 53 -32.682 25.740 -45.557 1.00173.17 C
ATOM 351 C ILE A 53 -32.879 24.542 -46.490 1.00173.73 C
ATOM 352 O ILE A 53 -31.946 23.772 -46.714 1.00173.84 O
ATOM 353 CB ILE A 53 -33.366 25.441 -44.210 1.00173.17 C
ATOM 354 CG1 ILE A 53 -33.043 26.546 -43.204 1.00172.80 C
ATOM 355 CG2 ILE A 53 -32.940 24.079 -43.680 1.00173.14 C
ATOM 356 CD1 ILE A 53 -33.466 26.230 -41.791 1.00173.18 C
ATOM 357 N ALA A 54 -34.079 24.392 -47.046 1.00174.00 N
ATOM 358 CA ALA A 54 -34.447 23.136 -47.704 1.00174.27 C
ATOM 359 C ALA A 54 -34.873 23.246 -49.173 1.00173.89 C
ATOM 360 O ALA A 54 -35.155 22.228 -49.806 1.00173.72 O
ATOM 361 CB ALA A 54 -35.557 22.457 -46.909 1.00174.93 C
ATOM 362 N ALA A 55 -34.932 24.459 -49.716 1.00173.87 N
ATOM 363 CA ALA A 55 -35.352 24.635 -51.109 1.00173.92 C
ATOM 364 C ALA A 55 -34.390 23.966 -52.087 1.00173.75 C
ATOM 365 O ALA A 55 -33.181 23.956 -51.869 1.00174.05 O
ATOM 366 CB ALA A 55 -35.490 26.109 -51.445 1.00174.18 C
ATOM 367 N PRO A 56 -34.931 23.403 -53.175 1.00173.45 N
ATOM 368 CA PRO A 56 -34.130 22.762 -54.217 1.00173.46 C
ATOM 369 C PRO A 56 -33.569 23.787 -55.206 1.00172.57 C
ATOM 370 O PRO A 56 -34.047 24.921 -55.225 1.00172.44 O
ATOM 371 CB PRO A 56 -35.140 21.831 -54.890 1.00173.94 C
ATOM 372 CG PRO A 56 -36.419 22.558 -54.763 1.00174.11 C
ATOM 373 CD PRO A 56 -36.373 23.204 -53.404 1.00173.75 C
ATOM 374 N PRO A 57 -32.560 23.396 -56.005 1.00172.07 N
ATOM 375 CA PRO A 57 -31.915 24.274 -56.987 1.00172.25 C
ATOM 376 C PRO A 57 -32.903 24.985 -57.910 1.00172.92 C
ATOM 377 O PRO A 57 -33.947 24.426 -58.246 1.00173.21 O
ATOM 378 CB PRO A 57 -31.034 23.307 -57.776 1.00173.42 C
ATOM 379 CG PRO A 57 -30.672 22.271 -56.781 1.00173.23 C
ATOM 380 CD PRO A 57 -31.925 22.065 -55.983 1.00172.58 C
ATOM 381 N VAL A 58 -32.573 26.213 -58.300 1.00173.08 N
ATOM 382 CA VAL A 58 -33.454 27.023 -59.135 1.00173.36 C
ATOM 383 C VAL A 58 -32.812 27.423 -60.465 1.00173.64 C
ATOM 384 O VAL A 58 -31.679 27.904 -60.498 1.00173.47 O
ATOM 385 CB VAL A 58 -33.893 28.301 -58.389 1.00173.37 C
ATOM 386 CG1 VAL A 58 -34.615 29.256 -59.328 1.00173.42 C
ATOM 387 CG2 VAL A 58 -34.760 27.950 -57.191 1.00174.27 C
ATOM 388 N ASP A 59 -33.547 27.222 -61.556 1.00174.07 N
ATOM 389 CA ASP A 59 -33.103 27.639 -62.882 1.00173.27 C
ATOM 390 C ASP A 59 -33.325 29.138 -63.069 1.00172.43 C
ATOM 391 O ASP A 59 -34.245 29.560 -63.771 1.00172.51 O
ATOM 392 CB ASP A 59 -33.836 26.844 -63.969 1.00173.85 C
ATOM 393 CG ASP A 59 -33.372 27.200 -65.371 1.00173.96 C
ATOM 394 OD1 ASP A 59 -32.168 27.475 -65.553 1.00173.69 O
ATOM 395 OD2 ASP A 59 -34.213 27.193 -66.295 1.00174.01 O
ATOM 396 N ILE A 60 -32.474 29.934 -62.430 1.00171.61 N
ATOM 397 CA ILE A 60 -32.594 31.389 -62.442 1.00172.38 C
ATOM 398 C ILE A 60 -32.568 32.013 -63.840 1.00172.45 C
ATOM 399 O ILE A 60 -33.402 32.861 -64.157 1.00172.78 O
ATOM 400 CB ILE A 60 -31.480 32.035 -61.582 1.00173.63 C
ATOM 401 CG1 ILE A 60 -31.518 33.559 -61.710 1.00174.27 C
ATOM 402 CG2 ILE A 60 -30.107 31.495 -61.960 1.00173.85 C
ATOM 403 CD1 ILE A 60 -30.688 34.274 -60.672 1.00175.63 C
ATOM 404 N ASP A 61 -31.628 31.588 -64.678 1.00172.79 N
ATOM 405 CA ASP A 61 -31.437 32.214 -65.982 1.00174.13 C
ATOM 406 C ASP A 61 -32.325 31.598 -67.063 1.00173.99 C
ATOM 407 O ASP A 61 -32.176 31.903 -68.247 1.00173.03 O
ATOM 408 CB ASP A 61 -29.965 32.125 -66.394 1.00175.25 C
ATOM 409 CG ASP A 61 -29.031 32.701 -65.344 1.00173.78 C
ATOM 410 OD1 ASP A 61 -29.427 33.672 -64.665 1.00172.18 O
ATOM 411 OD2 ASP A 61 -27.906 32.177 -65.190 1.00173.90 O
ATOM 412 N GLY A 62 -33.251 30.738 -66.650 1.00173.96 N
ATOM 413 CA GLY A 62 -34.179 30.108 -67.572 1.00173.78 C
ATOM 414 C GLY A 62 -33.528 29.255 -68.647 1.00172.87 C
ATOM 415 O GLY A 62 -34.160 28.917 -69.646 1.00172.57 O
ATOM 416 N ILE A 63 -32.265 28.902 -68.442 1.00172.59 N
ATOM 417 CA ILE A 63 -31.521 28.134 -69.431 1.00172.92 C
ATOM 418 C ILE A 63 -31.327 26.686 -68.987 1.00173.15 C
ATOM 419 O ILE A 63 -30.374 26.024 -69.403 1.00174.15 O
ATOM 420 CB ILE A 63 -30.145 28.766 -69.709 1.00173.65 C
ATOM 421 CG1 ILE A 63 -29.334 28.875 -68.417 1.00173.87 C
ATOM 422 CG2 ILE A 63 -30.311 30.138 -70.341 1.00173.14 C
ATOM 423 CD1 ILE A 63 -27.873 29.205 -68.640 1.00174.42 C
ATOM 424 N ARG A 64 -32.248 26.204 -68.153 1.00172.59 N
ATOM 425 CA ARG A 64 -32.198 24.849 -67.602 1.00172.70 C
ATOM 426 C ARG A 64 -30.849 24.558 -66.952 1.00172.60 C
ATOM 427 O ARG A 64 -30.199 23.561 -67.259 1.00171.78 O
ATOM 428 CB ARG A 64 -32.496 23.813 -68.688 1.00172.87 C
ATOM 429 CG ARG A 64 -33.690 24.158 -69.565 1.00174.24 C
ATOM 430 CD ARG A 64 -34.934 24.443 -68.737 1.00173.19 C
ATOM 431 NE ARG A 64 -36.051 24.910 -69.557 1.00173.77 N
ATOM 432 CZ ARG A 64 -36.786 24.130 -70.344 1.00174.23 C
ATOM 433 NH1 ARG A 64 -36.538 22.829 -70.417 1.00174.23 N
ATOM 434 NH2 ARG A 64 -37.778 24.650 -71.053 1.00174.63 N
ATOM 435 N GLU A 65 -30.441 25.444 -66.050 1.00173.08 N
ATOM 436 CA GLU A 65 -29.165 25.315 -65.356 1.00172.84 C
ATOM 437 C GLU A 65 -29.346 25.674 -63.884 1.00173.69 C
ATOM 438 O GLU A 65 -28.909 26.734 -63.443 1.00174.60 O
ATOM 439 CB GLU A 65 -28.105 26.208 -66.007 1.00172.77 C
ATOM 440 CG GLU A 65 -26.685 25.987 -65.498 1.00173.32 C
ATOM 441 CD GLU A 65 -25.706 27.013 -66.040 1.00174.46 C
ATOM 442 OE1 GLU A 65 -25.578 27.118 -67.278 1.00176.03 O
ATOM 443 OE2 GLU A 65 -25.057 27.708 -65.232 1.00173.69 O
ATOM 444 N PRO A 66 -30.016 24.789 -63.127 1.00173.85 N
ATOM 445 CA PRO A 66 -30.402 24.992 -61.726 1.00173.99 C
ATOM 446 C PRO A 66 -29.259 25.425 -60.811 1.00173.57 C
ATOM 447 O PRO A 66 -28.191 24.813 -60.820 1.00172.80 O
ATOM 448 CB PRO A 66 -30.921 23.609 -61.317 1.00173.94 C
ATOM 449 CG PRO A 66 -31.430 23.029 -62.584 1.00173.65 C
ATOM 450 CD PRO A 66 -30.409 23.449 -63.595 1.00174.03 C
ATOM 451 N VAL A 67 -29.496 26.477 -60.034 1.00173.56 N
ATOM 452 CA VAL A 67 -28.524 26.952 -59.058 1.00173.48 C
ATOM 453 C VAL A 67 -29.010 26.687 -57.638 1.00173.63 C
ATOM 454 O VAL A 67 -29.995 27.274 -57.189 1.00173.92 O
ATOM 455 CB VAL A 67 -28.241 28.459 -59.221 1.00173.16 C
ATOM 456 CG1 VAL A 67 -27.241 28.923 -58.174 1.00172.96 C
ATOM 457 CG2 VAL A 67 -27.729 28.755 -60.619 1.00174.06 C
ATOM 458 N SER A 68 -28.320 25.794 -56.938 1.00173.44 N
ATOM 459 CA SER A 68 -28.666 25.471 -55.560 1.00172.97 C
ATOM 460 C SER A 68 -28.138 26.544 -54.615 1.00173.17 C
ATOM 461 O SER A 68 -26.973 26.931 -54.699 1.00173.32 O
ATOM 462 CB SER A 68 -28.110 24.100 -55.168 1.00173.32 C
ATOM 463 OG SER A 68 -26.722 24.169 -54.894 1.00174.49 O
ATOM 464 N GLY A 69 -28.997 27.027 -53.723 1.00173.16 N
ATOM 465 CA GLY A 69 -28.603 28.051 -52.773 1.00173.34 C
ATOM 466 C GLY A 69 -29.075 27.786 -51.355 1.00173.57 C
ATOM 467 O GLY A 69 -29.086 28.691 -50.521 1.00174.20 O
ATOM 468 N SER A 70 -29.461 26.546 -51.074 1.00173.91 N
ATOM 469 CA SER A 70 -29.963 26.200 -49.748 1.00173.99 C
ATOM 470 C SER A 70 -28.968 25.358 -48.955 1.00173.51 C
ATOM 471 O SER A 70 -28.143 24.646 -49.528 1.00173.37 O
ATOM 472 CB SER A 70 -31.296 25.459 -49.859 1.00173.93 C
ATOM 473 OG SER A 70 -31.101 24.097 -50.193 1.00173.52 O
ATOM 474 N LEU A 71 -29.064 25.451 -47.631 1.00173.50 N
ATOM 475 CA LEU A 71 -28.171 24.749 -46.713 1.00173.64 C
ATOM 476 C LEU A 71 -28.125 23.246 -46.967 1.00173.36 C
ATOM 477 O LEU A 71 -27.054 22.675 -47.173 1.00173.06 O
ATOM 478 CB LEU A 71 -28.593 25.014 -45.267 1.00173.92 C
ATOM 479 CG LEU A 71 -28.668 26.484 -44.853 1.00173.61 C
ATOM 480 CD1 LEU A 71 -29.053 26.604 -43.389 1.00174.35 C
ATOM 481 CD2 LEU A 71 -27.345 27.183 -45.128 1.00173.67 C
ATOM 482 N LEU A 72 -29.294 22.612 -46.948 1.00173.19 N
ATOM 483 CA LEU A 72 -29.401 21.170 -47.148 1.00172.73 C
ATOM 484 C LEU A 72 -28.885 20.716 -48.509 1.00173.21 C
ATOM 485 O LEU A 72 -28.647 19.528 -48.720 1.00173.46 O
ATOM 486 CB LEU A 72 -30.853 20.719 -46.983 1.00172.81 C
ATOM 487 CG LEU A 72 -31.406 20.681 -45.559 1.00172.97 C
ATOM 488 CD1 LEU A 72 -32.859 20.230 -45.563 1.00172.35 C
ATOM 489 CD2 LEU A 72 -30.559 19.764 -44.695 1.00174.08 C
ATOM 490 N TYR A 73 -28.705 21.659 -49.429 1.00173.66 N
ATOM 491 CA TYR A 73 -28.243 21.320 -50.768 1.00174.10 C
ATOM 492 C TYR A 73 -26.819 21.812 -51.025 1.00174.30 C
ATOM 493 O TYR A 73 -26.498 22.261 -52.125 1.00174.04 O
ATOM 494 CB TYR A 73 -29.199 21.888 -51.823 1.00173.89 C
ATOM 495 CG TYR A 73 -30.470 21.080 -51.997 1.00173.65 C
ATOM 496 CD1 TYR A 73 -31.465 21.092 -51.026 1.00173.41 C
ATOM 497 CD2 TYR A 73 -30.672 20.298 -53.127 1.00173.43 C
ATOM 498 CE1 TYR A 73 -32.626 20.354 -51.178 1.00172.72 C
ATOM 499 CE2 TYR A 73 -31.830 19.556 -53.288 1.00172.99 C
ATOM 500 CZ TYR A 73 -32.802 19.588 -52.310 1.00172.04 C
ATOM 501 OH TYR A 73 -33.954 18.851 -52.467 1.00170.26 O
ATOM 502 N GLY A 74 -25.969 21.727 -50.004 1.00174.59 N
ATOM 503 CA GLY A 74 -24.549 21.989 -50.166 1.00174.45 C
ATOM 504 C GLY A 74 -24.065 23.399 -49.879 1.00174.00 C
ATOM 505 O GLY A 74 -22.912 23.725 -50.159 1.00174.22 O
ATOM 506 N ASN A 75 -24.933 24.242 -49.329 1.00173.59 N
ATOM 507 CA ASN A 75 -24.553 25.621 -49.033 1.00173.14 C
ATOM 508 C ASN A 75 -24.310 25.895 -47.554 1.00173.16 C
ATOM 509 O ASN A 75 -24.745 25.138 -46.687 1.00173.20 O
ATOM 510 CB ASN A 75 -25.620 26.585 -49.550 1.00172.68 C
ATOM 511 CG ASN A 75 -25.558 26.769 -51.048 1.00172.86 C
ATOM 512 OD1 ASN A 75 -24.920 27.696 -51.546 1.00172.62 O
ATOM 513 ND2 ASN A 75 -26.222 25.883 -51.780 1.00173.81 N
ATOM 514 N ASN A 76 -23.602 26.986 -47.282 1.00172.99 N
ATOM 515 CA ASN A 76 -23.471 27.513 -45.932 1.00172.84 C
ATOM 516 C ASN A 76 -24.054 28.923 -45.882 1.00173.03 C
ATOM 517 O ASN A 76 -24.497 29.443 -46.905 1.00173.56 O
ATOM 518 CB ASN A 76 -22.008 27.499 -45.471 1.00172.48 C
ATOM 519 CG ASN A 76 -21.081 28.258 -46.408 1.00172.59 C
ATOM 520 OD1 ASN A 76 -21.508 29.143 -47.147 1.00172.57 O
ATOM 521 ND2 ASN A 76 -19.800 27.908 -46.379 1.00172.38 N
ATOM 522 N ILE A 77 -24.063 29.527 -44.698 1.00173.09 N
ATOM 523 CA ILE A 77 -24.614 30.867 -44.504 1.00173.05 C
ATOM 524 C ILE A 77 -24.095 31.891 -45.516 1.00172.44 C
ATOM 525 O ILE A 77 -24.866 32.672 -46.073 1.00172.69 O
ATOM 526 CB ILE A 77 -24.312 31.387 -43.088 1.00174.46 C
ATOM 527 CG1 ILE A 77 -24.808 30.392 -42.038 1.00174.56 C
ATOM 528 CG2 ILE A 77 -24.956 32.747 -42.869 1.00174.84 C
ATOM 529 CD1 ILE A 77 -26.310 30.235 -42.014 1.00173.96 C
ATOM 530 N ILE A 78 -22.788 31.880 -45.752 1.00171.97 N
ATOM 531 CA ILE A 78 -22.164 32.861 -46.635 1.00172.82 C
ATOM 532 C ILE A 78 -22.522 32.646 -48.108 1.00173.55 C
ATOM 533 O ILE A 78 -22.768 33.604 -48.839 1.00174.04 O
ATOM 534 CB ILE A 78 -20.631 32.845 -46.480 1.00173.44 C
ATOM 535 CG1 ILE A 78 -20.246 33.056 -45.016 1.00172.64 C
ATOM 536 CG2 ILE A 78 -19.993 33.915 -47.349 1.00174.57 C
ATOM 537 CD1 ILE A 78 -20.729 34.370 -44.446 1.00172.57 C
ATOM 538 N THR A 79 -22.564 31.391 -48.541 1.00173.33 N
ATOM 539 CA THR A 79 -22.865 31.089 -49.938 1.00173.40 C
ATOM 540 C THR A 79 -24.363 30.974 -50.193 1.00172.96 C
ATOM 541 O THR A 79 -24.857 31.413 -51.231 1.00173.28 O
ATOM 542 CB THR A 79 -22.188 29.783 -50.392 1.00173.72 C
ATOM 543 OG1 THR A 79 -22.784 28.674 -49.708 1.00173.06 O
ATOM 544 CG2 THR A 79 -20.699 29.823 -50.091 1.00174.41 C
ATOM 545 N GLY A 80 -25.075 30.379 -49.242 1.00173.11 N
ATOM 546 CA GLY A 80 -26.506 30.165 -49.360 1.00173.49 C
ATOM 547 C GLY A 80 -27.319 31.402 -49.692 1.00172.56 C
ATOM 548 O GLY A 80 -26.963 32.516 -49.304 1.00172.19 O
ATOM 549 N ALA A 81 -28.415 31.199 -50.417 1.00171.93 N
ATOM 550 CA ALA A 81 -29.285 32.292 -50.830 1.00171.25 C
ATOM 551 C ALA A 81 -30.627 31.770 -51.329 1.00171.33 C
ATOM 552 O ALA A 81 -30.775 30.582 -51.612 1.00171.83 O
ATOM 553 CB ALA A 81 -28.613 33.121 -51.913 1.00172.14 C
ATOM 554 N VAL A 82 -31.602 32.663 -51.447 1.00170.74 N
ATOM 555 CA VAL A 82 -32.861 32.314 -52.092 1.00171.98 C
ATOM 556 C VAL A 82 -32.806 32.822 -53.524 1.00173.54 C
ATOM 557 O VAL A 82 -32.765 34.028 -53.765 1.00174.54 O
ATOM 558 CB VAL A 82 -34.076 32.907 -51.363 1.00172.05 C
ATOM 559 CG1 VAL A 82 -35.331 32.738 -52.202 1.00172.87 C
ATOM 560 CG2 VAL A 82 -34.251 32.246 -50.007 1.00173.55 C
ATOM 561 N VAL A 83 -32.805 31.892 -54.471 1.00173.61 N
ATOM 562 CA VAL A 83 -32.566 32.220 -55.869 1.00172.23 C
ATOM 563 C VAL A 83 -33.786 32.856 -56.525 1.00172.19 C
ATOM 564 O VAL A 83 -34.900 32.351 -56.391 1.00172.75 O
ATOM 565 CB VAL A 83 -32.163 30.964 -56.660 1.00172.19 C
ATOM 566 CG1 VAL A 83 -31.760 31.328 -58.074 1.00172.53 C
ATOM 567 CG2 VAL A 83 -31.029 30.240 -55.952 1.00174.28 C
ATOM 568 N PRO A 84 -33.573 33.972 -57.242 1.00171.99 N
ATOM 569 CA PRO A 84 -34.628 34.681 -57.970 1.00172.73 C
ATOM 570 C PRO A 84 -35.368 33.791 -58.963 1.00172.83 C
ATOM 571 O PRO A 84 -34.823 32.781 -59.409 1.00173.03 O
ATOM 572 CB PRO A 84 -33.858 35.787 -58.693 1.00173.06 C
ATOM 573 CG PRO A 84 -32.715 36.071 -57.783 1.00172.66 C
ATOM 574 CD PRO A 84 -32.301 34.716 -57.281 1.00171.94 C
ATOM 575 N SER A 85 -36.603 34.166 -59.284 1.00172.92 N
ATOM 576 CA SER A 85 -37.429 33.418 -60.227 1.00173.12 C
ATOM 577 C SER A 85 -36.747 33.278 -61.583 1.00173.38 C
ATOM 578 O SER A 85 -35.835 34.035 -61.908 1.00173.01 O
ATOM 579 CB SER A 85 -38.790 34.096 -60.396 1.00173.58 C
ATOM 580 OG SER A 85 -38.642 35.405 -60.916 1.00172.99 O
ATOM 581 N SER A 86 -37.198 32.304 -62.366 1.00174.07 N
ATOM 582 CA SER A 86 -36.601 32.019 -63.666 1.00173.63 C
ATOM 583 C SER A 86 -36.703 33.202 -64.621 1.00173.20 C
ATOM 584 O SER A 86 -37.564 34.069 -64.469 1.00173.25 O
ATOM 585 CB SER A 86 -37.262 30.791 -64.296 1.00173.72 C
ATOM 586 OG SER A 86 -36.838 30.618 -65.637 1.00172.56 O
ATOM 587 N ASN A 87 -35.815 33.228 -65.609 1.00172.91 N
ATOM 588 CA ASN A 87 -35.822 34.280 -66.612 1.00173.34 C
ATOM 589 C ASN A 87 -36.868 33.979 -67.679 1.00173.85 C
ATOM 590 O ASN A 87 -37.269 34.858 -68.441 1.00174.60 O
ATOM 591 CB ASN A 87 -34.434 34.432 -67.238 1.00173.42 C
ATOM 592 CG ASN A 87 -34.355 35.595 -68.205 1.00173.30 C
ATOM 593 OD1 ASN A 87 -34.550 36.748 -67.823 1.00172.60 O
ATOM 594 ND2 ASN A 87 -34.060 35.299 -69.464 1.00173.63 N
ATOM 595 N ALA A 88 -37.307 32.724 -67.720 1.00174.04 N
ATOM 596 CA ALA A 88 -38.379 32.310 -68.616 1.00174.88 C
ATOM 597 C ALA A 88 -39.713 32.894 -68.167 1.00174.53 C
ATOM 598 O ALA A 88 -40.638 33.043 -68.965 1.00174.49 O
ATOM 599 CB ALA A 88 -38.460 30.795 -68.682 1.00175.15 C
ATOM 600 N ILE A 89 -39.805 33.218 -66.881 1.00173.79 N
ATOM 601 CA ILE A 89 -41.006 33.825 -66.326 1.00173.18 C
ATOM 602 C ILE A 89 -40.987 35.333 -66.558 1.00172.36 C
ATOM 603 O ILE A 89 -42.017 35.943 -66.842 1.00171.58 O
ATOM 604 CB ILE A 89 -41.137 33.532 -64.819 1.00173.79 C
ATOM 605 CG1 ILE A 89 -41.195 32.024 -64.572 1.00173.89 C
ATOM 606 CG2 ILE A 89 -42.364 34.222 -64.239 1.00174.13 C
ATOM 607 CD1 ILE A 89 -41.044 31.639 -63.118 1.00174.19 C
ATOM 608 N GLY A 90 -39.800 35.923 -66.456 1.00172.65 N
ATOM 609 CA GLY A 90 -39.638 37.353 -66.639 1.00173.38 C
ATOM 610 C GLY A 90 -40.379 38.167 -65.596 1.00173.45 C
ATOM 611 O GLY A 90 -40.114 38.047 -64.400 1.00173.90 O
ATOM 612 N LEU A 91 -41.313 38.996 -66.051 1.00173.05 N
ATOM 613 CA LEU A 91 -42.099 39.827 -65.147 1.00172.94 C
ATOM 614 C LEU A 91 -43.487 39.247 -64.915 1.00172.87 C
ATOM 615 O LEU A 91 -44.330 39.884 -64.285 1.00173.63 O
ATOM 616 CB LEU A 91 -42.219 41.253 -65.688 1.00172.42 C
ATOM 617 CG LEU A 91 -40.948 42.102 -65.637 1.00172.93 C
ATOM 618 CD1 LEU A 91 -41.210 43.494 -66.189 1.00173.45 C
ATOM 619 CD2 LEU A 91 -40.401 42.174 -64.219 1.00173.09 C
ATOM 620 N HIS A 92 -43.729 38.048 -65.434 1.00172.28 N
ATOM 621 CA HIS A 92 -45.016 37.391 -65.234 1.00172.82 C
ATOM 622 C HIS A 92 -45.248 37.081 -63.762 1.00174.07 C
ATOM 623 O HIS A 92 -44.311 36.780 -63.023 1.00175.03 O
ATOM 624 CB HIS A 92 -45.111 36.101 -66.051 1.00172.58 C
ATOM 625 CG HIS A 92 -45.354 36.323 -67.510 1.00172.61 C
ATOM 626 ND1 HIS A 92 -46.161 35.497 -68.263 1.00172.66 N
ATOM 627 CD2 HIS A 92 -44.893 37.273 -68.358 1.00173.58 C
ATOM 628 CE1 HIS A 92 -46.190 35.930 -69.510 1.00173.42 C
ATOM 629 NE2 HIS A 92 -45.429 37.007 -69.595 1.00174.24 N
ATOM 630 N PHE A 93 -46.506 37.156 -63.344 1.00173.84 N
ATOM 631 CA PHE A 93 -46.876 36.837 -61.974 1.00173.45 C
ATOM 632 C PHE A 93 -46.920 35.325 -61.782 1.00173.66 C
ATOM 633 O PHE A 93 -47.647 34.626 -62.487 1.00174.26 O
ATOM 634 CB PHE A 93 -48.223 37.467 -61.628 1.00173.37 C
ATOM 635 CG PHE A 93 -48.537 37.456 -60.165 1.00173.72 C
ATOM 636 CD1 PHE A 93 -47.743 38.151 -59.269 1.00173.93 C
ATOM 637 CD2 PHE A 93 -49.631 36.760 -59.684 1.00174.17 C
ATOM 638 CE1 PHE A 93 -48.031 38.146 -57.921 1.00174.50 C
ATOM 639 CE2 PHE A 93 -49.924 36.750 -58.336 1.00174.28 C
ATOM 640 CZ PHE A 93 -49.123 37.444 -57.454 1.00174.71 C
ATOM 641 N TYR A 94 -46.137 34.823 -60.830 1.00173.50 N
ATOM 642 CA TYR A 94 -46.001 33.379 -60.643 1.00173.78 C
ATOM 643 C TYR A 94 -46.311 32.917 -59.216 1.00174.12 C
ATOM 644 O TYR A 94 -45.401 32.587 -58.456 1.00173.85 O
ATOM 645 CB TYR A 94 -44.589 32.933 -61.035 1.00174.00 C
ATOM 646 CG TYR A 94 -44.446 31.440 -61.251 1.00174.60 C
ATOM 647 CD1 TYR A 94 -45.099 30.803 -62.301 1.00174.52 C
ATOM 648 CD2 TYR A 94 -43.652 30.668 -60.412 1.00174.98 C
ATOM 649 CE1 TYR A 94 -44.969 29.437 -62.503 1.00174.75 C
ATOM 650 CE2 TYR A 94 -43.516 29.304 -60.607 1.00174.82 C
ATOM 651 CZ TYR A 94 -44.176 28.694 -61.653 1.00174.82 C
ATOM 652 OH TYR A 94 -44.040 27.338 -61.846 1.00174.24 O
ATOM 653 N PRO A 95 -47.602 32.908 -58.842 1.00174.42 N
ATOM 654 CA PRO A 95 -48.039 32.376 -57.548 1.00174.64 C
ATOM 655 C PRO A 95 -48.045 30.848 -57.539 1.00174.42 C
ATOM 656 O PRO A 95 -47.917 30.240 -58.601 1.00174.64 O
ATOM 657 CB PRO A 95 -49.457 32.933 -57.413 1.00174.50 C
ATOM 658 CG PRO A 95 -49.940 32.978 -58.819 1.00174.24 C
ATOM 659 CD PRO A 95 -48.743 33.423 -59.620 1.00174.32 C
ATOM 660 N ILE A 96 -48.166 30.244 -56.361 1.00173.89 N
ATOM 661 CA ILE A 96 -48.232 28.789 -56.240 1.00173.48 C
ATOM 662 C ILE A 96 -49.335 28.181 -57.111 1.00173.94 C
ATOM 663 O ILE A 96 -49.139 27.136 -57.729 1.00174.24 O
ATOM 664 CB ILE A 96 -48.451 28.359 -54.775 1.00173.37 C
ATOM 665 CG1 ILE A 96 -47.338 28.918 -53.886 1.00173.69 C
ATOM 666 CG2 ILE A 96 -48.504 26.845 -54.659 1.00173.45 C
ATOM 667 CD1 ILE A 96 -47.466 28.528 -52.433 1.00174.68 C
ATOM 668 N TRP A 97 -50.487 28.846 -57.175 1.00174.02 N
ATOM 669 CA TRP A 97 -51.618 28.337 -57.951 1.00174.12 C
ATOM 670 C TRP A 97 -51.459 28.572 -59.457 1.00174.27 C
ATOM 671 O TRP A 97 -52.430 28.507 -60.210 1.00175.04 O
ATOM 672 CB TRP A 97 -52.931 28.964 -57.461 1.00174.06 C
ATOM 673 CG TRP A 97 -53.014 30.457 -57.622 1.00174.26 C
ATOM 674 CD1 TRP A 97 -53.300 31.144 -58.765 1.00174.53 C
ATOM 675 CD2 TRP A 97 -52.825 31.444 -56.599 1.00174.27 C
ATOM 676 NE1 TRP A 97 -53.293 32.496 -58.521 1.00174.24 N
ATOM 677 CE2 TRP A 97 -53.005 32.707 -57.199 1.00174.16 C
ATOM 678 CE3 TRP A 97 -52.518 31.382 -55.236 1.00174.54 C
ATOM 679 CZ2 TRP A 97 -52.887 33.897 -56.484 1.00174.14 C
ATOM 680 CZ3 TRP A 97 -52.402 32.566 -54.528 1.00174.96 C
ATOM 681 CH2 TRP A 97 -52.586 33.806 -55.153 1.00174.44 C
ATOM 682 N GLU A 98 -50.230 28.837 -59.887 1.00174.10 N
ATOM 683 CA GLU A 98 -49.924 29.047 -61.298 1.00174.17 C
ATOM 684 C GLU A 98 -49.036 27.911 -61.795 1.00174.28 C
ATOM 685 O GLU A 98 -48.612 27.885 -62.951 1.00174.42 O
ATOM 686 CB GLU A 98 -49.239 30.403 -61.500 1.00174.08 C
ATOM 687 CG GLU A 98 -49.138 30.888 -62.943 1.00174.00 C
ATOM 688 CD GLU A 98 -50.394 31.583 -63.431 1.00173.76 C
ATOM 689 OE1 GLU A 98 -50.304 32.315 -64.439 1.00173.89 O
ATOM 690 OE2 GLU A 98 -51.464 31.405 -62.813 1.00173.17 O
ATOM 691 N ALA A 99 -48.771 26.960 -60.907 1.00174.15 N
ATOM 692 CA ALA A 99 -47.890 25.843 -61.221 1.00173.83 C
ATOM 693 C ALA A 99 -48.639 24.520 -61.147 1.00173.63 C
ATOM 694 O ALA A 99 -49.539 24.352 -60.324 1.00173.36 O
ATOM 695 CB ALA A 99 -46.697 25.831 -60.280 1.00173.53 C
ATOM 696 N ALA A 100 -48.270 23.590 -62.023 1.00173.98 N
ATOM 697 CA ALA A 100 -48.854 22.253 -62.025 1.00174.04 C
ATOM 698 C ALA A 100 -48.572 21.519 -60.716 1.00174.07 C
ATOM 699 O ALA A 100 -49.350 20.663 -60.293 1.00173.99 O
ATOM 700 CB ALA A 100 -48.331 21.450 -63.205 1.00174.46 C
ATOM 701 N SER A 101 -47.456 21.860 -60.080 1.00174.23 N
ATOM 702 CA SER A 101 -47.071 21.248 -58.814 1.00174.28 C
ATOM 703 C SER A 101 -46.049 22.112 -58.087 1.00174.13 C
ATOM 704 O SER A 101 -45.499 23.055 -58.660 1.00173.69 O
ATOM 705 CB SER A 101 -46.503 19.846 -59.039 1.00173.78 C
ATOM 706 OG SER A 101 -45.502 19.859 -60.042 1.00174.11 O
ATOM 707 N LEU A 102 -45.794 21.782 -56.825 1.00174.58 N
ATOM 708 CA LEU A 102 -44.803 22.504 -56.035 1.00174.33 C
ATOM 709 C LEU A 102 -43.402 22.255 -56.577 1.00174.12 C
ATOM 710 O LEU A 102 -42.556 23.147 -56.558 1.00174.25 O
ATOM 711 CB LEU A 102 -44.882 22.100 -54.561 1.00173.35 C
ATOM 712 CG LEU A 102 -46.033 22.712 -53.761 1.00173.52 C
ATOM 713 CD1 LEU A 102 -46.200 22.004 -52.424 1.00174.18 C
ATOM 714 CD2 LEU A 102 -45.812 24.207 -53.561 1.00173.08 C
ATOM 715 N ASP A 103 -43.168 21.035 -57.054 1.00173.77 N
ATOM 716 CA ASP A 103 -41.890 20.666 -57.650 1.00173.23 C
ATOM 717 C ASP A 103 -41.528 21.632 -58.771 1.00172.58 C
ATOM 718 O ASP A 103 -40.389 22.088 -58.872 1.00172.17 O
ATOM 719 CB ASP A 103 -41.940 19.229 -58.177 1.00173.91 C
ATOM 720 CG ASP A 103 -41.637 18.203 -57.101 1.00173.99 C
ATOM 721 OD1 ASP A 103 -41.984 18.453 -55.927 1.00173.81 O
ATOM 722 OD2 ASP A 103 -41.053 17.148 -57.426 1.00173.81 O
ATOM 723 N GLU A 104 -42.514 21.946 -59.604 1.00172.72 N
ATOM 724 CA GLU A 104 -42.336 22.901 -60.689 1.00173.46 C
ATOM 725 C GLU A 104 -42.152 24.308 -60.135 1.00173.07 C
ATOM 726 O GLU A 104 -41.355 25.095 -60.648 1.00173.44 O
ATOM 727 CB GLU A 104 -43.535 22.861 -61.635 1.00174.00 C
ATOM 728 CG GLU A 104 -43.610 24.036 -62.593 1.00174.20 C
ATOM 729 CD GLU A 104 -44.963 24.153 -63.260 1.00174.01 C
ATOM 730 OE1 GLU A 104 -45.485 23.124 -63.737 1.00174.39 O
ATOM 731 OE2 GLU A 104 -45.506 25.276 -63.306 1.00173.59 O
ATOM 732 N TRP A 105 -42.891 24.608 -59.072 1.00172.74 N
ATOM 733 CA TRP A 105 -42.881 25.935 -58.473 1.00173.34 C
ATOM 734 C TRP A 105 -41.524 26.239 -57.852 1.00173.83 C
ATOM 735 O TRP A 105 -41.023 27.359 -57.953 1.00174.42 O
ATOM 736 CB TRP A 105 -43.993 26.048 -57.426 1.00173.92 C
ATOM 737 CG TRP A 105 -44.141 27.412 -56.816 1.00173.96 C
ATOM 738 CD1 TRP A 105 -44.612 28.537 -57.427 1.00174.33 C
ATOM 739 CD2 TRP A 105 -43.846 27.784 -55.465 1.00173.37 C
ATOM 740 NE1 TRP A 105 -44.614 29.591 -56.545 1.00173.85 N
ATOM 741 CE2 TRP A 105 -44.149 29.154 -55.331 1.00173.44 C
ATOM 742 CE3 TRP A 105 -43.348 27.095 -54.354 1.00173.30 C
ATOM 743 CZ2 TRP A 105 -43.971 29.847 -54.137 1.00173.90 C
ATOM 744 CZ3 TRP A 105 -43.172 27.784 -53.169 1.00173.79 C
ATOM 745 CH2 TRP A 105 -43.483 29.145 -53.069 1.00174.39 C
ATOM 746 N LEU A 106 -40.924 25.235 -57.222 1.00173.93 N
ATOM 747 CA LEU A 106 -39.615 25.402 -56.600 1.00174.24 C
ATOM 748 C LEU A 106 -38.498 25.444 -57.639 1.00173.80 C
ATOM 749 O LEU A 106 -37.426 25.993 -57.390 1.00174.42 O
ATOM 750 CB LEU A 106 -39.350 24.278 -55.598 1.00174.90 C
ATOM 751 CG LEU A 106 -40.349 24.094 -54.454 1.00175.54 C
ATOM 752 CD1 LEU A 106 -40.123 22.760 -53.756 1.00175.59 C
ATOM 753 CD2 LEU A 106 -40.242 25.242 -53.465 1.00175.06 C
ATOM 754 N TYR A 107 -38.754 24.857 -58.802 1.00172.95 N
ATOM 755 CA TYR A 107 -37.754 24.789 -59.859 1.00173.14 C
ATOM 756 C TYR A 107 -37.633 26.124 -60.583 1.00172.72 C
ATOM 757 O TYR A 107 -36.545 26.518 -61.002 1.00172.92 O
ATOM 758 CB TYR A 107 -38.106 23.674 -60.847 1.00173.77 C
ATOM 759 CG TYR A 107 -37.087 23.450 -61.946 1.00173.72 C
ATOM 760 CD1 TYR A 107 -36.027 22.569 -61.767 1.00173.77 C
ATOM 761 CD2 TYR A 107 -37.196 24.102 -63.168 1.00173.48 C
ATOM 762 CE1 TYR A 107 -35.097 22.353 -62.766 1.00173.54 C
ATOM 763 CE2 TYR A 107 -36.269 23.891 -64.176 1.00173.93 C
ATOM 764 CZ TYR A 107 -35.223 23.015 -63.968 1.00174.09 C
ATOM 765 OH TYR A 107 -34.296 22.798 -64.962 1.00174.24 O
ATOM 766 N ASN A 108 -38.754 26.823 -60.715 1.00172.35 N
ATOM 767 CA ASN A 108 -38.789 28.077 -61.457 1.00172.63 C
ATOM 768 C ASN A 108 -38.604 29.303 -60.568 1.00172.29 C
ATOM 769 O ASN A 108 -38.878 30.425 -60.988 1.00172.61 O
ATOM 770 CB ASN A 108 -40.104 28.194 -62.231 1.00173.18 C
ATOM 771 CG ASN A 108 -40.223 27.166 -63.342 1.00173.69 C
ATOM 772 OD1 ASN A 108 -40.165 27.506 -64.524 1.00173.86 O
ATOM 773 ND2 ASN A 108 -40.398 25.904 -62.967 1.00173.58 N
ATOM 774 N GLY A 109 -38.138 29.086 -59.343 1.00172.01 N
ATOM 775 CA GLY A 109 -37.879 30.182 -58.426 1.00173.23 C
ATOM 776 C GLY A 109 -39.144 30.816 -57.884 1.00174.64 C
ATOM 777 O GLY A 109 -39.201 32.025 -57.659 1.00175.07 O
ATOM 778 N GLY A 110 -40.161 29.988 -57.677 1.00175.10 N
ATOM 779 CA GLY A 110 -41.426 30.424 -57.110 1.00174.64 C
ATOM 780 C GLY A 110 -41.363 31.165 -55.783 1.00173.12 C
ATOM 781 O GLY A 110 -41.917 32.259 -55.674 1.00172.35 O
ATOM 782 N PRO A 111 -40.711 30.570 -54.765 1.00172.76 N
ATOM 783 CA PRO A 111 -40.578 31.199 -53.447 1.00172.99 C
ATOM 784 C PRO A 111 -40.109 32.650 -53.485 1.00173.07 C
ATOM 785 O PRO A 111 -40.610 33.457 -52.704 1.00173.17 O
ATOM 786 CB PRO A 111 -39.537 30.319 -52.761 1.00173.47 C
ATOM 787 CG PRO A 111 -39.814 28.974 -53.306 1.00173.51 C
ATOM 788 CD PRO A 111 -40.151 29.204 -54.756 1.00173.20 C
ATOM 789 N TYR A 112 -39.175 32.965 -54.379 1.00173.08 N
ATOM 790 CA TYR A 112 -38.603 34.306 -54.468 1.00173.72 C
ATOM 791 C TYR A 112 -39.666 35.393 -54.578 1.00173.52 C
ATOM 792 O TYR A 112 -39.634 36.372 -53.834 1.00173.99 O
ATOM 793 CB TYR A 112 -37.652 34.406 -55.660 1.00173.96 C
ATOM 794 CG TYR A 112 -36.965 35.750 -55.775 1.00173.68 C
ATOM 795 CD1 TYR A 112 -35.914 36.087 -54.932 1.00174.00 C
ATOM 796 CD2 TYR A 112 -37.363 36.679 -56.728 1.00173.09 C
ATOM 797 CE1 TYR A 112 -35.281 37.311 -55.034 1.00173.56 C
ATOM 798 CE2 TYR A 112 -36.736 37.905 -56.837 1.00172.97 C
ATOM 799 CZ TYR A 112 -35.696 38.215 -55.988 1.00173.32 C
ATOM 800 OH TYR A 112 -35.070 39.435 -56.095 1.00174.04 O
ATOM 801 N GLN A 113 -40.603 35.217 -55.504 1.00172.95 N
ATOM 802 CA GLN A 113 -41.673 36.189 -55.693 1.00173.26 C
ATOM 803 C GLN A 113 -42.544 36.303 -54.450 1.00174.10 C
ATOM 804 O GLN A 113 -42.878 37.406 -54.020 1.00175.01 O
ATOM 805 CB GLN A 113 -42.535 35.825 -56.902 1.00173.30 C
ATOM 806 CG GLN A 113 -41.912 36.190 -58.237 1.00174.62 C
ATOM 807 CD GLN A 113 -42.883 36.036 -59.390 1.00174.59 C
ATOM 808 OE1 GLN A 113 -44.057 36.392 -59.280 1.00173.71 O
ATOM 809 NE2 GLN A 113 -42.395 35.512 -60.508 1.00174.84 N
ATOM 810 N LEU A 114 -42.907 35.160 -53.879 1.00173.63 N
ATOM 811 CA LEU A 114 -43.741 35.126 -52.683 1.00173.27 C
ATOM 812 C LEU A 114 -43.103 35.916 -51.542 1.00172.90 C
ATOM 813 O LEU A 114 -43.800 36.562 -50.762 1.00172.96 O
ATOM 814 CB LEU A 114 -44.004 33.676 -52.262 1.00172.98 C
ATOM 815 CG LEU A 114 -45.050 33.385 -51.182 1.00172.60 C
ATOM 816 CD1 LEU A 114 -45.594 31.980 -51.373 1.00173.13 C
ATOM 817 CD2 LEU A 114 -44.483 33.527 -49.779 1.00173.64 C
ATOM 818 N ILE A 115 -41.778 35.863 -51.453 1.00172.89 N
ATOM 819 CA ILE A 115 -41.056 36.561 -50.395 1.00172.69 C
ATOM 820 C ILE A 115 -40.971 38.064 -50.638 1.00172.87 C
ATOM 821 O ILE A 115 -41.394 38.858 -49.797 1.00172.65 O
ATOM 822 CB ILE A 115 -39.628 36.013 -50.233 1.00172.48 C
ATOM 823 CG1 ILE A 115 -39.667 34.514 -49.942 1.00172.85 C
ATOM 824 CG2 ILE A 115 -38.901 36.745 -49.119 1.00172.76 C
ATOM 825 CD1 ILE A 115 -38.305 33.902 -49.739 1.00173.47 C
ATOM 826 N ILE A 116 -40.416 38.447 -51.784 1.00173.37 N
ATOM 827 CA ILE A 116 -40.188 39.856 -52.093 1.00173.98 C
ATOM 828 C ILE A 116 -41.483 40.666 -52.132 1.00174.02 C
ATOM 829 O ILE A 116 -41.518 41.807 -51.671 1.00173.96 O
ATOM 830 CB ILE A 116 -39.435 40.036 -53.441 1.00174.04 C
ATOM 831 CG1 ILE A 116 -40.190 39.381 -54.600 1.00173.91 C
ATOM 832 CG2 ILE A 116 -38.026 39.474 -53.343 1.00173.42 C
ATOM 833 CD1 ILE A 116 -39.756 39.875 -55.966 1.00172.96 C
ATOM 834 N PHE A 117 -42.548 40.074 -52.664 1.00174.17 N
ATOM 835 CA PHE A 117 -43.838 40.752 -52.737 1.00174.10 C
ATOM 836 C PHE A 117 -44.395 40.973 -51.334 1.00173.87 C
ATOM 837 O PHE A 117 -44.839 42.070 -51.002 1.00174.27 O
ATOM 838 CB PHE A 117 -44.827 39.960 -53.602 1.00174.91 C
ATOM 839 CG PHE A 117 -44.484 39.961 -55.071 1.00174.72 C
ATOM 840 CD1 PHE A 117 -43.828 41.043 -55.639 1.00174.58 C
ATOM 841 CD2 PHE A 117 -44.827 38.893 -55.886 1.00174.34 C
ATOM 842 CE1 PHE A 117 -43.512 41.053 -56.985 1.00173.61 C
ATOM 843 CE2 PHE A 117 -44.512 38.899 -57.235 1.00172.87 C
ATOM 844 CZ PHE A 117 -43.854 39.982 -57.784 1.00172.88 C
ATOM 845 N HIS A 118 -44.373 39.924 -50.518 1.00173.98 N
ATOM 846 CA HIS A 118 -44.845 40.008 -49.138 1.00174.79 C
ATOM 847 C HIS A 118 -44.016 40.966 -48.300 1.00174.34 C
ATOM 848 O HIS A 118 -44.542 41.703 -47.465 1.00173.97 O
ATOM 849 CB HIS A 118 -44.814 38.632 -48.489 1.00175.03 C
ATOM 850 CG HIS A 118 -45.990 37.781 -48.836 1.00174.84 C
ATOM 851 ND1 HIS A 118 -46.075 37.072 -50.013 1.00174.23 N
ATOM 852 CD2 HIS A 118 -47.133 37.527 -48.157 1.00174.34 C
ATOM 853 CE1 HIS A 118 -47.222 36.415 -50.046 1.00173.95 C
ATOM 854 NE2 HIS A 118 -47.879 36.673 -48.930 1.00173.97 N
ATOM 855 N PHE A 119 -42.711 40.934 -48.526 1.00173.71 N
ATOM 856 CA PHE A 119 -41.792 41.774 -47.786 1.00172.93 C
ATOM 857 C PHE A 119 -42.008 43.248 -48.109 1.00173.33 C
ATOM 858 O PHE A 119 -42.309 44.044 -47.221 1.00173.57 O
ATOM 859 CB PHE A 119 -40.354 41.370 -48.087 1.00172.21 C
ATOM 860 CG PHE A 119 -39.344 42.322 -47.548 1.00172.25 C
ATOM 861 CD1 PHE A 119 -39.052 42.341 -46.197 1.00172.78 C
ATOM 862 CD2 PHE A 119 -38.684 43.200 -48.388 1.00172.74 C
ATOM 863 CE1 PHE A 119 -38.125 43.221 -45.692 1.00173.27 C
ATOM 864 CE2 PHE A 119 -37.754 44.082 -47.889 1.00172.86 C
ATOM 865 CZ PHE A 119 -37.473 44.092 -46.539 1.00172.99 C
ATOM 866 N LEU A 120 -41.856 43.599 -49.384 1.00173.53 N
ATOM 867 CA LEU A 120 -42.028 44.974 -49.847 1.00174.20 C
ATOM 868 C LEU A 120 -43.373 45.559 -49.427 1.00174.32 C
ATOM 869 O LEU A 120 -43.466 46.739 -49.086 1.00174.30 O
ATOM 870 CB LEU A 120 -41.882 45.042 -51.370 1.00173.93 C
ATOM 871 CG LEU A 120 -40.462 44.913 -51.927 1.00173.96 C
ATOM 872 CD1 LEU A 120 -40.481 44.850 -53.449 1.00174.07 C
ATOM 873 CD2 LEU A 120 -39.571 46.053 -51.443 1.00174.13 C
ATOM 874 N LEU A 121 -44.408 44.726 -49.450 1.00174.39 N
ATOM 875 CA LEU A 121 -45.731 45.124 -48.984 1.00174.18 C
ATOM 876 C LEU A 121 -45.699 45.443 -47.491 1.00173.12 C
ATOM 877 O LEU A 121 -46.045 46.548 -47.075 1.00172.62 O
ATOM 878 CB LEU A 121 -46.754 44.023 -49.276 1.00174.92 C
ATOM 879 CG LEU A 121 -48.223 44.439 -49.373 1.00175.53 C
ATOM 880 CD1 LEU A 121 -48.426 45.447 -50.495 1.00175.05 C
ATOM 881 CD2 LEU A 121 -49.105 43.220 -49.588 1.00174.63 C
ATOM 882 N GLY A 122 -45.284 44.462 -46.695 1.00172.83 N
ATOM 883 CA GLY A 122 -45.155 44.631 -45.260 1.00173.11 C
ATOM 884 C GLY A 122 -44.204 45.746 -44.866 1.00173.45 C
ATOM 885 O GLY A 122 -44.514 46.553 -43.988 1.00173.62 O
ATOM 886 N ALA A 123 -43.042 45.789 -45.514 1.00173.67 N
ATOM 887 CA ALA A 123 -42.035 46.809 -45.230 1.00173.50 C
ATOM 888 C ALA A 123 -42.553 48.212 -45.537 1.00173.11 C
ATOM 889 O ALA A 123 -42.072 49.195 -44.975 1.00173.06 O
ATOM 890 CB ALA A 123 -40.762 46.533 -46.017 1.00173.36 C
ATOM 891 N SER A 124 -43.535 48.299 -46.428 1.00173.07 N
ATOM 892 CA SER A 124 -44.175 49.572 -46.735 1.00173.44 C
ATOM 893 C SER A 124 -45.134 49.934 -45.613 1.00173.56 C
ATOM 894 O SER A 124 -45.153 51.068 -45.135 1.00173.53 O
ATOM 895 CB SER A 124 -44.913 49.507 -48.073 1.00173.72 C
ATOM 896 OG SER A 124 -44.020 49.227 -49.136 1.00173.80 O
ATOM 897 N CYS A 125 -45.931 48.953 -45.204 1.00173.80 N
ATOM 898 CA CYS A 125 -46.833 49.101 -44.069 1.00175.01 C
ATOM 899 C CYS A 125 -46.069 49.387 -42.778 1.00174.73 C
ATOM 900 O CYS A 125 -46.576 50.066 -41.885 1.00174.66 O
ATOM 901 CB CYS A 125 -47.688 47.842 -43.907 1.00174.65 C
ATOM 902 SG CYS A 125 -48.817 47.531 -45.280 1.00171.12 S
ATOM 903 N TYR A 126 -44.852 48.859 -42.688 1.00174.13 N
ATOM 904 CA TYR A 126 -43.985 49.116 -41.546 1.00173.48 C
ATOM 905 C TYR A 126 -43.677 50.605 -41.451 1.00173.48 C
ATOM 906 O TYR A 126 -43.594 51.166 -40.359 1.00173.37 O
ATOM 907 CB TYR A 126 -42.694 48.300 -41.656 1.00173.37 C
ATOM 908 CG TYR A 126 -41.783 48.423 -40.457 1.00173.33 C
ATOM 909 CD1 TYR A 126 -41.907 47.562 -39.376 1.00173.16 C
ATOM 910 CD2 TYR A 126 -40.794 49.396 -40.410 1.00173.67 C
ATOM 911 CE1 TYR A 126 -41.078 47.671 -38.278 1.00173.86 C
ATOM 912 CE2 TYR A 126 -39.957 49.512 -39.317 1.00173.70 C
ATOM 913 CZ TYR A 126 -40.104 48.646 -38.254 1.00173.92 C
ATOM 914 OH TYR A 126 -39.277 48.753 -37.160 1.00174.30 O
ATOM 915 N MET A 127 -43.525 51.239 -42.609 1.00173.55 N
ATOM 916 CA MET A 127 -43.314 52.677 -42.682 1.00173.87 C
ATOM 917 C MET A 127 -44.589 53.408 -42.288 1.00173.51 C
ATOM 918 O MET A 127 -44.555 54.375 -41.528 1.00173.28 O
ATOM 919 CB MET A 127 -42.880 53.088 -44.090 1.00174.63 C
ATOM 920 CG MET A 127 -42.682 54.583 -44.273 1.00175.24 C
ATOM 921 SD MET A 127 -41.857 54.982 -45.827 1.00173.37 S
ATOM 922 CE MET A 127 -43.122 54.529 -47.008 1.00172.62 C
ATOM 923 N GLY A 128 -45.716 52.928 -42.807 1.00173.58 N
ATOM 924 CA GLY A 128 -47.016 53.477 -42.469 1.00173.98 C
ATOM 925 C GLY A 128 -47.318 53.410 -40.986 1.00173.70 C
ATOM 926 O GLY A 128 -47.954 54.308 -40.433 1.00173.88 O
ATOM 927 N ARG A 129 -46.864 52.340 -40.341 1.00173.56 N
ATOM 928 CA ARG A 129 -47.068 52.175 -38.909 1.00174.02 C
ATOM 929 C ARG A 129 -46.186 53.132 -38.114 1.00174.05 C
ATOM 930 O ARG A 129 -46.590 53.629 -37.062 1.00174.16 O
ATOM 931 CB ARG A 129 -46.801 50.731 -38.484 1.00174.01 C
ATOM 932 CG ARG A 129 -47.670 50.279 -37.321 1.00173.86 C
ATOM 933 CD ARG A 129 -47.428 48.825 -36.957 1.00173.95 C
ATOM 934 NE ARG A 129 -46.057 48.576 -36.522 1.00173.50 N
ATOM 935 CZ ARG A 129 -45.717 47.635 -35.648 1.00173.50 C
ATOM 936 NH1 ARG A 129 -46.650 46.861 -35.113 1.00173.77 N
ATOM 937 NH2 ARG A 129 -44.448 47.465 -35.308 1.00173.28 N
ATOM 938 N GLN A 130 -44.983 53.391 -38.618 1.00173.76 N
ATOM 939 CA GLN A 130 -44.081 54.351 -37.985 1.00173.74 C
ATOM 940 C GLN A 130 -44.651 55.769 -37.980 1.00173.85 C
ATOM 941 O GLN A 130 -44.131 56.649 -37.295 1.00173.69 O
ATOM 942 CB GLN A 130 -42.720 54.343 -38.681 1.00173.82 C
ATOM 943 CG GLN A 130 -41.946 53.057 -38.487 1.00173.95 C
ATOM 944 CD GLN A 130 -40.456 53.248 -38.653 1.00174.73 C
ATOM 945 OE1 GLN A 130 -40.005 53.933 -39.569 1.00174.71 O
ATOM 946 NE2 GLN A 130 -39.680 52.641 -37.763 1.00174.92 N
ATOM 947 N TRP A 131 -45.715 55.988 -38.746 1.00173.83 N
ATOM 948 CA TRP A 131 -46.453 57.242 -38.679 1.00173.71 C
ATOM 949 C TRP A 131 -47.560 57.125 -37.643 1.00173.58 C
ATOM 950 O TRP A 131 -47.714 57.989 -36.778 1.00173.85 O
ATOM 951 CB TRP A 131 -47.061 57.623 -40.034 1.00173.85 C
ATOM 952 CG TRP A 131 -48.233 58.542 -39.859 1.00174.25 C
ATOM 953 CD1 TRP A 131 -48.192 59.891 -39.655 1.00175.03 C
ATOM 954 CD2 TRP A 131 -49.617 58.176 -39.830 1.00174.55 C
ATOM 955 NE1 TRP A 131 -49.464 60.388 -39.509 1.00175.53 N
ATOM 956 CE2 TRP A 131 -50.360 59.353 -39.613 1.00175.43 C
ATOM 957 CE3 TRP A 131 -50.306 56.966 -39.977 1.00174.23 C
ATOM 958 CZ2 TRP A 131 -51.750 59.359 -39.535 1.00175.87 C
ATOM 959 CZ3 TRP A 131 -51.684 56.970 -39.891 1.00175.07 C
ATOM 960 CH2 TRP A 131 -52.391 58.157 -39.669 1.00175.81 C
ATOM 961 N GLU A 132 -48.333 56.050 -37.758 1.00173.26 N
ATOM 962 CA GLU A 132 -49.512 55.820 -36.931 1.00173.47 C
ATOM 963 C GLU A 132 -49.222 55.944 -35.441 1.00173.66 C
ATOM 964 O GLU A 132 -49.876 56.714 -34.744 1.00173.93 O
ATOM 965 CB GLU A 132 -50.098 54.440 -37.235 1.00173.67 C
ATOM 966 CG GLU A 132 -51.532 54.271 -36.775 1.00173.76 C
ATOM 967 CD GLU A 132 -52.147 52.970 -37.246 1.00173.56 C
ATOM 968 OE1 GLU A 132 -51.925 52.592 -38.417 1.00173.33 O
ATOM 969 OE2 GLU A 132 -52.873 52.335 -36.453 1.00173.49 O
ATOM 970 N LEU A 133 -48.237 55.192 -34.963 1.00173.61 N
ATOM 971 CA LEU A 133 -47.871 55.225 -33.552 1.00173.39 C
ATOM 972 C LEU A 133 -47.454 56.626 -33.121 1.00173.65 C
ATOM 973 O LEU A 133 -47.795 57.074 -32.029 1.00173.38 O
ATOM 974 CB LEU A 133 -46.748 54.231 -33.263 1.00173.01 C
ATOM 975 CG LEU A 133 -46.390 54.053 -31.787 1.00172.31 C
ATOM 976 CD1 LEU A 133 -47.608 53.616 -30.991 1.00172.36 C
ATOM 977 CD2 LEU A 133 -45.263 53.049 -31.636 1.00172.61 C
ATOM 978 N SER A 134 -46.725 57.316 -33.993 1.00174.11 N
ATOM 979 CA SER A 134 -46.306 58.686 -33.728 1.00173.69 C
ATOM 980 C SER A 134 -47.517 59.605 -33.618 1.00173.86 C
ATOM 981 O SER A 134 -47.509 60.567 -32.852 1.00173.74 O
ATOM 982 CB SER A 134 -45.361 59.185 -34.824 1.00173.41 C
ATOM 983 OG SER A 134 -46.084 59.715 -35.921 1.00173.60 O
ATOM 984 N TYR A 135 -48.557 59.295 -34.386 1.00174.39 N
ATOM 985 CA TYR A 135 -49.807 60.043 -34.336 1.00174.45 C
ATOM 986 C TYR A 135 -50.550 59.758 -33.033 1.00174.42 C
ATOM 987 O TYR A 135 -50.990 60.680 -32.345 1.00174.54 O
ATOM 988 CB TYR A 135 -50.687 59.701 -35.543 1.00174.61 C
ATOM 989 CG TYR A 135 -51.927 60.558 -35.674 1.00175.43 C
ATOM 990 CD1 TYR A 135 -51.834 61.939 -35.792 1.00175.28 C
ATOM 991 CD2 TYR A 135 -53.193 59.985 -35.681 1.00175.58 C
ATOM 992 CE1 TYR A 135 -52.969 62.724 -35.910 1.00175.46 C
ATOM 993 CE2 TYR A 135 -54.330 60.760 -35.798 1.00175.13 C
ATOM 994 CZ TYR A 135 -54.213 62.128 -35.913 1.00175.18 C
ATOM 995 OH TYR A 135 -55.350 62.895 -36.029 1.00174.38 O
ATOM 996 N ARG A 136 -50.686 58.476 -32.699 1.00174.04 N
ATOM 997 CA ARG A 136 -51.359 58.068 -31.467 1.00173.95 C
ATOM 998 C ARG A 136 -50.645 58.563 -30.206 1.00174.08 C
ATOM 999 O ARG A 136 -51.254 58.647 -29.141 1.00174.80 O
ATOM 1000 CB ARG A 136 -51.490 56.543 -31.406 1.00173.58 C
ATOM 1001 CG ARG A 136 -51.982 55.881 -32.679 1.00173.62 C
ATOM 1002 CD ARG A 136 -53.376 56.345 -33.069 1.00174.22 C
ATOM 1003 NE ARG A 136 -53.951 55.491 -34.105 1.00174.63 N
ATOM 1004 CZ ARG A 136 -54.672 55.933 -35.130 1.00174.33 C
ATOM 1005 NH1 ARG A 136 -54.916 57.229 -35.266 1.00174.35 N
ATOM 1006 NH2 ARG A 136 -55.152 55.076 -36.020 1.00173.94 N
ATOM 1007 N LEU A 137 -49.361 58.888 -30.325 1.00173.58 N
ATOM 1008 CA LEU A 137 -48.577 59.307 -29.166 1.00173.83 C
ATOM 1009 C LEU A 137 -48.373 60.818 -29.128 1.00174.46 C
ATOM 1010 O LEU A 137 -47.701 61.340 -28.237 1.00174.66 O
ATOM 1011 CB LEU A 137 -47.220 58.600 -29.146 1.00173.82 C
ATOM 1012 CG LEU A 137 -47.239 57.086 -28.926 1.00174.53 C
ATOM 1013 CD1 LEU A 137 -45.826 56.551 -28.770 1.00174.63 C
ATOM 1014 CD2 LEU A 137 -48.081 56.738 -27.713 1.00174.43 C
ATOM 1015 N GLY A 138 -48.946 61.512 -30.105 1.00174.71 N
ATOM 1016 CA GLY A 138 -48.910 62.962 -30.135 1.00174.81 C
ATOM 1017 C GLY A 138 -47.555 63.550 -30.472 1.00174.34 C
ATOM 1018 O GLY A 138 -47.318 64.739 -30.257 1.00173.74 O
ATOM 1019 N MET A 139 -46.659 62.721 -30.997 1.00174.55 N
ATOM 1020 CA MET A 139 -45.347 63.197 -31.414 1.00174.29 C
ATOM 1021 C MET A 139 -45.323 63.469 -32.910 1.00174.30 C
ATOM 1022 O MET A 139 -46.165 62.971 -33.658 1.00174.53 O
ATOM 1023 CB MET A 139 -44.262 62.189 -31.048 1.00174.23 C
ATOM 1024 CG MET A 139 -44.605 60.761 -31.403 1.00174.07 C
ATOM 1025 SD MET A 139 -43.278 59.627 -30.975 1.00173.95 S
ATOM 1026 CE MET A 139 -42.327 59.644 -32.490 1.00173.53 C
ATOM 1027 N ARG A 140 -44.348 64.262 -33.337 1.00174.07 N
ATOM 1028 CA ARG A 140 -44.201 64.637 -34.737 1.00173.56 C
ATOM 1029 C ARG A 140 -43.936 63.415 -35.616 1.00173.67 C
ATOM 1030 O ARG A 140 -43.325 62.448 -35.165 1.00174.15 O
ATOM 1031 CB ARG A 140 -43.072 65.659 -34.876 1.00173.38 C
ATOM 1032 CG ARG A 140 -43.018 66.640 -33.716 1.00173.87 C
ATOM 1033 CD ARG A 140 -41.898 67.646 -33.879 1.00174.07 C
ATOM 1034 NE ARG A 140 -42.136 68.538 -35.006 1.00174.03 N
ATOM 1035 CZ ARG A 140 -41.210 69.319 -35.549 1.00174.31 C
ATOM 1036 NH1 ARG A 140 -39.972 69.319 -35.071 1.00174.62 N
ATOM 1037 NH2 ARG A 140 -41.521 70.099 -36.574 1.00174.16 N
ATOM 1038 N PRO A 141 -44.406 63.454 -36.873 1.00173.81 N
ATOM 1039 CA PRO A 141 -44.242 62.348 -37.823 1.00174.06 C
ATOM 1040 C PRO A 141 -42.816 62.239 -38.358 1.00174.37 C
ATOM 1041 O PRO A 141 -41.871 62.196 -37.577 1.00174.43 O
ATOM 1042 CB PRO A 141 -45.212 62.719 -38.944 1.00173.90 C
ATOM 1043 CG PRO A 141 -45.197 64.208 -38.931 1.00174.10 C
ATOM 1044 CD PRO A 141 -45.170 64.564 -37.469 1.00173.69 C
ATOM 1045 N TRP A 142 -42.680 62.159 -39.680 1.00174.42 N
ATOM 1046 CA TRP A 142 -41.389 62.265 -40.370 1.00174.61 C
ATOM 1047 C TRP A 142 -40.310 61.251 -39.966 1.00174.35 C
ATOM 1048 O TRP A 142 -39.271 61.170 -40.619 1.00174.31 O
ATOM 1049 CB TRP A 142 -40.825 63.677 -40.194 1.00174.32 C
ATOM 1050 CG TRP A 142 -41.730 64.744 -40.717 1.00173.91 C
ATOM 1051 CD1 TRP A 142 -42.671 64.612 -41.696 1.00173.29 C
ATOM 1052 CD2 TRP A 142 -41.780 66.111 -40.294 1.00174.07 C
ATOM 1053 NE1 TRP A 142 -43.306 65.811 -41.907 1.00173.39 N
ATOM 1054 CE2 TRP A 142 -42.777 66.748 -41.059 1.00174.18 C
ATOM 1055 CE3 TRP A 142 -41.079 66.857 -39.341 1.00173.74 C
ATOM 1056 CZ2 TRP A 142 -43.090 68.096 -40.901 1.00174.36 C
ATOM 1057 CZ3 TRP A 142 -41.392 68.196 -39.186 1.00173.86 C
ATOM 1058 CH2 TRP A 142 -42.388 68.801 -39.962 1.00174.07 C
ATOM 1059 N ILE A 143 -40.531 60.499 -38.893 1.00174.19 N
ATOM 1060 CA ILE A 143 -39.625 59.408 -38.556 1.00174.47 C
ATOM 1061 C ILE A 143 -39.709 58.357 -39.659 1.00174.54 C
ATOM 1062 O ILE A 143 -38.693 57.822 -40.110 1.00174.01 O
ATOM 1063 CB ILE A 143 -39.955 58.789 -37.181 1.00173.92 C
ATOM 1064 CG1 ILE A 143 -39.340 59.631 -36.062 1.00173.05 C
ATOM 1065 CG2 ILE A 143 -39.445 57.360 -37.090 1.00173.93 C
ATOM 1066 CD1 ILE A 143 -39.469 59.013 -34.688 1.00173.03 C
ATOM 1067 N CYS A 144 -40.933 58.087 -40.100 1.00174.66 N
ATOM 1068 CA CYS A 144 -41.182 57.197 -41.227 1.00173.86 C
ATOM 1069 C CYS A 144 -40.536 57.715 -42.509 1.00173.30 C
ATOM 1070 O CYS A 144 -40.215 56.940 -43.407 1.00173.65 O
ATOM 1071 CB CYS A 144 -42.688 57.021 -41.435 1.00174.58 C
ATOM 1072 SG CYS A 144 -43.524 58.493 -42.069 1.00176.56 S
ATOM 1073 N VAL A 145 -40.346 59.029 -42.583 1.00173.13 N
ATOM 1074 CA VAL A 145 -39.761 59.655 -43.763 1.00173.44 C
ATOM 1075 C VAL A 145 -38.277 59.301 -43.835 1.00173.94 C
ATOM 1076 O VAL A 145 -37.708 59.148 -44.918 1.00174.75 O
ATOM 1077 CB VAL A 145 -39.957 61.193 -43.739 1.00173.28 C
ATOM 1078 CG1 VAL A 145 -38.999 61.890 -44.690 1.00173.02 C
ATOM 1079 CG2 VAL A 145 -41.394 61.545 -44.084 1.00173.10 C
ATOM 1080 N ALA A 146 -37.662 59.130 -42.670 1.00173.20 N
ATOM 1081 CA ALA A 146 -36.270 58.709 -42.602 1.00173.38 C
ATOM 1082 C ALA A 146 -36.144 57.245 -43.013 1.00173.57 C
ATOM 1083 O ALA A 146 -35.167 56.849 -43.649 1.00173.81 O
ATOM 1084 CB ALA A 146 -35.716 58.922 -41.205 1.00173.17 C
ATOM 1085 N TYR A 147 -37.142 56.448 -42.643 1.00173.46 N
ATOM 1086 CA TYR A 147 -37.184 55.034 -43.006 1.00173.77 C
ATOM 1087 C TYR A 147 -37.535 54.832 -44.483 1.00174.22 C
ATOM 1088 O TYR A 147 -37.432 53.725 -45.012 1.00174.21 O
ATOM 1089 CB TYR A 147 -38.186 54.297 -42.114 1.00173.61 C
ATOM 1090 CG TYR A 147 -38.381 52.839 -42.459 1.00173.29 C
ATOM 1091 CD1 TYR A 147 -37.386 51.906 -42.205 1.00173.32 C
ATOM 1092 CD2 TYR A 147 -39.563 52.395 -43.036 1.00173.34 C
ATOM 1093 CE1 TYR A 147 -37.561 50.573 -42.518 1.00173.74 C
ATOM 1094 CE2 TYR A 147 -39.749 51.065 -43.353 1.00173.49 C
ATOM 1095 CZ TYR A 147 -38.745 50.157 -43.092 1.00174.05 C
ATOM 1096 OH TYR A 147 -38.928 48.830 -43.406 1.00175.07 O
ATOM 1097 N SER A 148 -37.940 55.908 -45.150 1.00173.93 N
ATOM 1098 CA SER A 148 -38.306 55.831 -46.559 1.00172.98 C
ATOM 1099 C SER A 148 -37.082 55.603 -47.437 1.00172.70 C
ATOM 1100 O SER A 148 -37.197 55.100 -48.550 1.00172.52 O
ATOM 1101 CB SER A 148 -39.029 57.103 -46.998 1.00173.16 C
ATOM 1102 OG SER A 148 -38.106 58.148 -47.254 1.00173.38 O
ATOM 1103 N ALA A 149 -35.912 55.974 -46.928 1.00172.82 N
ATOM 1104 CA ALA A 149 -34.670 55.815 -47.677 1.00173.16 C
ATOM 1105 C ALA A 149 -34.194 54.352 -47.744 1.00173.99 C
ATOM 1106 O ALA A 149 -33.905 53.862 -48.835 1.00173.83 O
ATOM 1107 CB ALA A 149 -33.576 56.715 -47.092 1.00173.31 C
ATOM 1108 N PRO A 150 -34.102 53.646 -46.593 1.00174.74 N
ATOM 1109 CA PRO A 150 -33.725 52.232 -46.730 1.00174.50 C
ATOM 1110 C PRO A 150 -34.794 51.410 -47.450 1.00174.27 C
ATOM 1111 O PRO A 150 -34.470 50.427 -48.115 1.00174.39 O
ATOM 1112 CB PRO A 150 -33.564 51.765 -45.279 1.00174.32 C
ATOM 1113 CG PRO A 150 -34.395 52.702 -44.485 1.00174.23 C
ATOM 1114 CD PRO A 150 -34.253 54.025 -45.175 1.00174.70 C
ATOM 1115 N LEU A 151 -36.053 51.812 -47.304 1.00174.13 N
ATOM 1116 CA LEU A 151 -37.164 51.130 -47.958 1.00174.04 C
ATOM 1117 C LEU A 151 -37.114 51.313 -49.472 1.00174.15 C
ATOM 1118 O LEU A 151 -37.310 50.358 -50.228 1.00174.08 O
ATOM 1119 CB LEU A 151 -38.499 51.634 -47.410 1.00173.60 C
ATOM 1120 CG LEU A 151 -39.752 51.000 -48.014 1.00173.77 C
ATOM 1121 CD1 LEU A 151 -39.702 49.488 -47.874 1.00174.06 C
ATOM 1122 CD2 LEU A 151 -41.001 51.556 -47.355 1.00173.57 C
ATOM 1123 N ALA A 152 -36.854 52.543 -49.908 1.00174.23 N
ATOM 1124 CA ALA A 152 -36.758 52.853 -51.332 1.00173.89 C
ATOM 1125 C ALA A 152 -35.602 52.117 -52.002 1.00173.54 C
ATOM 1126 O ALA A 152 -35.576 51.970 -53.222 1.00173.03 O
ATOM 1127 CB ALA A 152 -36.605 54.345 -51.534 1.00173.65 C
ATOM 1128 N SER A 153 -34.655 51.649 -51.198 1.00173.82 N
ATOM 1129 CA SER A 153 -33.514 50.909 -51.715 1.00173.88 C
ATOM 1130 C SER A 153 -33.914 49.462 -51.961 1.00173.89 C
ATOM 1131 O SER A 153 -33.616 48.895 -53.013 1.00174.22 O
ATOM 1132 CB SER A 153 -32.334 50.987 -50.745 1.00174.18 C
ATOM 1133 OG SER A 153 -31.942 52.332 -50.522 1.00174.43 O
ATOM 1134 N ALA A 154 -34.590 48.873 -50.978 1.00173.68 N
ATOM 1135 CA ALA A 154 -35.166 47.543 -51.124 1.00173.98 C
ATOM 1136 C ALA A 154 -36.100 47.495 -52.329 1.00174.04 C
ATOM 1137 O ALA A 154 -36.084 46.537 -53.099 1.00174.47 O
ATOM 1138 CB ALA A 154 -35.907 47.144 -49.858 1.00174.01 C
ATOM 1139 N PHE A 155 -36.913 48.536 -52.482 1.00173.18 N
ATOM 1140 CA PHE A 155 -37.817 48.646 -53.620 1.00173.08 C
ATOM 1141 C PHE A 155 -37.047 48.688 -54.934 1.00173.68 C
ATOM 1142 O PHE A 155 -37.393 47.996 -55.892 1.00173.73 O
ATOM 1143 CB PHE A 155 -38.693 49.891 -53.491 1.00172.47 C
ATOM 1144 CG PHE A 155 -40.069 49.607 -52.970 1.00172.31 C
ATOM 1145 CD1 PHE A 155 -41.096 49.279 -53.838 1.00173.40 C
ATOM 1146 CD2 PHE A 155 -40.337 49.667 -51.614 1.00172.68 C
ATOM 1147 CE1 PHE A 155 -42.366 49.013 -53.364 1.00173.58 C
ATOM 1148 CE2 PHE A 155 -41.604 49.404 -51.134 1.00173.71 C
ATOM 1149 CZ PHE A 155 -42.620 49.076 -52.010 1.00173.81 C
ATOM 1150 N ALA A 156 -36.004 49.510 -54.967 1.00174.03 N
ATOM 1151 CA ALA A 156 -35.168 49.659 -56.151 1.00174.28 C
ATOM 1152 C ALA A 156 -34.468 48.354 -56.508 1.00173.52 C
ATOM 1153 O ALA A 156 -34.353 47.997 -57.680 1.00173.78 O
ATOM 1154 CB ALA A 156 -34.144 50.764 -55.937 1.00174.25 C
ATOM 1155 N VAL A 157 -34.000 47.648 -55.487 1.00172.64 N
ATOM 1156 CA VAL A 157 -33.226 46.431 -55.681 1.00172.17 C
ATOM 1157 C VAL A 157 -34.106 45.203 -55.948 1.00172.75 C
ATOM 1158 O VAL A 157 -33.699 44.290 -56.668 1.00173.66 O
ATOM 1159 CB VAL A 157 -32.301 46.185 -54.458 1.00172.58 C
ATOM 1160 CG1 VAL A 157 -32.431 44.767 -53.922 1.00172.83 C
ATOM 1161 CG2 VAL A 157 -30.858 46.512 -54.812 1.00172.93 C
ATOM 1162 N PHE A 158 -35.319 45.193 -55.401 1.00173.02 N
ATOM 1163 CA PHE A 158 -36.192 44.024 -55.524 1.00173.55 C
ATOM 1164 C PHE A 158 -37.313 44.175 -56.547 1.00173.13 C
ATOM 1165 O PHE A 158 -37.896 43.182 -56.979 1.00172.56 O
ATOM 1166 CB PHE A 158 -36.815 43.676 -54.170 1.00173.25 C
ATOM 1167 CG PHE A 158 -35.843 43.111 -53.182 1.00172.91 C
ATOM 1168 CD1 PHE A 158 -34.851 42.236 -53.590 1.00173.56 C
ATOM 1169 CD2 PHE A 158 -35.928 43.443 -51.842 1.00173.42 C
ATOM 1170 CE1 PHE A 158 -33.953 41.712 -52.680 1.00174.69 C
ATOM 1171 CE2 PHE A 158 -35.038 42.921 -50.927 1.00174.62 C
ATOM 1172 CZ PHE A 158 -34.048 42.055 -51.345 1.00175.50 C
ATOM 1173 N LEU A 159 -37.626 45.406 -56.933 1.00172.40 N
ATOM 1174 CA LEU A 159 -38.787 45.623 -57.786 1.00171.91 C
ATOM 1175 C LEU A 159 -38.507 46.523 -58.984 1.00172.87 C
ATOM 1176 O LEU A 159 -38.813 46.161 -60.117 1.00173.91 O
ATOM 1177 CB LEU A 159 -39.936 46.208 -56.964 1.00171.99 C
ATOM 1178 CG LEU A 159 -41.162 46.614 -57.780 1.00173.02 C
ATOM 1179 CD1 LEU A 159 -41.907 45.380 -58.260 1.00173.02 C
ATOM 1180 CD2 LEU A 159 -42.074 47.519 -56.971 1.00174.56 C
ATOM 1181 N ILE A 160 -37.917 47.686 -58.736 1.00172.69 N
ATOM 1182 CA ILE A 160 -37.689 48.663 -59.796 1.00173.18 C
ATOM 1183 C ILE A 160 -36.716 48.156 -60.862 1.00173.67 C
ATOM 1184 O ILE A 160 -37.012 48.214 -62.056 1.00173.80 O
ATOM 1185 CB ILE A 160 -37.167 49.989 -59.223 1.00172.93 C
ATOM 1186 CG1 ILE A 160 -38.121 50.507 -58.146 1.00172.80 C
ATOM 1187 CG2 ILE A 160 -36.995 51.017 -60.329 1.00173.06 C
ATOM 1188 CD1 ILE A 160 -39.553 50.644 -58.615 1.00172.70 C
ATOM 1189 N TYR A 161 -35.558 47.663 -60.432 1.00173.65 N
ATOM 1190 CA TYR A 161 -34.572 47.115 -61.364 1.00173.38 C
ATOM 1191 C TYR A 161 -35.104 45.919 -62.174 1.00173.06 C
ATOM 1192 O TYR A 161 -34.859 45.847 -63.377 1.00173.43 O
ATOM 1193 CB TYR A 161 -33.289 46.725 -60.620 1.00173.71 C
ATOM 1194 CG TYR A 161 -32.117 46.432 -61.532 1.00173.69 C
ATOM 1195 CD1 TYR A 161 -31.613 47.408 -62.381 1.00173.84 C
ATOM 1196 CD2 TYR A 161 -31.507 45.184 -61.536 1.00173.63 C
ATOM 1197 CE1 TYR A 161 -30.541 47.147 -63.216 1.00173.81 C
ATOM 1198 CE2 TYR A 161 -30.434 44.914 -62.366 1.00173.90 C
ATOM 1199 CZ TYR A 161 -29.955 45.899 -63.202 1.00173.64 C
ATOM 1200 OH TYR A 161 -28.888 45.631 -64.027 1.00173.21 O
ATOM 1201 N PRO A 162 -35.824 44.976 -61.530 1.00172.79 N
ATOM 1202 CA PRO A 162 -36.420 43.914 -62.348 1.00173.16 C
ATOM 1203 C PRO A 162 -37.428 44.419 -63.380 1.00173.07 C
ATOM 1204 O PRO A 162 -37.430 43.927 -64.509 1.00172.95 O
ATOM 1205 CB PRO A 162 -37.111 43.032 -61.309 1.00173.54 C
ATOM 1206 CG PRO A 162 -36.272 43.186 -60.105 1.00173.46 C
ATOM 1207 CD PRO A 162 -35.914 44.645 -60.095 1.00173.34 C
ATOM 1208 N ILE A 163 -38.276 45.368 -62.995 1.00173.03 N
ATOM 1209 CA ILE A 163 -39.232 45.963 -63.923 1.00172.84 C
ATOM 1210 C ILE A 163 -38.518 46.574 -65.125 1.00173.25 C
ATOM 1211 O ILE A 163 -38.866 46.298 -66.273 1.00173.22 O
ATOM 1212 CB ILE A 163 -40.086 47.051 -63.240 1.00173.00 C
ATOM 1213 CG1 ILE A 163 -41.071 46.424 -62.253 1.00173.45 C
ATOM 1214 CG2 ILE A 163 -40.847 47.861 -64.277 1.00173.28 C
ATOM 1215 CD1 ILE A 163 -41.784 47.440 -61.388 1.00173.97 C
ATOM 1216 N GLY A 164 -37.514 47.401 -64.848 1.00173.37 N
ATOM 1217 CA GLY A 164 -36.730 48.037 -65.891 1.00173.48 C
ATOM 1218 C GLY A 164 -36.026 47.049 -66.801 1.00172.90 C
ATOM 1219 O GLY A 164 -36.068 47.180 -68.025 1.00172.26 O
ATOM 1220 N GLN A 165 -35.376 46.057 -66.203 1.00173.31 N
ATOM 1221 CA GLN A 165 -34.622 45.073 -66.970 1.00173.69 C
ATOM 1222 C GLN A 165 -35.542 44.027 -67.593 1.00173.88 C
ATOM 1223 O GLN A 165 -35.116 43.242 -68.441 1.00174.11 O
ATOM 1224 CB GLN A 165 -33.573 44.395 -66.088 1.00174.05 C
ATOM 1225 CG GLN A 165 -32.477 45.329 -65.605 1.00173.68 C
ATOM 1226 CD GLN A 165 -31.682 45.932 -66.745 1.00173.12 C
ATOM 1227 OE1 GLN A 165 -31.804 47.120 -67.042 1.00173.14 O
ATOM 1228 NE2 GLN A 165 -30.862 45.112 -67.393 1.00172.71 N
ATOM 1229 N GLY A 166 -36.801 44.014 -67.169 1.00173.44 N
ATOM 1230 CA GLY A 166 -37.794 43.148 -67.778 1.00174.00 C
ATOM 1231 C GLY A 166 -37.909 41.747 -67.204 1.00173.73 C
ATOM 1232 O GLY A 166 -38.585 40.898 -67.784 1.00174.09 O
ATOM 1233 N SER A 167 -37.260 41.496 -66.071 1.00173.74 N
ATOM 1234 CA SER A 167 -37.323 40.177 -65.443 1.00174.18 C
ATOM 1235 C SER A 167 -36.936 40.215 -63.967 1.00174.09 C
ATOM 1236 O SER A 167 -36.035 40.952 -63.568 1.00174.28 O
ATOM 1237 CB SER A 167 -36.420 39.191 -66.190 1.00173.90 C
ATOM 1238 OG SER A 167 -36.172 38.031 -65.414 1.00174.22 O
ATOM 1239 N PHE A 168 -37.616 39.404 -63.162 1.00173.42 N
ATOM 1240 CA PHE A 168 -37.321 39.315 -61.736 1.00172.80 C
ATOM 1241 C PHE A 168 -36.065 38.492 -61.487 1.00172.77 C
ATOM 1242 O PHE A 168 -35.536 38.472 -60.378 1.00173.43 O
ATOM 1243 CB PHE A 168 -38.499 38.708 -60.972 1.00173.06 C
ATOM 1244 CG PHE A 168 -39.638 39.662 -60.756 1.00174.61 C
ATOM 1245 CD1 PHE A 168 -40.791 39.576 -61.520 1.00174.65 C
ATOM 1246 CD2 PHE A 168 -39.551 40.656 -59.794 1.00175.43 C
ATOM 1247 CE1 PHE A 168 -41.838 40.459 -61.323 1.00175.04 C
ATOM 1248 CE2 PHE A 168 -40.593 41.541 -59.592 1.00175.15 C
ATOM 1249 CZ PHE A 168 -41.737 41.444 -60.357 1.00174.98 C
ATOM 1250 N SER A 169 -35.589 37.812 -62.525 1.00172.92 N
ATOM 1251 CA SER A 169 -34.392 36.990 -62.410 1.00173.15 C
ATOM 1252 C SER A 169 -33.159 37.862 -62.209 1.00172.31 C
ATOM 1253 O SER A 169 -32.115 37.389 -61.776 1.00172.29 O
ATOM 1254 CB SER A 169 -34.217 36.110 -63.647 1.00174.37 C
ATOM 1255 OG SER A 169 -33.856 36.873 -64.784 1.00175.12 O
ATOM 1256 N ASP A 170 -33.288 39.140 -62.535 1.00171.62 N
ATOM 1257 CA ASP A 170 -32.190 40.082 -62.419 1.00171.82 C
ATOM 1258 C ASP A 170 -32.302 40.912 -61.149 1.00172.46 C
ATOM 1259 O ASP A 170 -31.524 41.836 -60.931 1.00172.97 O
ATOM 1260 CB ASP A 170 -32.153 40.981 -63.656 1.00173.93 C
ATOM 1261 CG ASP A 170 -31.126 40.518 -64.674 1.00174.33 C
ATOM 1262 OD1 ASP A 170 -31.477 40.406 -65.871 1.00175.48 O
ATOM 1263 OD2 ASP A 170 -29.984 40.212 -64.261 1.00173.48 O
ATOM 1264 N GLY A 171 -33.272 40.577 -60.308 1.00172.91 N
ATOM 1265 CA GLY A 171 -33.382 41.234 -59.025 1.00173.88 C
ATOM 1266 C GLY A 171 -32.341 40.629 -58.099 1.00173.88 C
ATOM 1267 O GLY A 171 -31.870 39.507 -58.322 1.00173.97 O
ATOM 1268 N MET A 172 -31.955 41.376 -57.071 1.00173.51 N
ATOM 1269 CA MET A 172 -30.919 40.917 -56.153 1.00172.90 C
ATOM 1270 C MET A 172 -31.380 39.678 -55.405 1.00172.46 C
ATOM 1271 O MET A 172 -32.463 39.669 -54.824 1.00173.42 O
ATOM 1272 CB MET A 172 -30.543 42.014 -55.158 1.00172.93 C
ATOM 1273 CG MET A 172 -29.487 41.592 -54.149 1.00172.33 C
ATOM 1274 SD MET A 172 -29.176 42.865 -52.913 1.00168.61 S
ATOM 1275 CE MET A 172 -30.326 42.394 -51.625 1.00173.60 C
ATOM 1276 N PRO A 173 -30.558 38.622 -55.428 1.00171.93 N
ATOM 1277 CA PRO A 173 -30.843 37.376 -54.716 1.00172.90 C
ATOM 1278 C PRO A 173 -30.928 37.595 -53.211 1.00172.84 C
ATOM 1279 O PRO A 173 -30.425 38.597 -52.703 1.00172.49 O
ATOM 1280 CB PRO A 173 -29.647 36.490 -55.076 1.00173.44 C
ATOM 1281 CG PRO A 173 -29.161 37.038 -56.377 1.00172.68 C
ATOM 1282 CD PRO A 173 -29.335 38.515 -56.239 1.00172.66 C
ATOM 1283 N LEU A 174 -31.549 36.656 -52.509 1.00172.55 N
ATOM 1284 CA LEU A 174 -31.705 36.763 -51.067 1.00172.28 C
ATOM 1285 C LEU A 174 -30.616 35.979 -50.350 1.00172.67 C
ATOM 1286 O LEU A 174 -30.871 34.911 -49.794 1.00172.43 O
ATOM 1287 CB LEU A 174 -33.086 36.264 -50.642 1.00172.99 C
ATOM 1288 CG LEU A 174 -34.282 36.933 -51.321 1.00173.21 C
ATOM 1289 CD1 LEU A 174 -35.587 36.446 -50.713 1.00174.45 C
ATOM 1290 CD2 LEU A 174 -34.175 38.444 -51.221 1.00173.61 C
ATOM 1291 N GLY A 175 -29.400 36.513 -50.371 1.00172.93 N
ATOM 1292 CA GLY A 175 -28.275 35.858 -49.732 1.00172.96 C
ATOM 1293 C GLY A 175 -27.004 36.680 -49.775 1.00173.36 C
ATOM 1294 O GLY A 175 -26.906 37.654 -50.522 1.00173.58 O
ATOM 1295 N ILE A 176 -26.034 36.286 -48.958 1.00173.32 N
ATOM 1296 CA ILE A 176 -24.755 36.982 -48.870 1.00174.03 C
ATOM 1297 C ILE A 176 -24.010 37.005 -50.205 1.00173.81 C
ATOM 1298 O ILE A 176 -23.865 38.058 -50.824 1.00173.70 O
ATOM 1299 CB ILE A 176 -23.850 36.340 -47.803 1.00174.04 C
ATOM 1300 CG1 ILE A 176 -24.630 36.116 -46.505 1.00172.72 C
ATOM 1301 CG2 ILE A 176 -22.627 37.202 -47.554 1.00174.80 C
ATOM 1302 CD1 ILE A 176 -25.078 37.395 -45.837 1.00172.93 C
ATOM 1303 N SER A 177 -23.533 35.840 -50.635 1.00173.19 N
ATOM 1304 CA SER A 177 -22.794 35.724 -51.888 1.00172.80 C
ATOM 1305 C SER A 177 -23.639 36.134 -53.090 1.00173.88 C
ATOM 1306 O SER A 177 -23.124 36.692 -54.059 1.00174.29 O
ATOM 1307 CB SER A 177 -22.280 34.297 -52.074 1.00172.62 C
ATOM 1308 OG SER A 177 -21.338 33.962 -51.070 1.00172.40 O
ATOM 1309 N GLY A 178 -24.937 35.851 -53.021 1.00174.28 N
ATOM 1310 CA GLY A 178 -25.861 36.239 -54.072 1.00174.25 C
ATOM 1311 C GLY A 178 -25.941 37.745 -54.238 1.00174.58 C
ATOM 1312 O GLY A 178 -26.180 38.247 -55.336 1.00175.15 O
ATOM 1313 N THR A 179 -25.736 38.465 -53.139 1.00174.15 N
ATOM 1314 CA THR A 179 -25.741 39.922 -53.160 1.00173.60 C
ATOM 1315 C THR A 179 -24.469 40.434 -53.828 1.00173.68 C
ATOM 1316 O THR A 179 -24.498 41.412 -54.578 1.00173.76 O
ATOM 1317 CB THR A 179 -25.862 40.509 -51.739 1.00172.91 C
ATOM 1318 OG1 THR A 179 -27.083 40.058 -51.138 1.00171.95 O
ATOM 1319 CG2 THR A 179 -25.857 42.028 -51.778 1.00173.67 C
ATOM 1320 N PHE A 180 -23.353 39.764 -53.554 1.00173.35 N
ATOM 1321 CA PHE A 180 -22.081 40.110 -54.177 1.00173.61 C
ATOM 1322 C PHE A 180 -22.157 39.954 -55.692 1.00173.32 C
ATOM 1323 O PHE A 180 -21.604 40.762 -56.436 1.00173.35 O
ATOM 1324 CB PHE A 180 -20.949 39.242 -53.625 1.00174.03 C
ATOM 1325 CG PHE A 180 -20.780 39.332 -52.137 1.00173.05 C
ATOM 1326 CD1 PHE A 180 -21.080 40.500 -51.460 1.00173.33 C
ATOM 1327 CD2 PHE A 180 -20.310 38.247 -51.417 1.00172.61 C
ATOM 1328 CE1 PHE A 180 -20.921 40.584 -50.091 1.00174.74 C
ATOM 1329 CE2 PHE A 180 -20.148 38.324 -50.049 1.00173.80 C
ATOM 1330 CZ PHE A 180 -20.455 39.495 -49.385 1.00175.01 C
ATOM 1331 N ASN A 181 -22.855 38.915 -56.140 1.00173.22 N
ATOM 1332 CA ASN A 181 -23.043 38.671 -57.564 1.00173.10 C
ATOM 1333 C ASN A 181 -23.810 39.811 -58.215 1.00172.89 C
ATOM 1334 O ASN A 181 -23.445 40.279 -59.291 1.00173.14 O
ATOM 1335 CB ASN A 181 -23.774 37.346 -57.792 1.00173.37 C
ATOM 1336 CG ASN A 181 -23.752 36.910 -59.246 1.00172.79 C
ATOM 1337 OD1 ASN A 181 -24.497 37.435 -60.073 1.00172.17 O
ATOM 1338 ND2 ASN A 181 -22.895 35.945 -59.565 1.00172.73 N
ATOM 1339 N PHE A 182 -24.879 40.245 -57.555 1.00172.66 N
ATOM 1340 CA PHE A 182 -25.677 41.371 -58.025 1.00172.61 C
ATOM 1341 C PHE A 182 -24.834 42.625 -58.246 1.00172.78 C
ATOM 1342 O PHE A 182 -25.024 43.339 -59.227 1.00173.12 O
ATOM 1343 CB PHE A 182 -26.806 41.670 -57.038 1.00173.54 C
ATOM 1344 CG PHE A 182 -27.711 42.783 -57.477 1.00174.14 C
ATOM 1345 CD1 PHE A 182 -28.648 42.577 -58.475 1.00173.85 C
ATOM 1346 CD2 PHE A 182 -27.622 44.037 -56.895 1.00175.45 C
ATOM 1347 CE1 PHE A 182 -29.482 43.601 -58.884 1.00174.33 C
ATOM 1348 CE2 PHE A 182 -28.454 45.065 -57.300 1.00175.95 C
ATOM 1349 CZ PHE A 182 -29.385 44.846 -58.296 1.00175.03 C
ATOM 1350 N MET A 183 -23.902 42.885 -57.333 1.00172.65 N
ATOM 1351 CA MET A 183 -23.048 44.067 -57.421 1.00173.39 C
ATOM 1352 C MET A 183 -22.043 43.984 -58.562 1.00173.70 C
ATOM 1353 O MET A 183 -21.998 44.867 -59.420 1.00173.52 O
ATOM 1354 CB MET A 183 -22.304 44.289 -56.104 1.00173.50 C
ATOM 1355 CG MET A 183 -23.199 44.686 -54.957 1.00173.29 C
ATOM 1356 SD MET A 183 -22.275 45.201 -53.502 1.00171.73 S
ATOM 1357 CE MET A 183 -22.154 43.641 -52.640 1.00173.45 C
ATOM 1358 N ILE A 184 -21.232 42.929 -58.552 1.00173.54 N
ATOM 1359 CA ILE A 184 -20.189 42.734 -59.554 1.00172.65 C
ATOM 1360 C ILE A 184 -20.739 42.829 -60.973 1.00172.50 C
ATOM 1361 O ILE A 184 -20.166 43.507 -61.825 1.00172.68 O
ATOM 1362 CB ILE A 184 -19.489 41.373 -59.376 1.00172.70 C
ATOM 1363 CG1 ILE A 184 -18.893 41.261 -57.973 1.00172.49 C
ATOM 1364 CG2 ILE A 184 -18.408 41.188 -60.425 1.00173.41 C
ATOM 1365 CD1 ILE A 184 -18.065 40.013 -57.763 1.00172.93 C
ATOM 1366 N VAL A 185 -21.861 42.160 -61.215 1.00172.50 N
ATOM 1367 CA VAL A 185 -22.500 42.185 -62.525 1.00173.55 C
ATOM 1368 C VAL A 185 -23.024 43.581 -62.852 1.00173.66 C
ATOM 1369 O VAL A 185 -22.841 44.076 -63.964 1.00174.24 O
ATOM 1370 CB VAL A 185 -23.656 41.167 -62.606 1.00174.20 C
ATOM 1371 CG1 VAL A 185 -24.384 41.286 -63.935 1.00174.88 C
ATOM 1372 CG2 VAL A 185 -23.134 39.749 -62.399 1.00174.22 C
ATOM 1373 N PHE A 186 -23.683 44.202 -61.876 1.00173.37 N
ATOM 1374 CA PHE A 186 -24.172 45.574 -62.002 1.00174.05 C
ATOM 1375 C PHE A 186 -23.072 46.528 -62.458 1.00173.89 C
ATOM 1376 O PHE A 186 -23.235 47.262 -63.434 1.00174.14 O
ATOM 1377 CB PHE A 186 -24.752 46.058 -60.673 1.00173.85 C
ATOM 1378 CG PHE A 186 -25.774 47.144 -60.816 1.00173.50 C
ATOM 1379 CD1 PHE A 186 -27.120 46.833 -60.900 1.00172.82 C
ATOM 1380 CD2 PHE A 186 -25.393 48.475 -60.859 1.00173.61 C
ATOM 1381 CE1 PHE A 186 -28.066 47.828 -61.026 1.00172.83 C
ATOM 1382 CE2 PHE A 186 -26.336 49.475 -60.989 1.00173.32 C
ATOM 1383 CZ PHE A 186 -27.675 49.150 -61.073 1.00173.38 C
ATOM 1384 N GLN A 187 -21.958 46.514 -61.732 1.00173.26 N
ATOM 1385 CA GLN A 187 -20.784 47.314 -62.069 1.00173.35 C
ATOM 1386 C GLN A 187 -20.333 47.124 -63.516 1.00173.35 C
ATOM 1387 O GLN A 187 -19.939 48.075 -64.180 1.00173.27 O
ATOM 1388 CB GLN A 187 -19.632 46.975 -61.118 1.00173.26 C
ATOM 1389 CG GLN A 187 -18.288 47.569 -61.512 1.00173.20 C
ATOM 1390 CD GLN A 187 -18.333 49.076 -61.631 1.00173.64 C
ATOM 1391 OE1 GLN A 187 -18.984 49.752 -60.838 1.00173.44 O
ATOM 1392 NE2 GLN A 187 -17.639 49.613 -62.628 1.00174.59 N
ATOM 1393 N ALA A 188 -20.398 45.891 -64.002 1.00173.60 N
ATOM 1394 CA ALA A 188 -19.967 45.581 -65.361 1.00173.26 C
ATOM 1395 C ALA A 188 -20.847 46.258 -66.401 1.00173.02 C
ATOM 1396 O ALA A 188 -20.362 46.813 -67.385 1.00173.95 O
ATOM 1397 CB ALA A 188 -19.967 44.077 -65.584 1.00173.38 C
ATOM 1398 N GLU A 189 -22.150 46.193 -66.171 1.00172.58 N
ATOM 1399 CA GLU A 189 -23.133 46.623 -67.151 1.00172.98 C
ATOM 1400 C GLU A 189 -23.563 48.069 -67.020 1.00173.06 C
ATOM 1401 O GLU A 189 -24.149 48.634 -67.941 1.00173.42 O
ATOM 1402 CB GLU A 189 -24.348 45.725 -67.045 1.00173.09 C
ATOM 1403 CG GLU A 189 -23.949 44.291 -66.969 1.00173.24 C
ATOM 1404 CD GLU A 189 -25.075 43.388 -67.331 1.00173.18 C
ATOM 1405 OE1 GLU A 189 -26.178 43.595 -66.791 1.00172.70 O
ATOM 1406 OE2 GLU A 189 -24.859 42.493 -68.171 1.00173.13 O
ATOM 1407 N HIS A 190 -23.282 48.664 -65.870 1.00172.93 N
ATOM 1408 CA HIS A 190 -23.765 50.004 -65.604 1.00173.39 C
ATOM 1409 C HIS A 190 -22.647 50.937 -65.147 1.00173.99 C
ATOM 1410 O HIS A 190 -22.814 52.155 -65.159 1.00174.59 O
ATOM 1411 CB HIS A 190 -24.879 49.956 -64.557 1.00173.86 C
ATOM 1412 CG HIS A 190 -26.092 49.194 -64.998 1.00174.08 C
ATOM 1413 ND1 HIS A 190 -26.875 49.595 -66.058 1.00173.90 N
ATOM 1414 CD2 HIS A 190 -26.664 48.065 -64.514 1.00174.62 C
ATOM 1415 CE1 HIS A 190 -27.873 48.743 -66.213 1.00174.53 C
ATOM 1416 NE2 HIS A 190 -27.769 47.806 -65.288 1.00174.73 N
ATOM 1417 N ASN A 191 -21.504 50.362 -64.774 1.00173.65 N
ATOM 1418 CA ASN A 191 -20.372 51.135 -64.265 1.00173.77 C
ATOM 1419 C ASN A 191 -20.826 52.061 -63.137 1.00174.36 C
ATOM 1420 O ASN A 191 -20.698 53.283 -63.227 1.00174.66 O
ATOM 1421 CB ASN A 191 -19.715 51.930 -65.398 1.00173.10 C
ATOM 1422 CG ASN A 191 -18.346 52.462 -65.023 1.00173.14 C
ATOM 1423 OD1 ASN A 191 -17.689 51.945 -64.121 1.00173.25 O
ATOM 1424 ND2 ASN A 191 -17.909 53.504 -65.721 1.00173.20 N
ATOM 1425 N ILE A 192 -21.362 51.459 -62.079 1.00174.15 N
ATOM 1426 CA ILE A 192 -22.030 52.191 -61.005 1.00173.83 C
ATOM 1427 C ILE A 192 -21.077 53.084 -60.207 1.00173.96 C
ATOM 1428 O ILE A 192 -21.478 54.138 -59.713 1.00174.43 O
ATOM 1429 CB ILE A 192 -22.762 51.211 -60.047 1.00174.01 C
ATOM 1430 CG1 ILE A 192 -23.636 51.967 -59.046 1.00174.40 C
ATOM 1431 CG2 ILE A 192 -21.777 50.283 -59.343 1.00174.33 C
ATOM 1432 CD1 ILE A 192 -24.534 51.068 -58.233 1.00174.25 C
ATOM 1433 N LEU A 193 -19.820 52.668 -60.083 1.00173.39 N
ATOM 1434 CA LEU A 193 -18.821 53.459 -59.372 1.00172.79 C
ATOM 1435 C LEU A 193 -18.606 54.826 -60.017 1.00172.90 C
ATOM 1436 O LEU A 193 -18.217 55.780 -59.349 1.00172.94 O
ATOM 1437 CB LEU A 193 -17.496 52.704 -59.302 1.00172.53 C
ATOM 1438 CG LEU A 193 -17.519 51.449 -58.429 1.00173.31 C
ATOM 1439 CD1 LEU A 193 -16.182 50.724 -58.482 1.00174.16 C
ATOM 1440 CD2 LEU A 193 -17.887 51.805 -56.998 1.00173.79 C
ATOM 1441 N MET A 194 -18.867 54.918 -61.316 1.00173.18 N
ATOM 1442 CA MET A 194 -18.689 56.169 -62.042 1.00173.46 C
ATOM 1443 C MET A 194 -20.013 56.906 -62.210 1.00174.06 C
ATOM 1444 O MET A 194 -20.186 57.676 -63.154 1.00174.71 O
ATOM 1445 CB MET A 194 -18.062 55.912 -63.413 1.00173.54 C
ATOM 1446 CG MET A 194 -16.616 55.456 -63.360 1.00173.43 C
ATOM 1447 SD MET A 194 -15.538 56.719 -62.663 1.00173.36 S
ATOM 1448 CE MET A 194 -15.066 57.615 -64.138 1.00173.80 C
ATOM 1449 N HIS A 195 -20.943 56.669 -61.291 1.00173.84 N
ATOM 1450 CA HIS A 195 -22.246 57.326 -61.325 1.00173.71 C
ATOM 1451 C HIS A 195 -22.431 58.205 -60.090 1.00173.68 C
ATOM 1452 O HIS A 195 -22.214 57.751 -58.967 1.00174.12 O
ATOM 1453 CB HIS A 195 -23.369 56.288 -61.419 1.00173.23 C
ATOM 1454 CG HIS A 195 -24.703 56.865 -61.783 1.00172.96 C
ATOM 1455 ND1 HIS A 195 -25.397 57.722 -60.954 1.00173.05 N
ATOM 1456 CD2 HIS A 195 -25.471 56.708 -62.887 1.00172.73 C
ATOM 1457 CE1 HIS A 195 -26.534 58.066 -61.532 1.00173.01 C
ATOM 1458 NE2 HIS A 195 -26.603 57.465 -62.706 1.00172.75 N
ATOM 1459 N PRO A 196 -22.827 59.471 -60.301 1.00173.26 N
ATOM 1460 CA PRO A 196 -23.007 60.474 -59.244 1.00173.59 C
ATOM 1461 C PRO A 196 -23.878 60.019 -58.076 1.00173.66 C
ATOM 1462 O PRO A 196 -23.528 60.265 -56.921 1.00173.44 O
ATOM 1463 CB PRO A 196 -23.680 61.630 -59.988 1.00173.37 C
ATOM 1464 CG PRO A 196 -23.150 61.518 -61.365 1.00172.61 C
ATOM 1465 CD PRO A 196 -23.110 60.038 -61.631 1.00172.96 C
ATOM 1466 N PHE A 197 -24.991 59.359 -58.379 1.00173.88 N
ATOM 1467 CA PHE A 197 -25.958 58.973 -57.357 1.00173.96 C
ATOM 1468 C PHE A 197 -25.376 57.966 -56.385 1.00173.04 C
ATOM 1469 O PHE A 197 -25.639 58.019 -55.183 1.00172.86 O
ATOM 1470 CB PHE A 197 -27.220 58.398 -57.997 1.00174.28 C
ATOM 1471 CG PHE A 197 -28.168 59.440 -58.503 1.00174.09 C
ATOM 1472 CD1 PHE A 197 -27.798 60.774 -58.531 1.00174.28 C
ATOM 1473 CD2 PHE A 197 -29.434 59.091 -58.938 1.00173.25 C
ATOM 1474 CE1 PHE A 197 -28.667 61.738 -58.989 1.00173.40 C
ATOM 1475 CE2 PHE A 197 -30.310 60.052 -59.398 1.00172.81 C
ATOM 1476 CZ PHE A 197 -29.926 61.378 -59.424 1.00172.65 C
ATOM 1477 N HIS A 198 -24.590 57.040 -56.916 1.00172.56 N
ATOM 1478 CA HIS A 198 -23.911 56.069 -56.081 1.00172.63 C
ATOM 1479 C HIS A 198 -22.864 56.739 -55.205 1.00173.22 C
ATOM 1480 O HIS A 198 -22.748 56.430 -54.023 1.00174.31 O
ATOM 1481 CB HIS A 198 -23.258 54.994 -56.940 1.00172.85 C
ATOM 1482 CG HIS A 198 -22.592 53.922 -56.143 1.00172.81 C
ATOM 1483 ND1 HIS A 198 -21.283 54.013 -55.722 1.00172.73 N
ATOM 1484 CD2 HIS A 198 -23.059 52.743 -55.671 1.00172.86 C
ATOM 1485 CE1 HIS A 198 -20.968 52.930 -55.035 1.00173.10 C
ATOM 1486 NE2 HIS A 198 -22.028 52.144 -54.992 1.00172.79 N
ATOM 1487 N GLN A 199 -22.108 57.656 -55.799 1.00173.22 N
ATOM 1488 CA GLN A 199 -21.084 58.409 -55.086 1.00173.62 C
ATOM 1489 C GLN A 199 -21.690 59.206 -53.937 1.00173.67 C
ATOM 1490 O GLN A 199 -21.116 59.284 -52.850 1.00173.68 O
ATOM 1491 CB GLN A 199 -20.342 59.334 -56.047 1.00173.89 C
ATOM 1492 CG GLN A 199 -19.523 58.590 -57.087 1.00174.17 C
ATOM 1493 CD GLN A 199 -18.987 59.502 -58.166 1.00175.04 C
ATOM 1494 OE1 GLN A 199 -19.747 60.198 -58.840 1.00175.00 O
ATOM 1495 NE2 GLN A 199 -17.672 59.504 -58.340 1.00175.98 N
ATOM 1496 N LEU A 200 -22.849 59.805 -54.192 1.00173.58 N
ATOM 1497 CA LEU A 200 -23.605 60.494 -53.153 1.00173.88 C
ATOM 1498 C LEU A 200 -24.041 59.513 -52.073 1.00174.07 C
ATOM 1499 O LEU A 200 -24.174 59.878 -50.905 1.00173.39 O
ATOM 1500 CB LEU A 200 -24.828 61.195 -53.748 1.00173.49 C
ATOM 1501 CG LEU A 200 -24.587 62.506 -54.496 1.00172.57 C
ATOM 1502 CD1 LEU A 200 -25.883 63.014 -55.106 1.00172.43 C
ATOM 1503 CD2 LEU A 200 -23.981 63.547 -53.568 1.00172.80 C
ATOM 1504 N GLY A 201 -24.262 58.266 -52.477 1.00174.42 N
ATOM 1505 CA GLY A 201 -24.654 57.215 -51.558 1.00174.37 C
ATOM 1506 C GLY A 201 -23.593 56.903 -50.523 1.00173.89 C
ATOM 1507 O GLY A 201 -23.878 56.882 -49.326 1.00173.75 O
ATOM 1508 N VAL A 202 -22.369 56.655 -50.980 1.00173.72 N
ATOM 1509 CA VAL A 202 -21.275 56.364 -50.063 1.00173.88 C
ATOM 1510 C VAL A 202 -20.952 57.615 -49.255 1.00174.44 C
ATOM 1511 O VAL A 202 -20.515 57.524 -48.109 1.00174.95 O
ATOM 1512 CB VAL A 202 -20.008 55.845 -50.804 1.00174.00 C
ATOM 1513 CG1 VAL A 202 -20.303 55.595 -52.272 1.00174.21 C
ATOM 1514 CG2 VAL A 202 -18.824 56.795 -50.636 1.00174.32 C
ATOM 1515 N ALA A 203 -21.201 58.779 -49.848 1.00173.92 N
ATOM 1516 CA ALA A 203 -20.992 60.046 -49.161 1.00174.23 C
ATOM 1517 C ALA A 203 -21.883 60.128 -47.926 1.00174.81 C
ATOM 1518 O ALA A 203 -21.431 60.506 -46.845 1.00174.89 O
ATOM 1519 CB ALA A 203 -21.266 61.211 -50.097 1.00173.91 C
ATOM 1520 N GLY A 204 -23.151 59.770 -48.101 1.00174.90 N
ATOM 1521 CA GLY A 204 -24.089 59.701 -46.996 1.00175.31 C
ATOM 1522 C GLY A 204 -23.739 58.599 -46.015 1.00174.57 C
ATOM 1523 O GLY A 204 -23.857 58.771 -44.803 1.00173.89 O
ATOM 1524 N VAL A 205 -23.306 57.460 -46.546 1.00174.39 N
ATOM 1525 CA VAL A 205 -22.977 56.302 -45.724 1.00173.40 C
ATOM 1526 C VAL A 205 -21.671 56.503 -44.955 1.00173.10 C
ATOM 1527 O VAL A 205 -21.614 56.251 -43.751 1.00172.97 O
ATOM 1528 CB VAL A 205 -22.893 55.025 -46.583 1.00173.26 C
ATOM 1529 CG1 VAL A 205 -22.241 53.898 -45.815 1.00172.91 C
ATOM 1530 CG2 VAL A 205 -24.282 54.619 -47.046 1.00173.43 C
ATOM 1531 N PHE A 206 -20.626 56.956 -45.643 1.00173.34 N
ATOM 1532 CA PHE A 206 -19.373 57.294 -44.973 1.00173.89 C
ATOM 1533 C PHE A 206 -19.605 58.423 -43.977 1.00173.98 C
ATOM 1534 O PHE A 206 -19.270 58.302 -42.797 1.00174.15 O
ATOM 1535 CB PHE A 206 -18.294 57.698 -45.980 1.00173.44 C
ATOM 1536 CG PHE A 206 -17.591 56.535 -46.617 1.00173.26 C
ATOM 1537 CD1 PHE A 206 -16.758 56.727 -47.705 1.00174.18 C
ATOM 1538 CD2 PHE A 206 -17.762 55.250 -46.129 1.00173.02 C
ATOM 1539 CE1 PHE A 206 -16.109 55.661 -48.297 1.00174.50 C
ATOM 1540 CE2 PHE A 206 -17.116 54.180 -46.717 1.00172.83 C
ATOM 1541 CZ PHE A 206 -16.289 54.387 -47.803 1.00173.57 C
ATOM 1542 N GLY A 207 -20.175 59.519 -44.472 1.00173.53 N
ATOM 1543 CA GLY A 207 -20.535 60.653 -43.641 1.00173.61 C
ATOM 1544 C GLY A 207 -21.385 60.239 -42.457 1.00173.99 C
ATOM 1545 O GLY A 207 -21.141 60.673 -41.332 1.00174.15 O
ATOM 1546 N GLY A 208 -22.387 59.403 -42.719 1.00174.03 N
ATOM 1547 CA GLY A 208 -23.227 58.838 -41.676 1.00174.40 C
ATOM 1548 C GLY A 208 -22.421 58.213 -40.555 1.00173.84 C
ATOM 1549 O GLY A 208 -22.500 58.654 -39.409 1.00173.71 O
ATOM 1550 N ALA A 209 -21.646 57.185 -40.892 1.00173.50 N
ATOM 1551 CA ALA A 209 -20.743 56.538 -39.945 1.00173.35 C
ATOM 1552 C ALA A 209 -19.797 57.544 -39.299 1.00173.30 C
ATOM 1553 O ALA A 209 -19.492 57.447 -38.111 1.00174.07 O
ATOM 1554 CB ALA A 209 -19.949 55.443 -40.637 1.00173.37 C
ATOM 1555 N LEU A 210 -19.332 58.504 -40.094 1.00172.92 N
ATOM 1556 CA LEU A 210 -18.463 59.567 -39.606 1.00173.36 C
ATOM 1557 C LEU A 210 -19.189 60.374 -38.532 1.00173.85 C
ATOM 1558 O LEU A 210 -18.759 60.418 -37.380 1.00174.14 O
ATOM 1559 CB LEU A 210 -18.026 60.472 -40.765 1.00173.55 C
ATOM 1560 CG LEU A 210 -16.774 61.359 -40.714 1.00173.64 C
ATOM 1561 CD1 LEU A 210 -16.704 62.223 -41.967 1.00173.52 C
ATOM 1562 CD2 LEU A 210 -16.688 62.228 -39.468 1.00174.00 C
ATOM 1563 N PHE A 211 -20.286 61.013 -38.926 1.00173.81 N
ATOM 1564 CA PHE A 211 -21.088 61.833 -38.020 1.00173.82 C
ATOM 1565 C PHE A 211 -21.624 61.045 -36.824 1.00173.86 C
ATOM 1566 O PHE A 211 -21.714 61.578 -35.718 1.00174.21 O
ATOM 1567 CB PHE A 211 -22.242 62.484 -38.786 1.00173.92 C
ATOM 1568 CG PHE A 211 -21.791 63.359 -39.922 1.00174.11 C
ATOM 1569 CD1 PHE A 211 -20.632 64.112 -39.813 1.00173.59 C
ATOM 1570 CD2 PHE A 211 -22.520 63.427 -41.097 1.00174.71 C
ATOM 1571 CE1 PHE A 211 -20.211 64.915 -40.853 1.00173.32 C
ATOM 1572 CE2 PHE A 211 -22.102 64.229 -42.143 1.00174.43 C
ATOM 1573 CZ PHE A 211 -20.945 64.974 -42.019 1.00173.58 C
ATOM 1574 N CYS A 212 -22.001 59.789 -37.051 1.00173.34 N
ATOM 1575 CA CYS A 212 -22.438 58.919 -35.961 1.00173.22 C
ATOM 1576 C CYS A 212 -21.350 58.773 -34.902 1.00173.45 C
ATOM 1577 O CYS A 212 -21.631 58.777 -33.704 1.00173.42 O
ATOM 1578 CB CYS A 212 -22.836 57.543 -36.494 1.00173.26 C
ATOM 1579 SG CYS A 212 -23.388 56.383 -35.222 1.00172.34 S
ATOM 1580 N ALA A 213 -20.108 58.644 -35.358 1.00173.71 N
ATOM 1581 CA ALA A 213 -18.960 58.576 -34.463 1.00174.03 C
ATOM 1582 C ALA A 213 -18.666 59.956 -33.883 1.00174.07 C
ATOM 1583 O ALA A 213 -18.300 60.081 -32.714 1.00173.48 O
ATOM 1584 CB ALA A 213 -17.740 58.031 -35.195 1.00174.54 C
ATOM 1585 N MET A 214 -18.825 60.983 -34.716 1.00174.36 N
ATOM 1586 CA MET A 214 -18.652 62.372 -34.302 1.00174.20 C
ATOM 1587 C MET A 214 -19.524 62.711 -33.109 1.00173.96 C
ATOM 1588 O MET A 214 -19.022 62.971 -32.014 1.00173.76 O
ATOM 1589 CB MET A 214 -18.974 63.325 -35.458 1.00173.85 C
ATOM 1590 CG MET A 214 -17.811 63.637 -36.397 1.00173.62 C
ATOM 1591 SD MET A 214 -16.631 64.852 -35.758 1.00172.94 S
ATOM 1592 CE MET A 214 -15.601 63.859 -34.679 1.00173.67 C
ATOM 1593 N HIS A 215 -20.833 62.713 -33.343 1.00174.06 N
ATOM 1594 CA HIS A 215 -21.808 62.989 -32.299 1.00174.23 C
ATOM 1595 C HIS A 215 -21.617 62.084 -31.091 1.00174.71 C
ATOM 1596 O HIS A 215 -21.456 62.564 -29.968 1.00174.75 O
ATOM 1597 CB HIS A 215 -23.233 62.842 -32.825 1.00173.79 C
ATOM 1598 CG HIS A 215 -24.266 63.324 -31.861 1.00173.88 C
ATOM 1599 ND1 HIS A 215 -24.588 64.656 -31.726 1.00173.75 N
ATOM 1600 CD2 HIS A 215 -25.019 62.660 -30.953 1.00173.75 C
ATOM 1601 CE1 HIS A 215 -25.511 64.791 -30.791 1.00173.39 C
ATOM 1602 NE2 HIS A 215 -25.787 63.595 -30.304 1.00173.21 N
ATOM 1603 N GLY A 216 -21.679 60.777 -31.334 1.00174.90 N
ATOM 1604 CA GLY A 216 -21.417 59.771 -30.321 1.00174.71 C
ATOM 1605 C GLY A 216 -20.268 60.098 -29.386 1.00174.96 C
ATOM 1606 O GLY A 216 -20.427 60.068 -28.167 1.00174.98 O
ATOM 1607 N SER A 217 -19.111 60.413 -29.961 1.00174.78 N
ATOM 1608 CA SER A 217 -17.911 60.702 -29.182 1.00174.62 C
ATOM 1609 C SER A 217 -18.026 62.015 -28.414 1.00174.27 C
ATOM 1610 O SER A 217 -17.854 62.041 -27.197 1.00173.91 O
ATOM 1611 CB SER A 217 -16.682 60.739 -30.092 1.00173.58 C
ATOM 1612 OG SER A 217 -16.760 61.813 -31.012 1.00172.46 O
ATOM 1613 N LEU A 218 -18.304 63.097 -29.136 1.00174.10 N
ATOM 1614 CA LEU A 218 -18.465 64.426 -28.545 1.00173.89 C
ATOM 1615 C LEU A 218 -19.383 64.437 -27.320 1.00174.20 C
ATOM 1616 O LEU A 218 -19.017 64.956 -26.265 1.00174.57 O
ATOM 1617 CB LEU A 218 -18.997 65.408 -29.592 1.00173.81 C
ATOM 1618 CG LEU A 218 -17.957 66.300 -30.276 1.00174.03 C
ATOM 1619 CD1 LEU A 218 -16.722 65.500 -30.683 1.00174.30 C
ATOM 1620 CD2 LEU A 218 -18.558 67.020 -31.475 1.00174.32 C
ATOM 1621 N VAL A 219 -20.575 63.867 -27.469 1.00173.89 N
ATOM 1622 CA VAL A 219 -21.540 63.808 -26.376 1.00173.50 C
ATOM 1623 C VAL A 219 -21.011 63.008 -25.186 1.00173.87 C
ATOM 1624 O VAL A 219 -20.941 63.523 -24.070 1.00174.57 O
ATOM 1625 CB VAL A 219 -22.877 63.200 -26.832 1.00172.92 C
ATOM 1626 CG1 VAL A 219 -23.783 62.966 -25.638 1.00173.68 C
ATOM 1627 CG2 VAL A 219 -23.555 64.120 -27.831 1.00172.71 C
ATOM 1628 N THR A 220 -20.641 61.752 -25.426 1.00173.38 N
ATOM 1629 CA THR A 220 -20.173 60.866 -24.358 1.00174.05 C
ATOM 1630 C THR A 220 -18.889 61.379 -23.696 1.00174.56 C
ATOM 1631 O THR A 220 -18.569 60.992 -22.571 1.00174.71 O
ATOM 1632 CB THR A 220 -19.936 59.426 -24.874 1.00173.47 C
ATOM 1633 OG1 THR A 220 -19.856 58.521 -23.766 1.00174.27 O
ATOM 1634 CG2 THR A 220 -18.656 59.338 -25.688 1.00173.01 C
ATOM 1635 N SER A 221 -18.152 62.237 -24.397 1.00174.51 N
ATOM 1636 CA SER A 221 -16.934 62.826 -23.847 1.00174.13 C
ATOM 1637 C SER A 221 -17.240 64.052 -22.989 1.00174.27 C
ATOM 1638 O SER A 221 -16.433 64.448 -22.149 1.00173.84 O
ATOM 1639 CB SER A 221 -15.967 63.205 -24.968 1.00173.41 C
ATOM 1640 OG SER A 221 -16.514 64.216 -25.794 1.00173.27 O
ATOM 1641 N SER A 222 -18.408 64.650 -23.201 1.00174.62 N
ATOM 1642 CA SER A 222 -18.784 65.851 -22.462 1.00174.43 C
ATOM 1643 C SER A 222 -19.907 65.569 -21.469 1.00174.82 C
ATOM 1644 O SER A 222 -20.841 66.358 -21.334 1.00174.97 O
ATOM 1645 CB SER A 222 -19.206 66.963 -23.426 1.00173.97 C
ATOM 1646 OG SER A 222 -20.356 66.589 -24.167 1.00173.36 O
ATOM 1647 N LEU A 223 -19.797 64.446 -20.767 1.00174.92 N
ATOM 1648 CA LEU A 223 -20.798 64.052 -19.783 1.00174.26 C
ATOM 1649 C LEU A 223 -20.515 64.688 -18.427 1.00173.69 C
ATOM 1650 O LEU A 223 -19.364 64.782 -18.004 1.00174.03 O
ATOM 1651 CB LEU A 223 -20.848 62.527 -19.643 1.00173.89 C
ATOM 1652 CG LEU A 223 -21.278 61.704 -20.858 1.00173.73 C
ATOM 1653 CD1 LEU A 223 -21.306 60.226 -20.511 1.00173.47 C
ATOM 1654 CD2 LEU A 223 -22.639 62.158 -21.347 1.00174.00 C
ATOM 1655 N ILE A 224 -21.570 65.137 -17.757 1.00173.14 N
ATOM 1656 CA ILE A 224 -21.438 65.696 -16.418 1.00174.01 C
ATOM 1657 C ILE A 224 -21.121 64.583 -15.424 1.00174.47 C
ATOM 1658 O ILE A 224 -21.727 63.514 -15.466 1.00174.55 O
ATOM 1659 CB ILE A 224 -22.716 66.438 -15.987 1.00174.80 C
ATOM 1660 CG1 ILE A 224 -23.166 67.403 -17.086 1.00174.20 C
ATOM 1661 CG2 ILE A 224 -22.482 67.194 -14.688 1.00174.86 C
ATOM 1662 CD1 ILE A 224 -24.548 67.980 -16.868 1.00174.56 C
ATOM 1663 N ARG A 225 -20.163 64.833 -14.538 1.00174.76 N
ATOM 1664 CA ARG A 225 -19.744 63.831 -13.565 1.00174.24 C
ATOM 1665 C ARG A 225 -20.782 63.605 -12.471 1.00174.50 C
ATOM 1666 O ARG A 225 -21.173 64.537 -11.768 1.00174.63 O
ATOM 1667 CB ARG A 225 -18.411 64.237 -12.934 1.00173.89 C
ATOM 1668 CG ARG A 225 -17.985 63.378 -11.760 1.00173.56 C
ATOM 1669 CD ARG A 225 -16.822 64.020 -11.020 1.00173.18 C
ATOM 1670 NE ARG A 225 -15.957 64.782 -11.917 1.00173.28 N
ATOM 1671 CZ ARG A 225 -14.839 65.394 -11.537 1.00173.74 C
ATOM 1672 NH1 ARG A 225 -14.443 65.334 -10.273 1.00174.28 N
ATOM 1673 NH2 ARG A 225 -14.116 66.067 -12.422 1.00173.63 N
ATOM 1674 N GLU A 226 -21.214 62.355 -12.331 1.00174.02 N
ATOM 1675 CA GLU A 226 -22.123 61.954 -11.262 1.00174.47 C
ATOM 1676 C GLU A 226 -21.824 60.522 -10.835 1.00175.08 C
ATOM 1677 O GLU A 226 -22.588 59.915 -10.083 1.00176.86 O
ATOM 1678 CB GLU A 226 -23.586 62.077 -11.699 1.00173.85 C
ATOM 1679 CG GLU A 226 -24.144 63.493 -11.656 1.00173.61 C
ATOM 1680 CD GLU A 226 -24.519 64.018 -13.027 1.00173.64 C
ATOM 1681 OE1 GLU A 226 -25.136 65.101 -13.101 1.00173.20 O
ATOM 1682 OE2 GLU A 226 -24.190 63.353 -14.032 1.00174.22 O
ATOM 1683 N THR A 227 -20.711 59.983 -11.325 1.00173.96 N
ATOM 1684 CA THR A 227 -20.348 58.596 -11.061 1.00173.31 C
ATOM 1685 C THR A 227 -19.029 58.477 -10.307 1.00173.14 C
ATOM 1686 O THR A 227 -18.207 59.393 -10.324 1.00173.20 O
ATOM 1687 CB THR A 227 -20.241 57.795 -12.367 1.00173.54 C
ATOM 1688 OG1 THR A 227 -19.124 58.270 -13.127 1.00173.73 O
ATOM 1689 CG2 THR A 227 -21.507 57.953 -13.188 1.00173.51 C
ATOM 1690 N THR A 228 -18.835 57.340 -9.647 1.00173.00 N
ATOM 1691 CA THR A 228 -17.604 57.074 -8.914 1.00173.50 C
ATOM 1692 C THR A 228 -16.474 56.731 -9.884 1.00173.78 C
ATOM 1693 O THR A 228 -16.705 56.559 -11.081 1.00172.73 O
ATOM 1694 CB THR A 228 -17.787 55.924 -7.901 1.00173.76 C
ATOM 1695 OG1 THR A 228 -19.164 55.837 -7.518 1.00174.42 O
ATOM 1696 CG2 THR A 228 -16.931 56.152 -6.660 1.00173.06 C
ATOM 1697 N GLU A 229 -15.255 56.631 -9.363 1.00174.93 N
ATOM 1698 CA GLU A 229 -14.094 56.288 -10.177 1.00174.87 C
ATOM 1699 C GLU A 229 -14.143 54.821 -10.594 1.00173.89 C
ATOM 1700 O GLU A 229 -13.631 54.443 -11.648 1.00172.76 O
ATOM 1701 CB GLU A 229 -12.801 56.582 -9.408 1.00175.26 C
ATOM 1702 CG GLU A 229 -11.521 56.289 -10.176 1.00174.52 C
ATOM 1703 CD GLU A 229 -11.326 57.212 -11.364 1.00174.78 C
ATOM 1704 OE1 GLU A 229 -11.862 58.341 -11.341 1.00174.10 O
ATOM 1705 OE2 GLU A 229 -10.633 56.810 -12.322 1.00174.80 O
ATOM 1706 N THR A 230 -14.776 54.000 -9.764 1.00174.48 N
ATOM 1707 CA THR A 230 -14.907 52.578 -10.049 1.00174.45 C
ATOM 1708 C THR A 230 -16.376 52.213 -10.210 1.00174.56 C
ATOM 1709 O THR A 230 -16.852 51.219 -9.659 1.00174.52 O
ATOM 1710 CB THR A 230 -14.278 51.716 -8.940 1.00174.95 C
ATOM 1711 OG1 THR A 230 -14.737 52.168 -7.659 1.00174.66 O
ATOM 1712 CG2 THR A 230 -12.759 51.805 -8.993 1.00174.51 C
ATOM 1713 N GLU A 231 -17.089 53.034 -10.971 1.00174.19 N
ATOM 1714 CA GLU A 231 -18.505 52.823 -11.227 1.00173.89 C
ATOM 1715 C GLU A 231 -18.815 53.224 -12.661 1.00174.50 C
ATOM 1716 O GLU A 231 -18.298 54.227 -13.153 1.00174.78 O
ATOM 1717 CB GLU A 231 -19.358 53.624 -10.238 1.00173.44 C
ATOM 1718 CG GLU A 231 -20.818 53.775 -10.635 1.00173.64 C
ATOM 1719 CD GLU A 231 -21.584 54.702 -9.710 1.00172.66 C
ATOM 1720 OE1 GLU A 231 -21.784 54.336 -8.533 1.00172.52 O
ATOM 1721 OE2 GLU A 231 -21.990 55.794 -10.159 1.00172.06 O
ATOM 1722 N SER A 232 -19.634 52.419 -13.332 1.00174.08 N
ATOM 1723 CA SER A 232 -20.037 52.677 -14.712 1.00174.39 C
ATOM 1724 C SER A 232 -20.563 54.094 -14.924 1.00174.32 C
ATOM 1725 O SER A 232 -21.503 54.525 -14.255 1.00174.90 O
ATOM 1726 CB SER A 232 -21.096 51.663 -15.143 1.00175.34 C
ATOM 1727 OG SER A 232 -21.782 52.106 -16.301 1.00176.52 O
ATOM 1728 N ALA A 233 -19.950 54.810 -15.863 1.00173.01 N
ATOM 1729 CA ALA A 233 -20.336 56.183 -16.173 1.00172.71 C
ATOM 1730 C ALA A 233 -21.757 56.285 -16.729 1.00173.01 C
ATOM 1731 O ALA A 233 -22.314 57.377 -16.821 1.00173.14 O
ATOM 1732 CB ALA A 233 -19.348 56.793 -17.154 1.00172.51 C
ATOM 1733 N ASN A 234 -22.337 55.147 -17.096 1.00173.75 N
ATOM 1734 CA ASN A 234 -23.688 55.107 -17.647 1.00174.31 C
ATOM 1735 C ASN A 234 -24.749 55.326 -16.577 1.00173.27 C
ATOM 1736 O ASN A 234 -25.787 55.941 -16.828 1.00173.36 O
ATOM 1737 CB ASN A 234 -23.934 53.773 -18.354 1.00174.55 C
ATOM 1738 CG ASN A 234 -23.523 53.800 -19.815 1.00173.38 C
ATOM 1739 OD1 ASN A 234 -23.008 54.803 -20.310 1.00173.61 O
ATOM 1740 ND2 ASN A 234 -23.750 52.693 -20.512 1.00172.54 N
ATOM 1741 N TYR A 235 -24.482 54.810 -15.382 1.00172.28 N
ATOM 1742 CA TYR A 235 -25.389 54.955 -14.249 1.00172.99 C
ATOM 1743 C TYR A 235 -25.627 56.410 -13.851 1.00173.86 C
ATOM 1744 O TYR A 235 -26.573 56.707 -13.124 1.00175.14 O
ATOM 1745 CB TYR A 235 -24.860 54.165 -13.049 1.00174.59 C
ATOM 1746 CG TYR A 235 -25.142 52.686 -13.147 1.00174.25 C
ATOM 1747 CD1 TYR A 235 -24.274 51.838 -13.818 1.00173.14 C
ATOM 1748 CD2 TYR A 235 -26.285 52.139 -12.579 1.00175.58 C
ATOM 1749 CE1 TYR A 235 -24.532 50.485 -13.917 1.00173.74 C
ATOM 1750 CE2 TYR A 235 -26.552 50.788 -12.672 1.00176.24 C
ATOM 1751 CZ TYR A 235 -25.672 49.966 -13.342 1.00175.29 C
ATOM 1752 OH TYR A 235 -25.937 48.621 -13.436 1.00175.70 O
ATOM 1753 N GLY A 236 -24.776 57.317 -14.325 1.00173.55 N
ATOM 1754 CA GLY A 236 -24.962 58.737 -14.074 1.00173.68 C
ATOM 1755 C GLY A 236 -26.124 59.344 -14.843 1.00172.96 C
ATOM 1756 O GLY A 236 -26.201 60.561 -15.017 1.00172.50 O
ATOM 1757 N TYR A 237 -27.030 58.489 -15.303 1.00172.74 N
ATOM 1758 CA TYR A 237 -28.232 58.923 -15.994 1.00172.92 C
ATOM 1759 C TYR A 237 -29.408 58.050 -15.581 1.00173.48 C
ATOM 1760 O TYR A 237 -29.285 56.829 -15.482 1.00173.45 O
ATOM 1761 CB TYR A 237 -28.039 58.875 -17.511 1.00173.49 C
ATOM 1762 CG TYR A 237 -29.286 59.229 -18.290 1.00174.41 C
ATOM 1763 CD1 TYR A 237 -29.592 60.551 -18.584 1.00174.48 C
ATOM 1764 CD2 TYR A 237 -30.159 58.242 -18.730 1.00174.94 C
ATOM 1765 CE1 TYR A 237 -30.733 60.880 -19.293 1.00174.94 C
ATOM 1766 CE2 TYR A 237 -31.302 58.561 -19.438 1.00175.29 C
ATOM 1767 CZ TYR A 237 -31.583 59.880 -19.717 1.00175.42 C
ATOM 1768 OH TYR A 237 -32.718 60.201 -20.423 1.00176.23 O
ATOM 1769 N LYS A 238 -30.548 58.687 -15.340 1.00173.82 N
ATOM 1770 CA LYS A 238 -31.758 57.975 -14.960 1.00173.69 C
ATOM 1771 C LYS A 238 -32.826 58.155 -16.031 1.00173.19 C
ATOM 1772 O LYS A 238 -33.029 59.260 -16.534 1.00173.10 O
ATOM 1773 CB LYS A 238 -32.270 58.464 -13.603 1.00174.73 C
ATOM 1774 CG LYS A 238 -31.375 58.095 -12.427 1.00174.89 C
ATOM 1775 CD LYS A 238 -31.197 56.590 -12.318 1.00174.76 C
ATOM 1776 CE LYS A 238 -30.044 56.240 -11.392 1.00174.00 C
ATOM 1777 NZ LYS A 238 -29.728 54.785 -11.425 1.00173.85 N
ATOM 1778 N PHE A 239 -33.493 57.065 -16.392 1.00173.10 N
ATOM 1779 CA PHE A 239 -34.567 57.125 -17.376 1.00174.31 C
ATOM 1780 C PHE A 239 -35.674 58.068 -16.923 1.00174.46 C
ATOM 1781 O PHE A 239 -36.285 57.863 -15.875 1.00175.07 O
ATOM 1782 CB PHE A 239 -35.138 55.730 -17.633 1.00175.16 C
ATOM 1783 CG PHE A 239 -36.228 55.706 -18.666 1.00174.88 C
ATOM 1784 CD1 PHE A 239 -35.979 56.120 -19.963 1.00174.43 C
ATOM 1785 CD2 PHE A 239 -37.502 55.272 -18.338 1.00174.77 C
ATOM 1786 CE1 PHE A 239 -36.980 56.100 -20.915 1.00174.82 C
ATOM 1787 CE2 PHE A 239 -38.507 55.249 -19.285 1.00174.29 C
ATOM 1788 CZ PHE A 239 -38.246 55.664 -20.575 1.00174.42 C
ATOM 1789 N GLY A 240 -35.920 59.108 -17.712 1.00173.65 N
ATOM 1790 CA GLY A 240 -36.933 60.090 -17.376 1.00174.11 C
ATOM 1791 C GLY A 240 -36.363 61.261 -16.602 1.00174.80 C
ATOM 1792 O GLY A 240 -36.882 61.631 -15.549 1.00176.25 O
ATOM 1793 N GLN A 241 -35.290 61.846 -17.126 1.00173.56 N
ATOM 1794 CA GLN A 241 -34.662 62.998 -16.492 1.00173.44 C
ATOM 1795 C GLN A 241 -35.315 64.299 -16.941 1.00173.69 C
ATOM 1796 O GLN A 241 -35.981 64.348 -17.974 1.00173.23 O
ATOM 1797 CB GLN A 241 -33.164 63.035 -16.804 1.00172.95 C
ATOM 1798 CG GLN A 241 -32.298 62.249 -15.833 1.00173.00 C
ATOM 1799 CD GLN A 241 -30.818 62.486 -16.055 1.00173.47 C
ATOM 1800 OE1 GLN A 241 -30.427 63.275 -16.916 1.00173.83 O
ATOM 1801 NE2 GLN A 241 -29.984 61.802 -15.280 1.00173.34 N
ATOM 1802 N GLU A 242 -35.128 65.349 -16.149 1.00174.34 N
ATOM 1803 CA GLU A 242 -35.606 66.673 -16.520 1.00174.34 C
ATOM 1804 C GLU A 242 -34.525 67.402 -17.306 1.00174.36 C
ATOM 1805 O GLU A 242 -34.732 67.787 -18.456 1.00173.88 O
ATOM 1806 CB GLU A 242 -36.004 67.490 -15.285 1.00175.09 C
ATOM 1807 CG GLU A 242 -37.358 67.130 -14.681 1.00174.93 C
ATOM 1808 CD GLU A 242 -37.340 65.817 -13.920 1.00176.08 C
ATOM 1809 OE1 GLU A 242 -38.432 65.307 -13.590 1.00176.11 O
ATOM 1810 OE2 GLU A 242 -36.237 65.297 -13.648 1.00176.79 O
ATOM 1811 N GLU A 243 -33.366 67.573 -16.677 1.00174.89 N
ATOM 1812 CA GLU A 243 -32.246 68.276 -17.293 1.00174.88 C
ATOM 1813 C GLU A 243 -31.385 67.357 -18.157 1.00174.65 C
ATOM 1814 O GLU A 243 -31.552 66.137 -18.152 1.00174.48 O
ATOM 1815 CB GLU A 243 -31.382 68.946 -16.218 1.00174.72 C
ATOM 1816 CG GLU A 243 -31.601 68.417 -14.805 1.00175.02 C
ATOM 1817 CD GLU A 243 -31.115 66.992 -14.625 1.00175.16 C
ATOM 1818 OE1 GLU A 243 -31.964 66.093 -14.441 1.00175.00 O
ATOM 1819 OE2 GLU A 243 -29.886 66.771 -14.664 1.00174.74 O
ATOM 1820 N GLU A 244 -30.464 67.962 -18.902 1.00174.46 N
ATOM 1821 CA GLU A 244 -29.586 67.228 -19.807 1.00174.59 C
ATOM 1822 C GLU A 244 -28.510 66.470 -19.030 1.00174.47 C
ATOM 1823 O GLU A 244 -28.182 66.829 -17.899 1.00174.64 O
ATOM 1824 CB GLU A 244 -28.949 68.190 -20.816 1.00174.36 C
ATOM 1825 CG GLU A 244 -28.177 67.515 -21.938 1.00174.04 C
ATOM 1826 CD GLU A 244 -28.963 66.391 -22.582 1.00174.22 C
ATOM 1827 OE1 GLU A 244 -30.015 66.673 -23.195 1.00174.05 O
ATOM 1828 OE2 GLU A 244 -28.538 65.222 -22.466 1.00174.28 O
ATOM 1829 N THR A 245 -27.961 65.425 -19.644 1.00174.06 N
ATOM 1830 CA THR A 245 -26.945 64.603 -19.000 1.00173.68 C
ATOM 1831 C THR A 245 -25.539 64.908 -19.511 1.00173.39 C
ATOM 1832 O THR A 245 -24.566 64.303 -19.062 1.00172.97 O
ATOM 1833 CB THR A 245 -27.234 63.104 -19.205 1.00173.59 C
ATOM 1834 OG1 THR A 245 -26.380 62.329 -18.355 1.00174.03 O
ATOM 1835 CG2 THR A 245 -26.998 62.707 -20.653 1.00173.22 C
ATOM 1836 N TYR A 246 -25.429 65.849 -20.444 1.00173.66 N
ATOM 1837 CA TYR A 246 -24.120 66.238 -20.957 1.00174.18 C
ATOM 1838 C TYR A 246 -24.033 67.738 -21.216 1.00174.73 C
ATOM 1839 O TYR A 246 -25.036 68.389 -21.507 1.00174.51 O
ATOM 1840 CB TYR A 246 -23.788 65.461 -22.237 1.00174.21 C
ATOM 1841 CG TYR A 246 -24.453 65.975 -23.497 1.00174.25 C
ATOM 1842 CD1 TYR A 246 -23.761 66.788 -24.389 1.00173.86 C
ATOM 1843 CD2 TYR A 246 -25.760 65.628 -23.809 1.00174.50 C
ATOM 1844 CE1 TYR A 246 -24.359 67.252 -25.547 1.00173.79 C
ATOM 1845 CE2 TYR A 246 -26.367 66.089 -24.966 1.00174.57 C
ATOM 1846 CZ TYR A 246 -25.661 66.900 -25.830 1.00174.11 C
ATOM 1847 OH TYR A 246 -26.257 67.362 -26.983 1.00173.02 O
ATOM 1848 N ASN A 247 -22.822 68.275 -21.112 1.00174.73 N
ATOM 1849 CA ASN A 247 -22.587 69.699 -21.308 1.00174.36 C
ATOM 1850 C ASN A 247 -22.404 70.038 -22.782 1.00174.12 C
ATOM 1851 O ASN A 247 -21.285 70.018 -23.296 1.00174.13 O
ATOM 1852 CB ASN A 247 -21.364 70.152 -20.508 1.00173.73 C
ATOM 1853 CG ASN A 247 -21.432 71.615 -20.111 1.00173.85 C
ATOM 1854 OD1 ASN A 247 -21.791 72.475 -20.916 1.00173.83 O
ATOM 1855 ND2 ASN A 247 -21.080 71.904 -18.864 1.00173.92 N
ATOM 1856 N ILE A 248 -23.509 70.342 -23.457 1.00173.85 N
ATOM 1857 CA ILE A 248 -23.481 70.667 -24.881 1.00173.87 C
ATOM 1858 C ILE A 248 -22.679 71.942 -25.151 1.00174.36 C
ATOM 1859 O ILE A 248 -22.204 72.168 -26.266 1.00174.02 O
ATOM 1860 CB ILE A 248 -24.916 70.828 -25.440 1.00174.31 C
ATOM 1861 CG1 ILE A 248 -24.898 70.942 -26.967 1.00173.88 C
ATOM 1862 CG2 ILE A 248 -25.621 72.014 -24.789 1.00174.38 C
ATOM 1863 CD1 ILE A 248 -26.243 70.715 -27.609 1.00173.56 C
ATOM 1864 N VAL A 249 -22.500 72.760 -24.118 1.00174.69 N
ATOM 1865 CA VAL A 249 -21.777 74.016 -24.262 1.00174.33 C
ATOM 1866 C VAL A 249 -20.277 73.760 -24.172 1.00173.72 C
ATOM 1867 O VAL A 249 -19.471 74.481 -24.761 1.00173.25 O
ATOM 1868 CB VAL A 249 -22.195 75.038 -23.188 1.00174.40 C
ATOM 1869 CG1 VAL A 249 -21.647 76.415 -23.524 1.00174.75 C
ATOM 1870 CG2 VAL A 249 -23.712 75.089 -23.069 1.00173.95 C
ATOM 1871 N ALA A 250 -19.913 72.716 -23.436 1.00173.95 N
ATOM 1872 CA ALA A 250 -18.522 72.298 -23.337 1.00174.14 C
ATOM 1873 C ALA A 250 -18.141 71.487 -24.570 1.00174.08 C
ATOM 1874 O ALA A 250 -16.995 71.520 -25.019 1.00174.11 O
ATOM 1875 CB ALA A 250 -18.295 71.492 -22.069 1.00174.95 C
ATOM 1876 N ALA A 251 -19.114 70.755 -25.104 1.00173.96 N
ATOM 1877 CA ALA A 251 -18.930 70.003 -26.339 1.00174.26 C
ATOM 1878 C ALA A 251 -18.623 70.944 -27.501 1.00174.44 C
ATOM 1879 O ALA A 251 -17.645 70.756 -28.224 1.00174.80 O
ATOM 1880 CB ALA A 251 -20.166 69.166 -26.640 1.00174.19 C
ATOM 1881 N HIS A 252 -19.473 71.952 -27.676 1.00174.18 N
ATOM 1882 CA HIS A 252 -19.280 72.959 -28.715 1.00173.93 C
ATOM 1883 C HIS A 252 -17.965 73.716 -28.552 1.00173.81 C
ATOM 1884 O HIS A 252 -17.323 74.083 -29.536 1.00173.27 O
ATOM 1885 CB HIS A 252 -20.447 73.947 -28.718 1.00174.00 C
ATOM 1886 CG HIS A 252 -20.229 75.132 -29.604 1.00174.91 C
ATOM 1887 ND1 HIS A 252 -19.899 75.014 -30.936 1.00175.09 N
ATOM 1888 CD2 HIS A 252 -20.286 76.460 -29.346 1.00175.79 C
ATOM 1889 CE1 HIS A 252 -19.766 76.218 -31.463 1.00175.35 C
ATOM 1890 NE2 HIS A 252 -19.995 77.113 -30.520 1.00175.87 N
ATOM 1891 N GLY A 253 -17.573 73.950 -27.304 1.00174.36 N
ATOM 1892 CA GLY A 253 -16.324 74.627 -27.007 1.00174.39 C
ATOM 1893 C GLY A 253 -15.119 73.866 -27.524 1.00173.85 C
ATOM 1894 O GLY A 253 -14.173 74.461 -28.037 1.00173.31 O
ATOM 1895 N TYR A 254 -15.156 72.545 -27.389 1.00174.02 N
ATOM 1896 CA TYR A 254 -14.070 71.694 -27.861 1.00173.83 C
ATOM 1897 C TYR A 254 -14.047 71.590 -29.380 1.00173.62 C
ATOM 1898 O TYR A 254 -13.044 71.915 -30.016 1.00173.49 O
ATOM 1899 CB TYR A 254 -14.183 70.294 -27.254 1.00174.65 C
ATOM 1900 CG TYR A 254 -13.360 69.249 -27.976 1.00174.25 C
ATOM 1901 CD1 TYR A 254 -11.987 69.168 -27.788 1.00173.76 C
ATOM 1902 CD2 TYR A 254 -13.957 68.342 -28.844 1.00174.04 C
ATOM 1903 CE1 TYR A 254 -11.231 68.219 -28.444 1.00173.53 C
ATOM 1904 CE2 TYR A 254 -13.208 67.390 -29.506 1.00173.85 C
ATOM 1905 CZ TYR A 254 -11.846 67.332 -29.301 1.00174.07 C
ATOM 1906 OH TYR A 254 -11.095 66.385 -29.956 1.00175.12 O
ATOM 1907 N PHE A 255 -15.155 71.127 -29.952 1.00173.72 N
ATOM 1908 CA PHE A 255 -15.257 70.935 -31.394 1.00173.78 C
ATOM 1909 C PHE A 255 -15.105 72.257 -32.138 1.00173.42 C
ATOM 1910 O PHE A 255 -14.643 72.291 -33.278 1.00172.82 O
ATOM 1911 CB PHE A 255 -16.589 70.280 -31.758 1.00173.77 C
ATOM 1912 CG PHE A 255 -16.727 69.970 -33.219 1.00173.13 C
ATOM 1913 CD1 PHE A 255 -15.824 69.133 -33.850 1.00172.90 C
ATOM 1914 CD2 PHE A 255 -17.754 70.524 -33.964 1.00173.77 C
ATOM 1915 CE1 PHE A 255 -15.947 68.848 -35.197 1.00173.84 C
ATOM 1916 CE2 PHE A 255 -17.881 70.245 -35.310 1.00174.03 C
ATOM 1917 CZ PHE A 255 -16.977 69.405 -35.928 1.00174.23 C
ATOM 1918 N GLY A 256 -15.508 73.342 -31.485 1.00173.60 N
ATOM 1919 CA GLY A 256 -15.377 74.668 -32.056 1.00174.05 C
ATOM 1920 C GLY A 256 -13.922 75.069 -32.186 1.00174.93 C
ATOM 1921 O GLY A 256 -13.570 75.904 -33.015 1.00175.27 O
ATOM 1922 N ARG A 257 -13.074 74.478 -31.350 1.00175.38 N
ATOM 1923 CA ARG A 257 -11.645 74.762 -31.386 1.00175.25 C
ATOM 1924 C ARG A 257 -10.877 73.755 -32.236 1.00175.32 C
ATOM 1925 O ARG A 257 -9.756 74.027 -32.668 1.00175.61 O
ATOM 1926 CB ARG A 257 -11.083 74.805 -29.966 1.00174.08 C
ATOM 1927 CG ARG A 257 -11.592 75.996 -29.179 1.00174.31 C
ATOM 1928 CD ARG A 257 -11.041 76.041 -27.769 1.00175.00 C
ATOM 1929 NE ARG A 257 -11.134 77.379 -27.189 1.00175.23 N
ATOM 1930 CZ ARG A 257 -12.272 78.005 -26.901 1.00174.96 C
ATOM 1931 NH1 ARG A 257 -13.442 77.416 -27.108 1.00174.26 N
ATOM 1932 NH2 ARG A 257 -12.236 79.224 -26.386 1.00175.00 N
ATOM 1933 N LEU A 258 -11.485 72.596 -32.474 1.00175.43 N
ATOM 1934 CA LEU A 258 -10.884 71.569 -33.320 1.00175.17 C
ATOM 1935 C LEU A 258 -10.712 72.085 -34.743 1.00174.35 C
ATOM 1936 O LEU A 258 -9.637 71.971 -35.332 1.00173.66 O
ATOM 1937 CB LEU A 258 -11.735 70.296 -33.314 1.00175.05 C
ATOM 1938 CG LEU A 258 -11.096 69.042 -33.915 1.00174.04 C
ATOM 1939 CD1 LEU A 258 -9.816 68.683 -33.181 1.00173.43 C
ATOM 1940 CD2 LEU A 258 -12.074 67.878 -33.882 1.00174.76 C
ATOM 1941 N ILE A 259 -11.785 72.647 -35.290 1.00174.71 N
ATOM 1942 CA ILE A 259 -11.739 73.280 -36.602 1.00175.14 C
ATOM 1943 C ILE A 259 -11.727 74.799 -36.435 1.00175.30 C
ATOM 1944 O ILE A 259 -10.666 75.422 -36.426 1.00175.30 O
ATOM 1945 CB ILE A 259 -12.938 72.859 -37.481 1.00175.14 C
ATOM 1946 CG1 ILE A 259 -13.208 71.358 -37.344 1.00174.50 C
ATOM 1947 CG2 ILE A 259 -12.699 73.242 -38.936 1.00174.18 C
ATOM 1948 CD1 ILE A 259 -12.050 70.484 -37.776 1.00174.18 C
ATOM 1949 N PHE A 260 -12.918 75.376 -36.293 1.00175.02 N
ATOM 1950 CA PHE A 260 -13.094 76.791 -35.975 1.00174.11 C
ATOM 1951 C PHE A 260 -14.564 77.043 -35.645 1.00174.25 C
ATOM 1952 O PHE A 260 -15.452 76.472 -36.279 1.00174.69 O
ATOM 1953 CB PHE A 260 -12.601 77.696 -37.119 1.00174.08 C
ATOM 1954 CG PHE A 260 -13.454 77.660 -38.361 1.00174.54 C
ATOM 1955 CD1 PHE A 260 -14.548 78.502 -38.498 1.00174.67 C
ATOM 1956 CD2 PHE A 260 -13.144 76.799 -39.402 1.00174.54 C
ATOM 1957 CE1 PHE A 260 -15.322 78.476 -39.645 1.00174.76 C
ATOM 1958 CE2 PHE A 260 -13.916 76.769 -40.552 1.00174.94 C
ATOM 1959 CZ PHE A 260 -15.006 77.610 -40.672 1.00175.33 C
ATOM 1960 N GLN A 261 -14.789 77.881 -34.632 1.00174.17 N
ATOM 1961 CA GLN A 261 -16.099 78.124 -34.009 1.00174.78 C
ATOM 1962 C GLN A 261 -17.332 77.990 -34.905 1.00175.17 C
ATOM 1963 O GLN A 261 -18.195 77.148 -34.658 1.00175.35 O
ATOM 1964 CB GLN A 261 -16.110 79.522 -33.380 1.00174.23 C
ATOM 1965 CG GLN A 261 -17.230 79.733 -32.370 1.00173.58 C
ATOM 1966 CD GLN A 261 -17.303 81.160 -31.866 1.00173.91 C
ATOM 1967 OE1 GLN A 261 -16.440 81.984 -32.170 1.00174.18 O
ATOM 1968 NE2 GLN A 261 -18.341 81.463 -31.095 1.00173.97 N
ATOM 1969 N TYR A 262 -17.410 78.820 -35.939 1.00175.50 N
ATOM 1970 CA TYR A 262 -18.597 78.876 -36.789 1.00174.78 C
ATOM 1971 C TYR A 262 -18.819 77.601 -37.605 1.00174.02 C
ATOM 1972 O TYR A 262 -19.879 77.418 -38.203 1.00173.13 O
ATOM 1973 CB TYR A 262 -18.512 80.090 -37.717 1.00174.33 C
ATOM 1974 CG TYR A 262 -18.296 81.393 -36.977 1.00174.48 C
ATOM 1975 CD1 TYR A 262 -17.019 81.904 -36.784 1.00174.60 C
ATOM 1976 CD2 TYR A 262 -19.371 82.104 -36.458 1.00174.46 C
ATOM 1977 CE1 TYR A 262 -16.818 83.092 -36.102 1.00174.58 C
ATOM 1978 CE2 TYR A 262 -19.180 83.292 -35.776 1.00174.70 C
ATOM 1979 CZ TYR A 262 -17.902 83.780 -35.600 1.00174.52 C
ATOM 1980 OH TYR A 262 -17.709 84.962 -34.922 1.00174.36 O
ATOM 1981 N ALA A 263 -17.829 76.715 -37.612 1.00174.38 N
ATOM 1982 CA ALA A 263 -17.969 75.421 -38.268 1.00174.58 C
ATOM 1983 C ALA A 263 -18.332 74.356 -37.243 1.00174.17 C
ATOM 1984 O ALA A 263 -18.021 73.176 -37.412 1.00174.26 O
ATOM 1985 CB ALA A 263 -16.693 75.044 -38.996 1.00174.58 C
ATOM 1986 N SER A 264 -18.991 74.786 -36.174 1.00173.75 N
ATOM 1987 CA SER A 264 -19.381 73.885 -35.102 1.00174.22 C
ATOM 1988 C SER A 264 -20.811 74.171 -34.665 1.00174.43 C
ATOM 1989 O SER A 264 -21.243 75.324 -34.631 1.00173.94 O
ATOM 1990 CB SER A 264 -18.423 74.017 -33.917 1.00174.61 C
ATOM 1991 OG SER A 264 -18.846 73.220 -32.824 1.00175.21 O
ATOM 1992 N PHE A 265 -21.544 73.113 -34.341 1.00175.11 N
ATOM 1993 CA PHE A 265 -22.930 73.245 -33.914 1.00175.02 C
ATOM 1994 C PHE A 265 -23.044 73.626 -32.442 1.00174.82 C
ATOM 1995 O PHE A 265 -22.251 73.191 -31.608 1.00174.56 O
ATOM 1996 CB PHE A 265 -23.691 71.945 -34.173 1.00174.98 C
ATOM 1997 CG PHE A 265 -24.174 71.800 -35.586 1.00174.51 C
ATOM 1998 CD1 PHE A 265 -24.277 70.550 -36.172 1.00174.37 C
ATOM 1999 CD2 PHE A 265 -24.535 72.915 -36.326 1.00174.45 C
ATOM 2000 CE1 PHE A 265 -24.724 70.414 -37.472 1.00175.10 C
ATOM 2001 CE2 PHE A 265 -24.982 72.785 -37.626 1.00174.39 C
ATOM 2002 CZ PHE A 265 -25.078 71.534 -38.199 1.00175.05 C
ATOM 2003 N ASN A 266 -24.041 74.449 -32.140 1.00174.68 N
ATOM 2004 CA ASN A 266 -24.342 74.833 -30.769 1.00174.76 C
ATOM 2005 C ASN A 266 -25.825 74.617 -30.497 1.00174.23 C
ATOM 2006 O ASN A 266 -26.280 74.654 -29.353 1.00174.15 O
ATOM 2007 CB ASN A 266 -23.944 76.289 -30.518 1.00174.93 C
ATOM 2008 CG ASN A 266 -24.717 77.264 -31.385 1.00174.66 C
ATOM 2009 OD1 ASN A 266 -25.867 77.593 -31.094 1.00175.19 O
ATOM 2010 ND2 ASN A 266 -24.089 77.729 -32.459 1.00174.24 N
ATOM 2011 N ASN A 267 -26.568 74.383 -31.573 1.00173.48 N
ATOM 2012 CA ASN A 267 -27.991 74.098 -31.491 1.00172.73 C
ATOM 2013 C ASN A 267 -28.235 72.603 -31.660 1.00173.02 C
ATOM 2014 O ASN A 267 -28.067 72.060 -32.752 1.00173.54 O
ATOM 2015 CB ASN A 267 -28.756 74.894 -32.553 1.00172.68 C
ATOM 2016 CG ASN A 267 -30.254 74.900 -32.317 1.00173.27 C
ATOM 2017 OD1 ASN A 267 -30.841 73.895 -31.918 1.00173.16 O
ATOM 2018 ND2 ASN A 267 -30.883 76.043 -32.564 1.00174.11 N
ATOM 2019 N SER A 268 -28.619 71.946 -30.570 1.00172.98 N
ATOM 2020 CA SER A 268 -28.882 70.508 -30.570 1.00173.12 C
ATOM 2021 C SER A 268 -29.897 70.096 -31.636 1.00173.12 C
ATOM 2022 O SER A 268 -29.802 69.010 -32.207 1.00173.69 O
ATOM 2023 CB SER A 268 -29.371 70.065 -29.189 1.00173.49 C
ATOM 2024 OG SER A 268 -29.580 68.666 -29.139 1.00173.62 O
ATOM 2025 N ARG A 269 -30.868 70.965 -31.899 1.00172.81 N
ATOM 2026 CA ARG A 269 -31.905 70.679 -32.883 1.00173.37 C
ATOM 2027 C ARG A 269 -31.369 70.799 -34.307 1.00174.54 C
ATOM 2028 O ARG A 269 -31.735 70.020 -35.186 1.00175.25 O
ATOM 2029 CB ARG A 269 -33.099 71.613 -32.682 1.00173.66 C
ATOM 2030 CG ARG A 269 -33.714 71.505 -31.296 1.00173.85 C
ATOM 2031 CD ARG A 269 -35.072 72.176 -31.217 1.00173.72 C
ATOM 2032 NE ARG A 269 -35.732 71.889 -29.947 1.00173.79 N
ATOM 2033 CZ ARG A 269 -36.983 72.232 -29.659 1.00174.13 C
ATOM 2034 NH1 ARG A 269 -37.716 72.878 -30.555 1.00174.74 N
ATOM 2035 NH2 ARG A 269 -37.501 71.931 -28.477 1.00174.39 N
ATOM 2036 N SER A 270 -30.499 71.777 -34.533 1.00174.74 N
ATOM 2037 CA SER A 270 -29.855 71.936 -35.832 1.00174.87 C
ATOM 2038 C SER A 270 -28.857 70.808 -36.052 1.00174.63 C
ATOM 2039 O SER A 270 -28.581 70.412 -37.185 1.00174.40 O
ATOM 2040 CB SER A 270 -29.155 73.291 -35.924 1.00175.08 C
ATOM 2041 OG SER A 270 -30.085 74.350 -35.792 1.00175.26 O
ATOM 2042 N LEU A 271 -28.327 70.298 -34.946 1.00174.76 N
ATOM 2043 CA LEU A 271 -27.396 69.179 -34.952 1.00174.31 C
ATOM 2044 C LEU A 271 -28.075 67.899 -35.429 1.00173.88 C
ATOM 2045 O LEU A 271 -27.667 67.295 -36.421 1.00173.73 O
ATOM 2046 CB LEU A 271 -26.821 68.973 -33.549 1.00174.47 C
ATOM 2047 CG LEU A 271 -25.428 68.382 -33.318 1.00174.47 C
ATOM 2048 CD1 LEU A 271 -25.276 68.080 -31.838 1.00175.10 C
ATOM 2049 CD2 LEU A 271 -25.155 67.135 -34.152 1.00174.03 C
ATOM 2050 N HIS A 272 -29.112 67.494 -34.703 1.00173.85 N
ATOM 2051 CA HIS A 272 -29.783 66.223 -34.946 1.00173.98 C
ATOM 2052 C HIS A 272 -30.511 66.202 -36.284 1.00174.42 C
ATOM 2053 O HIS A 272 -30.729 65.137 -36.863 1.00174.72 O
ATOM 2054 CB HIS A 272 -30.762 65.928 -33.813 1.00173.83 C
ATOM 2055 CG HIS A 272 -30.097 65.712 -32.491 1.00173.43 C
ATOM 2056 ND1 HIS A 272 -29.390 66.704 -31.845 1.00173.79 N
ATOM 2057 CD2 HIS A 272 -30.024 64.620 -31.696 1.00172.86 C
ATOM 2058 CE1 HIS A 272 -28.915 66.233 -30.707 1.00173.40 C
ATOM 2059 NE2 HIS A 272 -29.289 64.972 -30.591 1.00172.91 N
ATOM 2060 N PHE A 273 -30.878 67.378 -36.780 1.00174.57 N
ATOM 2061 CA PHE A 273 -31.486 67.469 -38.098 1.00174.06 C
ATOM 2062 C PHE A 273 -30.457 67.101 -39.155 1.00173.97 C
ATOM 2063 O PHE A 273 -30.721 66.278 -40.030 1.00173.80 O
ATOM 2064 CB PHE A 273 -32.040 68.869 -38.357 1.00173.06 C
ATOM 2065 CG PHE A 273 -32.369 69.122 -39.797 1.00173.31 C
ATOM 2066 CD1 PHE A 273 -33.367 68.401 -40.428 1.00174.02 C
ATOM 2067 CD2 PHE A 273 -31.672 70.072 -40.524 1.00173.94 C
ATOM 2068 CE1 PHE A 273 -33.667 68.623 -41.758 1.00174.82 C
ATOM 2069 CE2 PHE A 273 -31.969 70.302 -41.854 1.00174.30 C
ATOM 2070 CZ PHE A 273 -32.967 69.576 -42.472 1.00174.13 C
ATOM 2071 N PHE A 274 -29.284 67.718 -39.059 1.00174.22 N
ATOM 2072 CA PHE A 274 -28.157 67.391 -39.924 1.00173.91 C
ATOM 2073 C PHE A 274 -27.779 65.920 -39.780 1.00173.19 C
ATOM 2074 O PHE A 274 -27.486 65.245 -40.766 1.00173.43 O
ATOM 2075 CB PHE A 274 -26.960 68.287 -39.596 1.00174.50 C
ATOM 2076 CG PHE A 274 -25.740 68.003 -40.426 1.00174.36 C
ATOM 2077 CD1 PHE A 274 -25.682 68.396 -41.753 1.00173.64 C
ATOM 2078 CD2 PHE A 274 -24.648 67.351 -39.876 1.00175.04 C
ATOM 2079 CE1 PHE A 274 -24.560 68.139 -42.518 1.00173.94 C
ATOM 2080 CE2 PHE A 274 -23.523 67.090 -40.637 1.00174.79 C
ATOM 2081 CZ PHE A 274 -23.479 67.485 -41.959 1.00174.31 C
ATOM 2082 N LEU A 275 -27.786 65.435 -38.542 1.00172.49 N
ATOM 2083 CA LEU A 275 -27.502 64.034 -38.248 1.00171.82 C
ATOM 2084 C LEU A 275 -28.460 63.101 -38.981 1.00171.40 C
ATOM 2085 O LEU A 275 -28.094 61.990 -39.359 1.00170.81 O
ATOM 2086 CB LEU A 275 -27.578 63.781 -36.742 1.00173.28 C
ATOM 2087 CG LEU A 275 -26.358 63.121 -36.097 1.00174.42 C
ATOM 2088 CD1 LEU A 275 -25.102 63.933 -36.378 1.00174.33 C
ATOM 2089 CD2 LEU A 275 -26.568 62.952 -34.599 1.00174.43 C
ATOM 2090 N ALA A 276 -29.692 63.559 -39.172 1.00172.18 N
ATOM 2091 CA ALA A 276 -30.710 62.763 -39.847 1.00173.31 C
ATOM 2092 C ALA A 276 -30.740 63.034 -41.350 1.00174.28 C
ATOM 2093 O ALA A 276 -30.833 62.106 -42.152 1.00174.60 O
ATOM 2094 CB ALA A 276 -32.077 63.034 -39.237 1.00173.79 C
ATOM 2095 N ALA A 277 -30.664 64.309 -41.720 1.00174.30 N
ATOM 2096 CA ALA A 277 -30.751 64.727 -43.120 1.00174.27 C
ATOM 2097 C ALA A 277 -29.688 64.087 -44.015 1.00174.55 C
ATOM 2098 O ALA A 277 -30.014 63.499 -45.045 1.00174.56 O
ATOM 2099 CB ALA A 277 -30.659 66.246 -43.216 1.00173.68 C
ATOM 2100 N TRP A 278 -28.424 64.209 -43.614 1.00174.37 N
ATOM 2101 CA TRP A 278 -27.294 63.758 -44.428 1.00173.37 C
ATOM 2102 C TRP A 278 -27.404 62.302 -44.912 1.00172.81 C
ATOM 2103 O TRP A 278 -27.396 62.068 -46.120 1.00173.26 O
ATOM 2104 CB TRP A 278 -25.977 63.966 -43.663 1.00173.64 C
ATOM 2105 CG TRP A 278 -24.754 63.619 -44.451 1.00173.24 C
ATOM 2106 CD1 TRP A 278 -24.146 62.401 -44.525 1.00173.36 C
ATOM 2107 CD2 TRP A 278 -23.979 64.504 -45.268 1.00173.33 C
ATOM 2108 NE1 TRP A 278 -23.045 62.470 -45.343 1.00173.62 N
ATOM 2109 CE2 TRP A 278 -22.920 63.750 -45.811 1.00173.41 C
ATOM 2110 CE3 TRP A 278 -24.080 65.860 -45.594 1.00173.72 C
ATOM 2111 CZ2 TRP A 278 -21.969 64.308 -46.664 1.00173.37 C
ATOM 2112 CZ3 TRP A 278 -23.135 66.410 -46.439 1.00173.73 C
ATOM 2113 CH2 TRP A 278 -22.094 65.636 -46.965 1.00173.27 C
ATOM 2114 N PRO A 279 -27.499 61.321 -43.992 1.00171.91 N
ATOM 2115 CA PRO A 279 -27.562 59.944 -44.495 1.00171.74 C
ATOM 2116 C PRO A 279 -28.825 59.645 -45.306 1.00172.42 C
ATOM 2117 O PRO A 279 -28.732 58.989 -46.341 1.00173.49 O
ATOM 2118 CB PRO A 279 -27.532 59.109 -43.215 1.00172.74 C
ATOM 2119 CG PRO A 279 -28.160 59.985 -42.202 1.00173.74 C
ATOM 2120 CD PRO A 279 -27.658 61.357 -42.525 1.00173.42 C
ATOM 2121 N VAL A 280 -29.980 60.112 -44.836 1.00172.42 N
ATOM 2122 CA VAL A 280 -31.253 59.873 -45.513 1.00173.54 C
ATOM 2123 C VAL A 280 -31.253 60.404 -46.946 1.00173.87 C
ATOM 2124 O VAL A 280 -31.667 59.709 -47.874 1.00173.76 O
ATOM 2125 CB VAL A 280 -32.430 60.505 -44.736 1.00173.88 C
ATOM 2126 CG1 VAL A 280 -33.705 60.474 -45.566 1.00174.34 C
ATOM 2127 CG2 VAL A 280 -32.636 59.786 -43.410 1.00173.28 C
ATOM 2128 N VAL A 281 -30.782 61.635 -47.118 1.00173.87 N
ATOM 2129 CA VAL A 281 -30.702 62.252 -48.439 1.00173.51 C
ATOM 2130 C VAL A 281 -29.710 61.516 -49.337 1.00173.90 C
ATOM 2131 O VAL A 281 -29.983 61.279 -50.515 1.00174.24 O
ATOM 2132 CB VAL A 281 -30.301 63.740 -48.336 1.00173.62 C
ATOM 2133 CG1 VAL A 281 -29.923 64.296 -49.701 1.00173.91 C
ATOM 2134 CG2 VAL A 281 -31.430 64.550 -47.720 1.00174.61 C
ATOM 2135 N GLY A 282 -28.565 61.148 -48.773 1.00174.15 N
ATOM 2136 CA GLY A 282 -27.546 60.425 -49.513 1.00174.44 C
ATOM 2137 C GLY A 282 -28.013 59.060 -49.983 1.00174.52 C
ATOM 2138 O GLY A 282 -27.775 58.670 -51.127 1.00174.28 O
ATOM 2139 N VAL A 283 -28.682 58.332 -49.094 1.00174.52 N
ATOM 2140 CA VAL A 283 -29.211 57.015 -49.423 1.00173.71 C
ATOM 2141 C VAL A 283 -30.379 57.155 -50.398 1.00173.96 C
ATOM 2142 O VAL A 283 -30.597 56.294 -51.252 1.00174.20 O
ATOM 2143 CB VAL A 283 -29.653 56.256 -48.151 1.00173.11 C
ATOM 2144 CG1 VAL A 283 -30.453 55.011 -48.501 1.00173.39 C
ATOM 2145 CG2 VAL A 283 -28.437 55.882 -47.320 1.00172.92 C
ATOM 2146 N TRP A 284 -31.113 58.257 -50.280 1.00174.13 N
ATOM 2147 CA TRP A 284 -32.195 58.557 -51.214 1.00174.07 C
ATOM 2148 C TRP A 284 -31.670 58.594 -52.644 1.00173.51 C
ATOM 2149 O TRP A 284 -32.292 58.055 -53.557 1.00173.76 O
ATOM 2150 CB TRP A 284 -32.863 59.888 -50.870 1.00173.99 C
ATOM 2151 CG TRP A 284 -34.109 59.755 -50.049 1.00173.64 C
ATOM 2152 CD1 TRP A 284 -34.895 58.647 -49.921 1.00173.47 C
ATOM 2153 CD2 TRP A 284 -34.720 60.775 -49.252 1.00172.79 C
ATOM 2154 NE1 TRP A 284 -35.954 58.913 -49.087 1.00173.01 N
ATOM 2155 CE2 TRP A 284 -35.869 60.214 -48.664 1.00172.97 C
ATOM 2156 CE3 TRP A 284 -34.404 62.109 -48.977 1.00172.00 C
ATOM 2157 CZ2 TRP A 284 -36.704 60.938 -47.817 1.00173.05 C
ATOM 2158 CZ3 TRP A 284 -35.232 62.827 -48.137 1.00172.08 C
ATOM 2159 CH2 TRP A 284 -36.369 62.241 -47.566 1.00172.89 C
ATOM 2160 N PHE A 285 -30.517 59.228 -52.828 1.00173.15 N
ATOM 2161 CA PHE A 285 -29.900 59.318 -54.144 1.00173.35 C
ATOM 2162 C PHE A 285 -29.374 57.969 -54.614 1.00173.03 C
ATOM 2163 O PHE A 285 -29.502 57.623 -55.789 1.00173.44 O
ATOM 2164 CB PHE A 285 -28.772 60.347 -54.138 1.00173.62 C
ATOM 2165 CG PHE A 285 -29.246 61.755 -54.332 1.00173.55 C
ATOM 2166 CD1 PHE A 285 -29.849 62.133 -55.519 1.00174.04 C
ATOM 2167 CD2 PHE A 285 -29.094 62.698 -53.331 1.00173.58 C
ATOM 2168 CE1 PHE A 285 -30.292 63.424 -55.706 1.00174.19 C
ATOM 2169 CE2 PHE A 285 -29.535 63.993 -53.512 1.00173.87 C
ATOM 2170 CZ PHE A 285 -30.135 64.356 -54.702 1.00173.94 C
ATOM 2171 N THR A 286 -28.783 57.207 -53.699 1.00172.29 N
ATOM 2172 CA THR A 286 -28.255 55.894 -54.046 1.00172.89 C
ATOM 2173 C THR A 286 -29.405 54.955 -54.405 1.00173.53 C
ATOM 2174 O THR A 286 -29.235 54.035 -55.206 1.00174.51 O
ATOM 2175 CB THR A 286 -27.392 55.295 -52.903 1.00173.34 C
ATOM 2176 OG1 THR A 286 -26.308 54.546 -53.464 1.00174.39 O
ATOM 2177 CG2 THR A 286 -28.205 54.391 -51.986 1.00173.61 C
ATOM 2178 N ALA A 287 -30.575 55.194 -53.816 1.00173.44 N
ATOM 2179 CA ALA A 287 -31.769 54.434 -54.159 1.00173.74 C
ATOM 2180 C ALA A 287 -32.267 54.851 -55.536 1.00173.59 C
ATOM 2181 O ALA A 287 -32.742 54.025 -56.315 1.00173.60 O
ATOM 2182 CB ALA A 287 -32.855 54.635 -53.113 1.00173.98 C
ATOM 2183 N LEU A 288 -32.146 56.142 -55.831 1.00173.43 N
ATOM 2184 CA LEU A 288 -32.534 56.668 -57.134 1.00173.21 C
ATOM 2185 C LEU A 288 -31.524 56.262 -58.194 1.00173.06 C
ATOM 2186 O LEU A 288 -31.836 56.238 -59.382 1.00173.65 O
ATOM 2187 CB LEU A 288 -32.666 58.193 -57.093 1.00173.59 C
ATOM 2188 CG LEU A 288 -33.829 58.765 -56.282 1.00174.44 C
ATOM 2189 CD1 LEU A 288 -33.598 60.237 -55.978 1.00174.60 C
ATOM 2190 CD2 LEU A 288 -35.146 58.567 -57.016 1.00174.47 C
ATOM 2191 N GLY A 289 -30.311 55.946 -57.756 1.00172.63 N
ATOM 2192 CA GLY A 289 -29.269 55.510 -58.665 1.00172.94 C
ATOM 2193 C GLY A 289 -29.610 54.170 -59.279 1.00173.35 C
ATOM 2194 O GLY A 289 -29.589 54.013 -60.497 1.00174.05 O
ATOM 2195 N ILE A 290 -29.935 53.203 -58.429 1.00172.91 N
ATOM 2196 CA ILE A 290 -30.328 51.875 -58.883 1.00173.17 C
ATOM 2197 C ILE A 290 -31.610 51.943 -59.707 1.00173.91 C
ATOM 2198 O ILE A 290 -31.786 51.196 -60.671 1.00174.59 O
ATOM 2199 CB ILE A 290 -30.522 50.919 -57.691 1.00172.75 C
ATOM 2200 CG1 ILE A 290 -29.224 50.816 -56.892 1.00173.68 C
ATOM 2201 CG2 ILE A 290 -30.972 49.542 -58.159 1.00172.72 C
ATOM 2202 CD1 ILE A 290 -28.043 50.362 -57.719 1.00174.01 C
ATOM 2203 N SER A 291 -32.496 52.859 -59.332 1.00173.95 N
ATOM 2204 CA SER A 291 -33.762 53.029 -60.031 1.00174.44 C
ATOM 2205 C SER A 291 -33.591 53.726 -61.380 1.00174.35 C
ATOM 2206 O SER A 291 -34.402 53.544 -62.288 1.00173.92 O
ATOM 2207 CB SER A 291 -34.739 53.817 -59.161 1.00174.24 C
ATOM 2208 OG SER A 291 -35.144 53.057 -58.035 1.00173.85 O
ATOM 2209 N THR A 292 -32.530 54.516 -61.509 1.00174.29 N
ATOM 2210 CA THR A 292 -32.253 55.228 -62.753 1.00174.07 C
ATOM 2211 C THR A 292 -31.504 54.308 -63.705 1.00174.34 C
ATOM 2212 O THR A 292 -31.805 54.245 -64.898 1.00174.63 O
ATOM 2213 CB THR A 292 -31.430 56.512 -62.506 1.00174.46 C
ATOM 2214 OG1 THR A 292 -32.309 57.583 -62.142 1.00175.55 O
ATOM 2215 CG2 THR A 292 -30.640 56.909 -63.746 1.00174.40 C
ATOM 2216 N MET A 293 -30.543 53.570 -63.160 1.00174.48 N
ATOM 2217 CA MET A 293 -29.751 52.638 -63.952 1.00174.11 C
ATOM 2218 C MET A 293 -30.546 51.363 -64.217 1.00173.96 C
ATOM 2219 O MET A 293 -30.029 50.400 -64.783 1.00173.83 O
ATOM 2220 CB MET A 293 -28.435 52.322 -63.239 1.00173.78 C
ATOM 2221 CG MET A 293 -27.639 53.570 -62.885 1.00173.50 C
ATOM 2222 SD MET A 293 -26.258 53.288 -61.763 1.00172.13 S
ATOM 2223 CE MET A 293 -24.915 53.149 -62.933 1.00173.61 C
ATOM 2224 N ALA A 294 -31.810 51.369 -63.801 1.00173.71 N
ATOM 2225 CA ALA A 294 -32.737 50.290 -64.112 1.00173.49 C
ATOM 2226 C ALA A 294 -33.313 50.514 -65.501 1.00173.78 C
ATOM 2227 O ALA A 294 -33.965 49.640 -66.069 1.00173.82 O
ATOM 2228 CB ALA A 294 -33.842 50.218 -63.078 1.00173.39 C
ATOM 2229 N PHE A 295 -33.058 51.703 -66.039 1.00174.22 N
ATOM 2230 CA PHE A 295 -33.497 52.061 -67.377 1.00174.58 C
ATOM 2231 C PHE A 295 -32.276 52.387 -68.226 1.00173.90 C
ATOM 2232 O PHE A 295 -32.365 53.098 -69.230 1.00173.30 O
ATOM 2233 CB PHE A 295 -34.462 53.244 -67.330 1.00174.72 C
ATOM 2234 CG PHE A 295 -35.680 52.993 -66.490 1.00173.89 C
ATOM 2235 CD1 PHE A 295 -35.755 53.476 -65.195 1.00172.97 C
ATOM 2236 CD2 PHE A 295 -36.743 52.259 -66.989 1.00173.90 C
ATOM 2237 CE1 PHE A 295 -36.872 53.244 -64.418 1.00172.93 C
ATOM 2238 CE2 PHE A 295 -37.863 52.024 -66.217 1.00173.90 C
ATOM 2239 CZ PHE A 295 -37.927 52.516 -64.929 1.00173.33 C
ATOM 2240 N ASN A 296 -31.136 51.860 -67.789 1.00173.63 N
ATOM 2241 CA ASN A 296 -29.878 51.931 -68.522 1.00173.43 C
ATOM 2242 C ASN A 296 -29.373 53.350 -68.759 1.00173.62 C
ATOM 2243 O ASN A 296 -28.813 53.650 -69.814 1.00174.47 O
ATOM 2244 CB ASN A 296 -30.012 51.202 -69.857 1.00173.23 C
ATOM 2245 CG ASN A 296 -30.474 49.769 -69.690 1.00173.14 C
ATOM 2246 OD1 ASN A 296 -30.144 49.109 -68.706 1.00173.06 O
ATOM 2247 ND2 ASN A 296 -31.242 49.279 -70.656 1.00173.73 N
ATOM 2248 N LEU A 297 -29.575 54.221 -67.776 1.00173.26 N
ATOM 2249 CA LEU A 297 -28.909 55.516 -67.766 1.00173.45 C
ATOM 2250 C LEU A 297 -27.714 55.397 -66.831 1.00173.68 C
ATOM 2251 O LEU A 297 -27.801 55.712 -65.644 1.00173.59 O
ATOM 2252 CB LEU A 297 -29.855 56.632 -67.322 1.00173.36 C
ATOM 2253 CG LEU A 297 -29.270 58.046 -67.286 1.00172.98 C
ATOM 2254 CD1 LEU A 297 -28.705 58.432 -68.643 1.00172.74 C
ATOM 2255 CD2 LEU A 297 -30.316 59.052 -66.833 1.00173.92 C
ATOM 2256 N ASN A 298 -26.597 54.934 -67.380 1.00173.93 N
ATOM 2257 CA ASN A 298 -25.469 54.504 -66.567 1.00173.91 C
ATOM 2258 C ASN A 298 -24.502 55.621 -66.198 1.00174.14 C
ATOM 2259 O ASN A 298 -24.727 56.790 -66.512 1.00173.92 O
ATOM 2260 CB ASN A 298 -24.706 53.394 -67.294 1.00173.58 C
ATOM 2261 CG ASN A 298 -25.626 52.435 -68.023 1.00173.62 C
ATOM 2262 OD1 ASN A 298 -26.384 51.690 -67.402 1.00173.43 O
ATOM 2263 ND2 ASN A 298 -25.571 52.457 -69.350 1.00173.86 N
ATOM 2264 N GLY A 299 -23.420 55.236 -65.528 1.00174.59 N
ATOM 2265 CA GLY A 299 -22.411 56.173 -65.074 1.00174.55 C
ATOM 2266 C GLY A 299 -21.587 56.710 -66.223 1.00173.68 C
ATOM 2267 O GLY A 299 -21.722 56.252 -67.356 1.00172.68 O
ATOM 2268 N PHE A 300 -20.731 57.681 -65.923 1.00174.01 N
ATOM 2269 CA PHE A 300 -19.921 58.343 -66.939 1.00174.26 C
ATOM 2270 C PHE A 300 -19.036 57.368 -67.709 1.00174.74 C
ATOM 2271 O PHE A 300 -18.435 56.462 -67.131 1.00174.78 O
ATOM 2272 CB PHE A 300 -19.053 59.428 -66.301 1.00174.45 C
ATOM 2273 CG PHE A 300 -19.837 60.559 -65.705 1.00173.62 C
ATOM 2274 CD1 PHE A 300 -19.970 60.680 -64.333 1.00173.24 C
ATOM 2275 CD2 PHE A 300 -20.435 61.506 -66.517 1.00174.06 C
ATOM 2276 CE1 PHE A 300 -20.687 61.723 -63.783 1.00173.04 C
ATOM 2277 CE2 PHE A 300 -21.158 62.548 -65.972 1.00174.35 C
ATOM 2278 CZ PHE A 300 -21.282 62.658 -64.603 1.00173.49 C
ATOM 2279 N ASN A 301 -18.966 57.564 -69.021 1.00174.26 N
ATOM 2280 CA ASN A 301 -18.153 56.721 -69.884 1.00173.13 C
ATOM 2281 C ASN A 301 -16.977 57.507 -70.457 1.00172.86 C
ATOM 2282 O ASN A 301 -17.092 58.122 -71.517 1.00172.40 O
ATOM 2283 CB ASN A 301 -19.014 56.139 -71.010 1.00173.36 C
ATOM 2284 CG ASN A 301 -18.323 55.018 -71.766 1.00174.23 C
ATOM 2285 OD1 ASN A 301 -17.097 54.972 -71.859 1.00174.61 O
ATOM 2286 ND2 ASN A 301 -19.115 54.105 -72.317 1.00174.73 N
ATOM 2287 N PHE A 302 -15.851 57.492 -69.750 1.00173.15 N
ATOM 2288 CA PHE A 302 -14.656 58.196 -70.208 1.00174.21 C
ATOM 2289 C PHE A 302 -13.667 57.266 -70.905 1.00175.06 C
ATOM 2290 O PHE A 302 -12.455 57.468 -70.825 1.00175.06 O
ATOM 2291 CB PHE A 302 -13.957 58.899 -69.040 1.00173.82 C
ATOM 2292 CG PHE A 302 -14.801 59.938 -68.360 1.00174.13 C
ATOM 2293 CD1 PHE A 302 -15.088 59.840 -67.010 1.00175.01 C
ATOM 2294 CD2 PHE A 302 -15.304 61.015 -69.072 1.00174.06 C
ATOM 2295 CE1 PHE A 302 -15.860 60.799 -66.380 1.00175.66 C
ATOM 2296 CE2 PHE A 302 -16.079 61.976 -68.449 1.00174.35 C
ATOM 2297 CZ PHE A 302 -16.358 61.866 -67.100 1.00175.31 C
ATOM 2298 N ASN A 303 -14.184 56.246 -71.582 1.00175.24 N
ATOM 2299 CA ASN A 303 -13.331 55.305 -72.298 1.00174.64 C
ATOM 2300 C ASN A 303 -12.751 55.920 -73.567 1.00173.86 C
ATOM 2301 O ASN A 303 -13.489 56.408 -74.426 1.00173.20 O
ATOM 2302 CB ASN A 303 -14.101 54.027 -72.632 1.00175.14 C
ATOM 2303 CG ASN A 303 -14.511 53.253 -71.392 1.00174.33 C
ATOM 2304 OD1 ASN A 303 -13.708 53.047 -70.481 1.00172.68 O
ATOM 2305 ND2 ASN A 303 -15.765 52.819 -71.353 1.00174.61 N
ATOM 2306 N HIS A 304 -11.423 55.902 -73.661 1.00173.85 N
ATOM 2307 CA HIS A 304 -10.697 56.446 -74.807 1.00174.44 C
ATOM 2308 C HIS A 304 -10.974 57.935 -74.980 1.00174.32 C
ATOM 2309 O HIS A 304 -11.142 58.418 -76.099 1.00175.23 O
ATOM 2310 CB HIS A 304 -11.053 55.687 -76.091 1.00174.44 C
ATOM 2311 CG HIS A 304 -10.572 54.269 -76.111 1.00173.92 C
ATOM 2312 ND1 HIS A 304 -10.462 53.538 -77.274 1.00173.47 N
ATOM 2313 CD2 HIS A 304 -10.171 53.447 -75.112 1.00173.78 C
ATOM 2314 CE1 HIS A 304 -10.013 52.328 -76.991 1.00173.47 C
ATOM 2315 NE2 HIS A 304 -9.829 52.247 -75.686 1.00172.83 N
ATOM 2316 N SER A 305 -11.021 58.658 -73.866 1.00173.30 N
ATOM 2317 CA SER A 305 -11.273 60.093 -73.905 1.00173.67 C
ATOM 2318 C SER A 305 -10.031 60.877 -74.311 1.00173.97 C
ATOM 2319 O SER A 305 -9.975 61.444 -75.402 1.00175.07 O
ATOM 2320 CB SER A 305 -11.778 60.585 -72.549 1.00174.40 C
ATOM 2321 OG SER A 305 -13.057 60.048 -72.266 1.00175.64 O
ATOM 2322 N VAL A 306 -9.039 60.911 -73.430 1.00173.79 N
ATOM 2323 CA VAL A 306 -7.799 61.621 -73.716 1.00174.81 C
ATOM 2324 C VAL A 306 -6.943 60.856 -74.727 1.00174.59 C
ATOM 2325 O VAL A 306 -6.509 59.729 -74.476 1.00173.93 O
ATOM 2326 CB VAL A 306 -6.988 61.879 -72.426 1.00175.07 C
ATOM 2327 CG1 VAL A 306 -7.009 60.658 -71.524 1.00175.06 C
ATOM 2328 CG2 VAL A 306 -5.561 62.296 -72.759 1.00174.99 C
ATOM 2329 N ILE A 307 -6.728 61.475 -75.884 1.00174.71 N
ATOM 2330 CA ILE A 307 -5.886 60.907 -76.931 1.00174.22 C
ATOM 2331 C ILE A 307 -4.808 61.911 -77.331 1.00174.86 C
ATOM 2332 O ILE A 307 -4.994 63.119 -77.184 1.00175.33 O
ATOM 2333 CB ILE A 307 -6.713 60.496 -78.168 1.00173.51 C
ATOM 2334 CG1 ILE A 307 -7.353 61.720 -78.824 1.00173.48 C
ATOM 2335 CG2 ILE A 307 -7.793 59.502 -77.779 1.00173.37 C
ATOM 2336 CD1 ILE A 307 -8.171 61.389 -80.053 1.00173.47 C
ATOM 2337 N ASP A 308 -3.679 61.413 -77.826 1.00174.96 N
ATOM 2338 CA ASP A 308 -2.539 62.276 -78.122 1.00174.85 C
ATOM 2339 C ASP A 308 -2.675 62.955 -79.487 1.00174.48 C
ATOM 2340 O ASP A 308 -3.681 62.783 -80.176 1.00174.32 O
ATOM 2341 CB ASP A 308 -1.231 61.478 -78.041 1.00174.58 C
ATOM 2342 CG ASP A 308 -0.973 60.638 -79.277 1.00174.21 C
ATOM 2343 OD1 ASP A 308 -1.948 60.164 -79.897 1.00174.35 O
ATOM 2344 OD2 ASP A 308 0.212 60.447 -79.626 1.00173.59 O
ATOM 2345 N ALA A 309 -1.656 63.721 -79.867 1.00174.57 N
ATOM 2346 CA ALA A 309 -1.699 64.538 -81.080 1.00174.43 C
ATOM 2347 C ALA A 309 -1.855 63.722 -82.362 1.00174.57 C
ATOM 2348 O ALA A 309 -2.325 64.240 -83.375 1.00174.61 O
ATOM 2349 CB ALA A 309 -0.450 65.401 -81.166 1.00174.71 C
ATOM 2350 N LYS A 310 -1.461 62.453 -82.322 1.00174.66 N
ATOM 2351 CA LYS A 310 -1.524 61.611 -83.512 1.00174.48 C
ATOM 2352 C LYS A 310 -2.864 60.888 -83.584 1.00174.14 C
ATOM 2353 O LYS A 310 -3.380 60.617 -84.670 1.00174.06 O
ATOM 2354 CB LYS A 310 -0.371 60.601 -83.526 1.00174.66 C
ATOM 2355 CG LYS A 310 -0.376 59.663 -84.729 1.00174.75 C
ATOM 2356 CD LYS A 310 0.777 58.669 -84.682 1.00174.92 C
ATOM 2357 CE LYS A 310 0.756 57.744 -85.892 1.00173.58 C
ATOM 2358 NZ LYS A 310 1.843 56.726 -85.845 1.00172.83 N
ATOM 2359 N GLY A 311 -3.434 60.596 -82.420 1.00174.00 N
ATOM 2360 CA GLY A 311 -4.688 59.869 -82.348 1.00173.97 C
ATOM 2361 C GLY A 311 -4.606 58.634 -81.474 1.00174.35 C
ATOM 2362 O GLY A 311 -5.620 57.984 -81.219 1.00174.05 O
ATOM 2363 N ASN A 312 -3.397 58.302 -81.025 1.00174.84 N
ATOM 2364 CA ASN A 312 -3.198 57.178 -80.114 1.00174.50 C
ATOM 2365 C ASN A 312 -4.016 57.360 -78.845 1.00173.43 C
ATOM 2366 O ASN A 312 -4.197 58.480 -78.371 1.00173.61 O
ATOM 2367 CB ASN A 312 -1.719 57.018 -79.756 1.00174.31 C
ATOM 2368 CG ASN A 312 -0.855 56.715 -80.962 1.00174.88 C
ATOM 2369 OD1 ASN A 312 -1.156 55.814 -81.746 1.00175.11 O
ATOM 2370 ND2 ASN A 312 0.232 57.463 -81.114 1.00174.80 N
ATOM 2371 N VAL A 313 -4.501 56.257 -78.290 1.00172.62 N
ATOM 2372 CA VAL A 313 -5.323 56.324 -77.092 1.00172.72 C
ATOM 2373 C VAL A 313 -4.457 56.321 -75.843 1.00173.34 C
ATOM 2374 O VAL A 313 -3.748 55.353 -75.568 1.00173.89 O
ATOM 2375 CB VAL A 313 -6.314 55.152 -77.022 1.00172.85 C
ATOM 2376 CG1 VAL A 313 -7.174 55.260 -75.772 1.00173.94 C
ATOM 2377 CG2 VAL A 313 -7.179 55.119 -78.272 1.00173.17 C
ATOM 2378 N ILE A 314 -4.518 57.413 -75.089 1.00173.13 N
ATOM 2379 CA ILE A 314 -3.783 57.517 -73.838 1.00173.28 C
ATOM 2380 C ILE A 314 -4.694 57.110 -72.690 1.00174.01 C
ATOM 2381 O ILE A 314 -5.662 57.802 -72.375 1.00174.46 O
ATOM 2382 CB ILE A 314 -3.251 58.941 -73.601 1.00173.77 C
ATOM 2383 CG1 ILE A 314 -2.360 59.379 -74.764 1.00173.98 C
ATOM 2384 CG2 ILE A 314 -2.482 59.010 -72.291 1.00174.55 C
ATOM 2385 CD1 ILE A 314 -1.184 58.460 -75.011 1.00174.54 C
ATOM 2386 N ASN A 315 -4.378 55.978 -72.071 1.00174.27 N
ATOM 2387 CA ASN A 315 -5.224 55.409 -71.031 1.00174.55 C
ATOM 2388 C ASN A 315 -5.261 56.229 -69.745 1.00173.68 C
ATOM 2389 O ASN A 315 -4.305 56.925 -69.402 1.00173.10 O
ATOM 2390 CB ASN A 315 -4.766 53.985 -70.711 1.00174.43 C
ATOM 2391 CG ASN A 315 -5.166 52.989 -71.779 1.00174.17 C
ATOM 2392 OD1 ASN A 315 -6.074 53.243 -72.572 1.00174.26 O
ATOM 2393 ND2 ASN A 315 -4.492 51.846 -71.805 1.00173.83 N
ATOM 2394 N THR A 316 -6.382 56.132 -69.039 1.00173.30 N
ATOM 2395 CA THR A 316 -6.525 56.709 -67.710 1.00173.16 C
ATOM 2396 C THR A 316 -6.953 55.610 -66.752 1.00173.57 C
ATOM 2397 O THR A 316 -7.043 54.445 -67.139 1.00173.63 O
ATOM 2398 CB THR A 316 -7.555 57.852 -67.679 1.00173.40 C
ATOM 2399 OG1 THR A 316 -8.743 57.450 -68.370 1.00172.96 O
ATOM 2400 CG2 THR A 316 -6.990 59.090 -68.341 1.00172.89 C
ATOM 2401 N TRP A 317 -7.209 55.973 -65.502 1.00173.35 N
ATOM 2402 CA TRP A 317 -7.724 55.009 -64.540 1.00172.64 C
ATOM 2403 C TRP A 317 -9.114 54.536 -64.945 1.00173.09 C
ATOM 2404 O TRP A 317 -9.521 53.427 -64.608 1.00173.00 O
ATOM 2405 CB TRP A 317 -7.755 55.613 -63.138 1.00172.36 C
ATOM 2406 CG TRP A 317 -6.398 55.795 -62.555 1.00171.97 C
ATOM 2407 CD1 TRP A 317 -5.771 56.975 -62.291 1.00172.37 C
ATOM 2408 CD2 TRP A 317 -5.484 54.759 -62.177 1.00171.71 C
ATOM 2409 NE1 TRP A 317 -4.526 56.740 -61.761 1.00173.02 N
ATOM 2410 CE2 TRP A 317 -4.326 55.388 -61.682 1.00172.25 C
ATOM 2411 CE3 TRP A 317 -5.536 53.364 -62.204 1.00171.63 C
ATOM 2412 CZ2 TRP A 317 -3.228 54.667 -61.219 1.00172.44 C
ATOM 2413 CZ3 TRP A 317 -4.445 52.653 -61.747 1.00171.81 C
ATOM 2414 CH2 TRP A 317 -3.310 53.303 -61.258 1.00172.24 C
ATOM 2415 N ALA A 318 -9.827 55.378 -65.686 1.00173.90 N
ATOM 2416 CA ALA A 318 -11.156 55.037 -66.183 1.00174.63 C
ATOM 2417 C ALA A 318 -11.088 53.872 -67.163 1.00174.46 C
ATOM 2418 O ALA A 318 -12.019 53.072 -67.262 1.00175.02 O
ATOM 2419 CB ALA A 318 -11.803 56.247 -66.841 1.00174.75 C
ATOM 2420 N ASP A 319 -9.978 53.785 -67.887 1.00173.84 N
ATOM 2421 CA ASP A 319 -9.765 52.700 -68.834 1.00173.61 C
ATOM 2422 C ASP A 319 -9.413 51.408 -68.102 1.00173.49 C
ATOM 2423 O ASP A 319 -9.869 50.329 -68.480 1.00173.46 O
ATOM 2424 CB ASP A 319 -8.667 53.070 -69.831 1.00174.18 C
ATOM 2425 CG ASP A 319 -9.092 54.176 -70.777 1.00173.89 C
ATOM 2426 OD1 ASP A 319 -8.666 55.332 -70.572 1.00174.14 O
ATOM 2427 OD2 ASP A 319 -9.864 53.892 -71.718 1.00173.46 O
ATOM 2428 N ILE A 320 -8.599 51.527 -67.056 1.00172.98 N
ATOM 2429 CA ILE A 320 -8.238 50.382 -66.225 1.00172.57 C
ATOM 2430 C ILE A 320 -9.485 49.791 -65.575 1.00172.36 C
ATOM 2431 O ILE A 320 -9.581 48.582 -65.364 1.00172.41 O
ATOM 2432 CB ILE A 320 -7.217 50.777 -65.134 1.00172.50 C
ATOM 2433 CG1 ILE A 320 -5.969 51.392 -65.770 1.00174.02 C
ATOM 2434 CG2 ILE A 320 -6.844 49.576 -64.272 1.00171.90 C
ATOM 2435 CD1 ILE A 320 -5.351 50.536 -66.857 1.00175.19 C
ATOM 2436 N ILE A 321 -10.448 50.658 -65.278 1.00172.24 N
ATOM 2437 CA ILE A 321 -11.722 50.230 -64.719 1.00172.16 C
ATOM 2438 C ILE A 321 -12.509 49.446 -65.760 1.00172.84 C
ATOM 2439 O ILE A 321 -13.161 48.448 -65.447 1.00172.78 O
ATOM 2440 CB ILE A 321 -12.558 51.436 -64.241 1.00172.14 C
ATOM 2441 CG1 ILE A 321 -11.882 52.119 -63.055 1.00173.68 C
ATOM 2442 CG2 ILE A 321 -13.969 51.011 -63.869 1.00172.15 C
ATOM 2443 CD1 ILE A 321 -12.623 53.337 -62.551 1.00174.19 C
ATOM 2444 N ASN A 322 -12.415 49.893 -67.008 1.00173.81 N
ATOM 2445 CA ASN A 322 -13.154 49.281 -68.103 1.00174.03 C
ATOM 2446 C ASN A 322 -12.697 47.855 -68.382 1.00173.96 C
ATOM 2447 O ASN A 322 -13.507 46.992 -68.723 1.00173.84 O
ATOM 2448 CB ASN A 322 -13.021 50.123 -69.370 1.00173.06 C
ATOM 2449 CG ASN A 322 -14.192 49.940 -70.309 1.00172.14 C
ATOM 2450 OD1 ASN A 322 -15.345 49.952 -69.884 1.00171.24 O
ATOM 2451 ND2 ASN A 322 -13.903 49.763 -71.592 1.00173.28 N
ATOM 2452 N ARG A 323 -11.396 47.618 -68.243 1.00174.00 N
ATOM 2453 CA ARG A 323 -10.833 46.285 -68.423 1.00174.53 C
ATOM 2454 C ARG A 323 -11.399 45.320 -67.389 1.00174.21 C
ATOM 2455 O ARG A 323 -11.803 44.206 -67.723 1.00174.96 O
ATOM 2456 CB ARG A 323 -9.307 46.327 -68.334 1.00174.52 C
ATOM 2457 CG ARG A 323 -8.650 47.151 -69.426 1.00174.37 C
ATOM 2458 CD ARG A 323 -8.988 46.603 -70.803 1.00174.38 C
ATOM 2459 NE ARG A 323 -8.571 45.212 -70.955 1.00174.31 N
ATOM 2460 CZ ARG A 323 -8.656 44.528 -72.090 1.00174.44 C
ATOM 2461 NH1 ARG A 323 -9.145 45.106 -73.180 1.00173.95 N
ATOM 2462 NH2 ARG A 323 -8.251 43.266 -72.138 1.00174.87 N
ATOM 2463 N ALA A 324 -11.419 45.754 -66.133 1.00173.27 N
ATOM 2464 CA ALA A 324 -12.017 44.970 -65.060 1.00173.34 C
ATOM 2465 C ALA A 324 -13.492 44.712 -65.344 1.00173.65 C
ATOM 2466 O ALA A 324 -14.003 43.624 -65.083 1.00173.99 O
ATOM 2467 CB ALA A 324 -11.848 45.677 -63.726 1.00173.46 C
ATOM 2468 N ASN A 325 -14.166 45.720 -65.888 1.00173.40 N
ATOM 2469 CA ASN A 325 -15.586 45.615 -66.206 1.00173.62 C
ATOM 2470 C ASN A 325 -15.844 44.606 -67.316 1.00173.14 C
ATOM 2471 O ASN A 325 -16.814 43.849 -67.269 1.00172.73 O
ATOM 2472 CB ASN A 325 -16.146 46.980 -66.608 1.00174.29 C
ATOM 2473 CG ASN A 325 -16.336 47.906 -65.423 1.00174.97 C
ATOM 2474 OD1 ASN A 325 -16.677 47.466 -64.325 1.00175.90 O
ATOM 2475 ND2 ASN A 325 -16.124 49.199 -65.642 1.00174.32 N
ATOM 2476 N LEU A 326 -14.972 44.612 -68.318 1.00173.21 N
ATOM 2477 CA LEU A 326 -15.061 43.671 -69.426 1.00173.23 C
ATOM 2478 C LEU A 326 -14.995 42.232 -68.932 1.00172.99 C
ATOM 2479 O LEU A 326 -15.805 41.397 -69.327 1.00172.79 O
ATOM 2480 CB LEU A 326 -13.944 43.933 -70.435 1.00173.49 C
ATOM 2481 CG LEU A 326 -14.166 45.095 -71.400 1.00173.50 C
ATOM 2482 CD1 LEU A 326 -12.906 45.368 -72.204 1.00173.98 C
ATOM 2483 CD2 LEU A 326 -15.327 44.777 -72.322 1.00174.19 C
ATOM 2484 N GLY A 327 -14.033 41.959 -68.056 1.00173.24 N
ATOM 2485 CA GLY A 327 -13.866 40.639 -67.477 1.00173.56 C
ATOM 2486 C GLY A 327 -15.123 40.133 -66.800 1.00173.32 C
ATOM 2487 O GLY A 327 -15.472 38.959 -66.914 1.00173.16 O
ATOM 2488 N MET A 328 -15.805 41.028 -66.094 1.00173.52 N
ATOM 2489 CA MET A 328 -17.057 40.685 -65.436 1.00174.03 C
ATOM 2490 C MET A 328 -18.127 40.394 -66.482 1.00173.47 C
ATOM 2491 O MET A 328 -18.799 39.364 -66.432 1.00174.11 O
ATOM 2492 CB MET A 328 -17.512 41.814 -64.512 1.00174.02 C
ATOM 2493 CG MET A 328 -16.505 42.216 -63.447 1.00173.52 C
ATOM 2494 SD MET A 328 -17.013 43.694 -62.543 1.00173.40 S
ATOM 2495 CE MET A 328 -15.459 44.573 -62.421 1.00173.28 C
ATOM 2496 N GLU A 329 -18.273 41.316 -67.429 1.00172.59 N
ATOM 2497 CA GLU A 329 -19.231 41.180 -68.521 1.00173.11 C
ATOM 2498 C GLU A 329 -19.002 39.906 -69.324 1.00172.82 C
ATOM 2499 O GLU A 329 -19.901 39.084 -69.490 1.00172.92 O
ATOM 2500 CB GLU A 329 -19.151 42.396 -69.444 1.00173.76 C
ATOM 2501 CG GLU A 329 -19.965 42.263 -70.719 1.00173.17 C
ATOM 2502 CD GLU A 329 -19.838 43.476 -71.617 1.00171.98 C
ATOM 2503 OE1 GLU A 329 -20.147 44.596 -71.159 1.00171.64 O
ATOM 2504 OE2 GLU A 329 -19.424 43.307 -72.782 1.00171.51 O
ATOM 2505 N VAL A 330 -17.782 39.754 -69.820 1.00172.84 N
ATOM 2506 CA VAL A 330 -17.417 38.621 -70.660 1.00173.59 C
ATOM 2507 C VAL A 330 -17.658 37.262 -69.984 1.00173.07 C
ATOM 2508 O VAL A 330 -17.978 36.280 -70.654 1.00174.00 O
ATOM 2509 CB VAL A 330 -15.933 38.747 -71.092 1.00174.49 C
ATOM 2510 CG1 VAL A 330 -15.398 37.444 -71.622 1.00173.75 C
ATOM 2511 CG2 VAL A 330 -15.782 39.839 -72.140 1.00174.66 C
ATOM 2512 N MET A 331 -17.567 37.217 -68.658 1.00172.01 N
ATOM 2513 CA MET A 331 -17.627 35.941 -67.946 1.00172.15 C
ATOM 2514 C MET A 331 -18.961 35.642 -67.258 1.00172.74 C
ATOM 2515 O MET A 331 -19.258 34.484 -66.958 1.00172.04 O
ATOM 2516 CB MET A 331 -16.510 35.875 -66.905 1.00172.38 C
ATOM 2517 CG MET A 331 -15.143 35.590 -67.494 1.00172.56 C
ATOM 2518 SD MET A 331 -15.101 34.000 -68.337 1.00172.96 S
ATOM 2519 CE MET A 331 -15.510 32.898 -66.989 1.00173.65 C
ATOM 2520 N HIS A 332 -19.765 36.671 -67.011 1.00173.33 N
ATOM 2521 CA HIS A 332 -21.021 36.476 -66.293 1.00173.32 C
ATOM 2522 C HIS A 332 -22.051 35.763 -67.161 1.00172.61 C
ATOM 2523 O HIS A 332 -22.173 36.045 -68.354 1.00173.16 O
ATOM 2524 CB HIS A 332 -21.586 37.813 -65.807 1.00173.79 C
ATOM 2525 CG HIS A 332 -22.332 38.574 -66.857 1.00173.78 C
ATOM 2526 ND1 HIS A 332 -21.747 38.989 -68.034 1.00174.06 N
ATOM 2527 CD2 HIS A 332 -23.620 38.990 -66.910 1.00173.30 C
ATOM 2528 CE1 HIS A 332 -22.640 39.632 -68.764 1.00174.09 C
ATOM 2529 NE2 HIS A 332 -23.784 39.645 -68.106 1.00173.10 N
ATOM 2530 N GLU A 333 -22.785 34.840 -66.543 1.00172.28 N
ATOM 2531 CA GLU A 333 -23.835 34.076 -67.215 1.00172.97 C
ATOM 2532 C GLU A 333 -23.319 33.429 -68.489 1.00173.37 C
ATOM 2533 O GLU A 333 -23.825 33.696 -69.580 1.00173.41 O
ATOM 2534 CB GLU A 333 -25.042 34.954 -67.534 1.00173.17 C
ATOM 2535 CG GLU A 333 -25.436 35.917 -66.438 1.00172.85 C
ATOM 2536 CD GLU A 333 -26.935 36.107 -66.365 1.00172.94 C
ATOM 2537 OE1 GLU A 333 -27.566 36.277 -67.428 1.00173.54 O
ATOM 2538 OE2 GLU A 333 -27.483 36.099 -65.243 1.00172.16 O
ATOM 2539 N ARG A 334 -22.286 32.611 -68.316 1.00173.20 N
ATOM 2540 CA ARG A 334 -21.631 31.838 -69.368 1.00172.74 C
ATOM 2541 C ARG A 334 -22.505 31.471 -70.561 1.00171.99 C
ATOM 2542 O ARG A 334 -22.340 32.004 -71.658 1.00172.03 O
ATOM 2543 CB ARG A 334 -21.087 30.548 -68.764 1.00172.84 C
ATOM 2544 CG ARG A 334 -19.993 30.734 -67.738 1.00172.65 C
ATOM 2545 CD ARG A 334 -19.953 29.523 -66.837 1.00173.38 C
ATOM 2546 NE ARG A 334 -21.130 29.481 -65.977 1.00173.43 N
ATOM 2547 CZ ARG A 334 -21.684 28.362 -65.525 1.00173.33 C
ATOM 2548 NH1 ARG A 334 -21.181 27.188 -65.870 1.00172.85 N
ATOM 2549 NH2 ARG A 334 -22.754 28.418 -64.743 1.00173.22 N
ATOM 2550 N ASN A 335 -23.438 30.556 -70.327 1.00171.30 N
ATOM 2551 CA ASN A 335 -24.206 29.931 -71.395 1.00172.31 C
ATOM 2552 C ASN A 335 -25.545 30.611 -71.669 1.00172.78 C
ATOM 2553 O ASN A 335 -26.399 30.061 -72.367 1.00174.06 O
ATOM 2554 CB ASN A 335 -24.424 28.457 -71.063 1.00172.31 C
ATOM 2555 CG ASN A 335 -23.193 27.817 -70.450 1.00172.46 C
ATOM 2556 OD1 ASN A 335 -22.225 27.515 -71.146 1.00172.69 O
ATOM 2557 ND2 ASN A 335 -23.222 27.612 -69.139 1.00173.25 N
ATOM 2558 N ALA A 336 -25.731 31.804 -71.118 1.00171.85 N
ATOM 2559 CA ALA A 336 -27.002 32.507 -71.251 1.00171.88 C
ATOM 2560 C ALA A 336 -27.092 33.335 -72.532 1.00172.81 C
ATOM 2561 O ALA A 336 -28.187 33.668 -72.983 1.00173.39 O
ATOM 2562 CB ALA A 336 -27.234 33.394 -70.040 1.00172.82 C
ATOM 2563 N HIS A 337 -25.944 33.672 -73.112 1.00172.53 N
ATOM 2564 CA HIS A 337 -25.913 34.547 -74.282 1.00172.31 C
ATOM 2565 C HIS A 337 -25.666 33.804 -75.594 1.00172.86 C
ATOM 2566 O HIS A 337 -24.839 32.895 -75.663 1.00172.60 O
ATOM 2567 CB HIS A 337 -24.851 35.629 -74.097 1.00171.75 C
ATOM 2568 CG HIS A 337 -25.036 36.445 -72.858 1.00172.54 C
ATOM 2569 ND1 HIS A 337 -24.758 35.959 -71.599 1.00173.65 N
ATOM 2570 CD2 HIS A 337 -25.486 37.710 -72.683 1.00173.31 C
ATOM 2571 CE1 HIS A 337 -25.019 36.892 -70.702 1.00174.11 C
ATOM 2572 NE2 HIS A 337 -25.464 37.964 -71.333 1.00173.93 N
ATOM 2573 N ASN A 338 -26.391 34.212 -76.632 1.00173.42 N
ATOM 2574 CA ASN A 338 -26.237 33.646 -77.966 1.00173.03 C
ATOM 2575 C ASN A 338 -25.860 34.714 -78.983 1.00172.48 C
ATOM 2576 O ASN A 338 -25.441 34.406 -80.097 1.00171.97 O
ATOM 2577 CB ASN A 338 -27.526 32.949 -78.406 1.00172.94 C
ATOM 2578 CG ASN A 338 -27.802 31.683 -77.622 1.00173.96 C
ATOM 2579 OD1 ASN A 338 -26.932 31.176 -76.914 1.00174.35 O
ATOM 2580 ND2 ASN A 338 -29.020 31.165 -77.742 1.00174.16 N
ATOM 2581 N PHE A 339 -26.007 35.972 -78.585 1.00172.55 N
ATOM 2582 CA PHE A 339 -25.835 37.097 -79.496 1.00173.10 C
ATOM 2583 C PHE A 339 -24.850 38.126 -78.930 1.00173.55 C
ATOM 2584 O PHE A 339 -24.695 38.227 -77.715 1.00174.17 O
ATOM 2585 CB PHE A 339 -27.200 37.733 -79.779 1.00173.16 C
ATOM 2586 CG PHE A 339 -28.205 36.768 -80.342 1.00173.52 C
ATOM 2587 CD1 PHE A 339 -29.483 36.692 -79.818 1.00173.13 C
ATOM 2588 CD2 PHE A 339 -27.870 35.938 -81.401 1.00174.17 C
ATOM 2589 CE1 PHE A 339 -30.408 35.802 -80.334 1.00173.25 C
ATOM 2590 CE2 PHE A 339 -28.790 35.046 -81.921 1.00174.14 C
ATOM 2591 CZ PHE A 339 -30.060 34.979 -81.388 1.00173.67 C
ATOM 2592 N PRO A 340 -24.178 38.885 -79.816 1.00173.85 N
ATOM 2593 CA PRO A 340 -23.107 39.823 -79.452 1.00174.03 C
ATOM 2594 C PRO A 340 -23.457 40.831 -78.360 1.00173.44 C
ATOM 2595 O PRO A 340 -22.706 40.951 -77.392 1.00172.95 O
ATOM 2596 CB PRO A 340 -22.836 40.548 -80.770 1.00174.57 C
ATOM 2597 CG PRO A 340 -23.113 39.522 -81.793 1.00174.38 C
ATOM 2598 CD PRO A 340 -24.333 38.806 -81.281 1.00174.24 C
ATOM 2599 N LEU A 341 -24.568 41.544 -78.511 1.00173.04 N
ATOM 2600 CA LEU A 341 -24.903 42.600 -77.561 1.00172.23 C
ATOM 2601 C LEU A 341 -25.777 42.094 -76.425 1.00172.01 C
ATOM 2602 O LEU A 341 -26.746 41.369 -76.643 1.00171.86 O
ATOM 2603 CB LEU A 341 -25.608 43.762 -78.263 1.00172.60 C
ATOM 2604 CG LEU A 341 -24.935 44.317 -79.516 1.00173.15 C
ATOM 2605 CD1 LEU A 341 -25.786 45.411 -80.127 1.00173.81 C
ATOM 2606 CD2 LEU A 341 -23.550 44.839 -79.178 1.00173.32 C
ATOM 2607 N ASP A 342 -25.427 42.490 -75.208 1.00172.09 N
ATOM 2608 CA ASP A 342 -26.223 42.149 -74.040 1.00173.21 C
ATOM 2609 C ASP A 342 -27.282 43.219 -73.805 1.00173.58 C
ATOM 2610 O ASP A 342 -27.050 44.182 -73.073 1.00173.69 O
ATOM 2611 CB ASP A 342 -25.335 41.999 -72.805 1.00173.82 C
ATOM 2612 CG ASP A 342 -26.041 41.295 -71.669 1.00173.06 C
ATOM 2613 OD1 ASP A 342 -27.234 40.973 -71.835 1.00172.68 O
ATOM 2614 OD2 ASP A 342 -25.413 41.063 -70.614 1.00172.51 O
ATOM 2615 N LEU A 343 -28.446 43.047 -74.423 1.00173.59 N
ATOM 2616 CA LEU A 343 -29.506 44.045 -74.323 1.00173.68 C
ATOM 2617 C LEU A 343 -30.721 43.554 -73.555 1.00173.96 C
ATOM 2618 O LEU A 343 -31.851 43.822 -73.963 1.00175.36 O
ATOM 2619 CB LEU A 343 -29.956 44.471 -75.716 1.00174.27 C
ATOM 2620 CG LEU A 343 -28.867 44.833 -76.718 1.00174.77 C
ATOM 2621 CD1 LEU A 343 -29.478 44.986 -78.104 1.00175.44 C
ATOM 2622 CD2 LEU A 343 -28.157 46.100 -76.296 1.00174.37 C
ATOM 2623 N ALA A 344 -30.495 42.872 -72.437 1.00173.29 N
ATOM 2624 CA ALA A 344 -31.584 42.257 -71.690 1.00174.06 C
ATOM 2625 C ALA A 344 -31.078 41.618 -70.413 1.00173.63 C
ATOM 2626 O ALA A 344 -30.859 42.293 -69.412 1.00172.48 O
ATOM 2627 CB ALA A 344 -32.289 41.209 -72.548 1.00175.76 C
ATOM 2628 OXT ALA A 344 -30.847 40.411 -70.382 1.00174.37 O
TER 2629 ALA A 344
ATOM 2630 N GLY B 2 -21.731 47.305 -9.386 1.00174.69 N
ATOM 2631 CA GLY B 2 -20.340 47.587 -9.082 1.00174.83 C
ATOM 2632 C GLY B 2 -19.492 47.762 -10.326 1.00174.53 C
ATOM 2633 O GLY B 2 -19.807 48.577 -11.194 1.00173.84 O
ATOM 2634 N LEU B 3 -18.408 46.996 -10.408 1.00174.53 N
ATOM 2635 CA LEU B 3 -17.497 47.068 -11.545 1.00174.86 C
ATOM 2636 C LEU B 3 -18.057 46.380 -12.787 1.00175.69 C
ATOM 2637 O LEU B 3 -18.611 45.282 -12.700 1.00174.71 O
ATOM 2638 CB LEU B 3 -16.144 46.447 -11.187 1.00173.82 C
ATOM 2639 CG LEU B 3 -15.199 47.282 -10.322 1.00173.56 C
ATOM 2640 CD1 LEU B 3 -14.004 46.447 -9.887 1.00174.29 C
ATOM 2641 CD2 LEU B 3 -14.746 48.531 -11.065 1.00172.98 C
ATOM 2642 N PRO B 4 -17.911 47.029 -13.953 1.00176.46 N
ATOM 2643 CA PRO B 4 -18.227 46.416 -15.247 1.00174.63 C
ATOM 2644 C PRO B 4 -17.278 45.263 -15.548 1.00174.62 C
ATOM 2645 O PRO B 4 -16.184 45.217 -14.987 1.00175.34 O
ATOM 2646 CB PRO B 4 -18.027 47.565 -16.239 1.00173.81 C
ATOM 2647 CG PRO B 4 -18.183 48.804 -15.420 1.00174.55 C
ATOM 2648 CD PRO B 4 -17.576 48.455 -14.096 1.00175.78 C
ATOM 2649 N TRP B 5 -17.691 44.350 -16.421 1.00174.36 N
ATOM 2650 CA TRP B 5 -16.897 43.163 -16.730 1.00174.77 C
ATOM 2651 C TRP B 5 -15.516 43.514 -17.288 1.00174.50 C
ATOM 2652 O TRP B 5 -14.533 42.832 -17.003 1.00175.43 O
ATOM 2653 CB TRP B 5 -17.651 42.262 -17.711 1.00174.65 C
ATOM 2654 CG TRP B 5 -17.886 42.880 -19.052 1.00174.69 C
ATOM 2655 CD1 TRP B 5 -18.973 43.608 -19.441 1.00174.96 C
ATOM 2656 CD2 TRP B 5 -17.021 42.811 -20.192 1.00173.91 C
ATOM 2657 NE1 TRP B 5 -18.833 44.005 -20.749 1.00174.09 N
ATOM 2658 CE2 TRP B 5 -17.644 43.528 -21.232 1.00173.83 C
ATOM 2659 CE3 TRP B 5 -15.778 42.217 -20.431 1.00173.31 C
ATOM 2660 CZ2 TRP B 5 -17.067 43.666 -22.492 1.00174.02 C
ATOM 2661 CZ3 TRP B 5 -15.208 42.356 -21.683 1.00173.90 C
ATOM 2662 CH2 TRP B 5 -15.852 43.074 -22.697 1.00174.58 C
ATOM 2663 N TYR B 6 -15.449 44.577 -18.084 1.00173.90 N
ATOM 2664 CA TYR B 6 -14.192 45.011 -18.689 1.00173.97 C
ATOM 2665 C TYR B 6 -13.320 45.824 -17.733 1.00173.84 C
ATOM 2666 O TYR B 6 -12.352 46.456 -18.156 1.00174.12 O
ATOM 2667 CB TYR B 6 -14.470 45.833 -19.949 1.00174.37 C
ATOM 2668 CG TYR B 6 -15.401 47.002 -19.718 1.00174.69 C
ATOM 2669 CD1 TYR B 6 -16.771 46.869 -19.904 1.00174.94 C
ATOM 2670 CD2 TYR B 6 -14.912 48.237 -19.312 1.00174.52 C
ATOM 2671 CE1 TYR B 6 -17.626 47.932 -19.692 1.00175.05 C
ATOM 2672 CE2 TYR B 6 -15.759 49.305 -19.095 1.00174.56 C
ATOM 2673 CZ TYR B 6 -17.115 49.147 -19.287 1.00174.70 C
ATOM 2674 OH TYR B 6 -17.961 50.210 -19.073 1.00173.88 O
ATOM 2675 N ARG B 7 -13.664 45.810 -16.449 1.00173.47 N
ATOM 2676 CA ARG B 7 -12.932 46.586 -15.453 1.00173.54 C
ATOM 2677 C ARG B 7 -12.489 45.747 -14.260 1.00173.50 C
ATOM 2678 O ARG B 7 -11.869 46.265 -13.332 1.00173.42 O
ATOM 2679 CB ARG B 7 -13.777 47.758 -14.956 1.00173.69 C
ATOM 2680 CG ARG B 7 -13.910 48.910 -15.937 1.00173.59 C
ATOM 2681 CD ARG B 7 -14.567 50.100 -15.259 1.00174.25 C
ATOM 2682 NE ARG B 7 -14.728 51.246 -16.148 1.00174.28 N
ATOM 2683 CZ ARG B 7 -15.371 52.361 -15.813 1.00174.43 C
ATOM 2684 NH1 ARG B 7 -15.916 52.477 -14.610 1.00174.71 N
ATOM 2685 NH2 ARG B 7 -15.471 53.359 -16.679 1.00174.48 N
ATOM 2686 N VAL B 8 -12.824 44.461 -14.285 1.00173.60 N
ATOM 2687 CA VAL B 8 -12.545 43.556 -13.171 1.00173.81 C
ATOM 2688 C VAL B 8 -11.080 43.562 -12.715 1.00174.38 C
ATOM 2689 O VAL B 8 -10.796 43.292 -11.548 1.00174.72 O
ATOM 2690 CB VAL B 8 -12.954 42.104 -13.516 1.00173.98 C
ATOM 2691 CG1 VAL B 8 -14.465 41.998 -13.652 1.00174.07 C
ATOM 2692 CG2 VAL B 8 -12.258 41.629 -14.784 1.00174.06 C
ATOM 2693 N HIS B 9 -10.155 43.862 -13.623 1.00174.30 N
ATOM 2694 CA HIS B 9 -8.733 43.807 -13.290 1.00174.68 C
ATOM 2695 C HIS B 9 -8.198 45.128 -12.752 1.00174.61 C
ATOM 2696 O HIS B 9 -7.027 45.226 -12.388 1.00174.57 O
ATOM 2697 CB HIS B 9 -7.913 43.396 -14.506 1.00174.45 C
ATOM 2698 CG HIS B 9 -8.141 41.984 -14.937 1.00173.36 C
ATOM 2699 ND1 HIS B 9 -7.596 41.461 -16.089 1.00173.24 N
ATOM 2700 CD2 HIS B 9 -8.868 40.988 -14.378 1.00172.74 C
ATOM 2701 CE1 HIS B 9 -7.970 40.201 -16.217 1.00172.99 C
ATOM 2702 NE2 HIS B 9 -8.743 39.891 -15.193 1.00172.14 N
ATOM 2703 N THR B 10 -9.058 46.138 -12.686 1.00174.35 N
ATOM 2704 CA THR B 10 -8.685 47.413 -12.090 1.00173.91 C
ATOM 2705 C THR B 10 -8.523 47.256 -10.580 1.00173.94 C
ATOM 2706 O THR B 10 -8.104 48.181 -9.886 1.00173.73 O
ATOM 2707 CB THR B 10 -9.725 48.502 -12.400 1.00173.40 C
ATOM 2708 OG1 THR B 10 -11.026 48.049 -12.006 1.00173.59 O
ATOM 2709 CG2 THR B 10 -9.736 48.815 -13.890 1.00172.80 C
ATOM 2710 N VAL B 11 -8.861 46.071 -10.082 1.00174.07 N
ATOM 2711 CA VAL B 11 -8.676 45.707 -8.681 1.00174.54 C
ATOM 2712 C VAL B 11 -7.191 45.643 -8.278 1.00175.05 C
ATOM 2713 O VAL B 11 -6.864 45.393 -7.118 1.00175.00 O
ATOM 2714 CB VAL B 11 -9.361 44.343 -8.391 1.00174.21 C
ATOM 2715 CG1 VAL B 11 -8.484 43.187 -8.858 1.00174.43 C
ATOM 2716 CG2 VAL B 11 -9.719 44.203 -6.917 1.00174.43 C
ATOM 2717 N LEU B 12 -6.297 45.892 -9.231 1.00174.64 N
ATOM 2718 CA LEU B 12 -4.862 45.748 -8.997 1.00174.18 C
ATOM 2719 C LEU B 12 -4.081 47.049 -9.152 1.00174.14 C
ATOM 2720 O LEU B 12 -2.892 47.095 -8.836 1.00174.24 O
ATOM 2721 CB LEU B 12 -4.276 44.702 -9.946 1.00173.30 C
ATOM 2722 CG LEU B 12 -4.851 43.289 -9.872 1.00173.56 C
ATOM 2723 CD1 LEU B 12 -4.049 42.352 -10.755 1.00173.99 C
ATOM 2724 CD2 LEU B 12 -4.875 42.793 -8.438 1.00173.53 C
ATOM 2725 N ILE B 13 -4.745 48.086 -9.658 1.00174.00 N
ATOM 2726 CA ILE B 13 -4.104 49.366 -9.968 1.00174.13 C
ATOM 2727 C ILE B 13 -3.204 49.892 -8.842 1.00174.86 C
ATOM 2728 O ILE B 13 -2.174 50.520 -9.099 1.00175.07 O
ATOM 2729 CB ILE B 13 -5.166 50.439 -10.311 1.00173.88 C
ATOM 2730 CG1 ILE B 13 -6.031 49.969 -11.482 1.00173.25 C
ATOM 2731 CG2 ILE B 13 -4.511 51.773 -10.641 1.00174.30 C
ATOM 2732 CD1 ILE B 13 -6.922 51.051 -12.060 1.00174.24 C
ATOM 2733 N ASN B 14 -3.570 49.602 -7.597 1.00174.56 N
ATOM 2734 CA ASN B 14 -2.733 49.973 -6.460 1.00173.62 C
ATOM 2735 C ASN B 14 -2.694 48.863 -5.418 1.00173.70 C
ATOM 2736 O ASN B 14 -3.052 49.061 -4.259 1.00173.93 O
ATOM 2737 CB ASN B 14 -3.218 51.284 -5.828 1.00173.38 C
ATOM 2738 CG ASN B 14 -4.727 51.332 -5.644 1.00173.27 C
ATOM 2739 OD1 ASN B 14 -5.372 50.313 -5.400 1.00173.05 O
ATOM 2740 ND2 ASN B 14 -5.293 52.530 -5.747 1.00172.53 N
ATOM 2741 N ASP B 15 -2.256 47.689 -5.856 1.00173.90 N
ATOM 2742 CA ASP B 15 -2.078 46.539 -4.981 1.00174.36 C
ATOM 2743 C ASP B 15 -0.877 45.734 -5.468 1.00174.48 C
ATOM 2744 O ASP B 15 -1.044 44.647 -6.018 1.00174.85 O
ATOM 2745 CB ASP B 15 -3.342 45.676 -4.952 1.00174.01 C
ATOM 2746 CG ASP B 15 -3.360 44.702 -3.788 1.00173.87 C
ATOM 2747 OD1 ASP B 15 -2.274 44.338 -3.289 1.00173.45 O
ATOM 2748 OD2 ASP B 15 -4.463 44.293 -3.374 1.00173.81 O
ATOM 2749 N PRO B 16 0.337 46.282 -5.281 1.00174.13 N
ATOM 2750 CA PRO B 16 1.606 45.742 -5.786 1.00173.98 C
ATOM 2751 C PRO B 16 1.776 44.237 -5.580 1.00174.60 C
ATOM 2752 O PRO B 16 2.348 43.562 -6.435 1.00174.95 O
ATOM 2753 CB PRO B 16 2.647 46.516 -4.974 1.00173.51 C
ATOM 2754 CG PRO B 16 1.986 47.818 -4.701 1.00173.52 C
ATOM 2755 CD PRO B 16 0.564 47.448 -4.407 1.00173.97 C
ATOM 2756 N GLY B 17 1.282 43.730 -4.455 1.00174.75 N
ATOM 2757 CA GLY B 17 1.343 42.310 -4.160 1.00174.86 C
ATOM 2758 C GLY B 17 0.558 41.465 -5.144 1.00174.92 C
ATOM 2759 O GLY B 17 1.108 40.576 -5.795 1.00174.64 O
ATOM 2760 N ARG B 18 -0.738 41.743 -5.244 1.00175.15 N
ATOM 2761 CA ARG B 18 -1.630 40.984 -6.113 1.00174.92 C
ATOM 2762 C ARG B 18 -1.371 41.279 -7.589 1.00174.55 C
ATOM 2763 O ARG B 18 -1.782 40.518 -8.464 1.00173.98 O
ATOM 2764 CB ARG B 18 -3.087 41.295 -5.768 1.00174.55 C
ATOM 2765 CG ARG B 18 -3.383 41.299 -4.281 1.00174.05 C
ATOM 2766 CD ARG B 18 -3.831 39.937 -3.782 1.00173.74 C
ATOM 2767 NE ARG B 18 -5.268 39.906 -3.524 1.00173.63 N
ATOM 2768 CZ ARG B 18 -5.865 39.026 -2.728 1.00174.19 C
ATOM 2769 NH1 ARG B 18 -5.150 38.100 -2.104 1.00174.65 N
ATOM 2770 NH2 ARG B 18 -7.179 39.073 -2.551 1.00174.14 N
ATOM 2771 N LEU B 19 -0.689 42.388 -7.858 1.00174.13 N
ATOM 2772 CA LEU B 19 -0.321 42.745 -9.220 1.00172.94 C
ATOM 2773 C LEU B 19 0.854 41.896 -9.684 1.00172.99 C
ATOM 2774 O LEU B 19 0.915 41.479 -10.839 1.00173.29 O
ATOM 2775 CB LEU B 19 0.035 44.227 -9.309 1.00173.11 C
ATOM 2776 CG LEU B 19 0.362 44.734 -10.712 1.00173.33 C
ATOM 2777 CD1 LEU B 19 -0.927 44.990 -11.479 1.00173.59 C
ATOM 2778 CD2 LEU B 19 1.230 45.975 -10.660 1.00173.92 C
ATOM 2779 N ILE B 20 1.785 41.644 -8.768 1.00173.40 N
ATOM 2780 CA ILE B 20 2.923 40.777 -9.044 1.00173.90 C
ATOM 2781 C ILE B 20 2.431 39.340 -9.180 1.00174.13 C
ATOM 2782 O ILE B 20 2.873 38.599 -10.061 1.00173.63 O
ATOM 2783 CB ILE B 20 3.992 40.870 -7.932 1.00174.21 C
ATOM 2784 CG1 ILE B 20 4.775 42.178 -8.047 1.00174.26 C
ATOM 2785 CG2 ILE B 20 4.946 39.689 -7.993 1.00174.15 C
ATOM 2786 CD1 ILE B 20 5.577 42.518 -6.805 1.00174.15 C
ATOM 2787 N ALA B 21 1.496 38.966 -8.312 1.00174.67 N
ATOM 2788 CA ALA B 21 0.887 37.642 -8.345 1.00174.00 C
ATOM 2789 C ALA B 21 0.200 37.402 -9.684 1.00173.52 C
ATOM 2790 O ALA B 21 0.260 36.307 -10.236 1.00173.71 O
ATOM 2791 CB ALA B 21 -0.109 37.482 -7.197 1.00173.70 C
ATOM 2792 N ALA B 22 -0.458 38.435 -10.198 1.00173.51 N
ATOM 2793 CA ALA B 22 -1.113 38.357 -11.498 1.00174.07 C
ATOM 2794 C ALA B 22 -0.094 38.169 -12.627 1.00173.70 C
ATOM 2795 O ALA B 22 -0.207 37.237 -13.424 1.00173.07 O
ATOM 2796 CB ALA B 22 -1.952 39.598 -11.737 1.00174.28 C
ATOM 2797 N HIS B 23 0.885 39.068 -12.697 1.00173.92 N
ATOM 2798 CA HIS B 23 1.948 38.998 -13.695 1.00173.70 C
ATOM 2799 C HIS B 23 2.704 37.679 -13.606 1.00173.63 C
ATOM 2800 O HIS B 23 3.237 37.179 -14.596 1.00174.23 O
ATOM 2801 CB HIS B 23 2.934 40.149 -13.512 1.00174.43 C
ATOM 2802 CG HIS B 23 2.329 41.509 -13.629 1.00174.93 C
ATOM 2803 ND1 HIS B 23 0.985 41.760 -13.401 1.00174.91 N
ATOM 2804 CD2 HIS B 23 2.868 42.703 -13.970 1.00175.11 C
ATOM 2805 CE1 HIS B 23 0.735 43.031 -13.606 1.00174.61 C
ATOM 2806 NE2 HIS B 23 1.867 43.638 -13.942 1.00175.26 N
ATOM 2807 N LEU B 24 2.752 37.125 -12.401 1.00173.08 N
ATOM 2808 CA LEU B 24 3.405 35.849 -12.173 1.00173.16 C
ATOM 2809 C LEU B 24 2.605 34.742 -12.839 1.00173.64 C
ATOM 2810 O LEU B 24 3.166 33.878 -13.508 1.00173.89 O
ATOM 2811 CB LEU B 24 3.556 35.581 -10.680 1.00173.18 C
ATOM 2812 CG LEU B 24 4.914 35.934 -10.084 1.00173.27 C
ATOM 2813 CD1 LEU B 24 4.924 35.662 -8.588 1.00173.88 C
ATOM 2814 CD2 LEU B 24 6.024 35.162 -10.779 1.00173.30 C
ATOM 2815 N MET B 25 1.288 34.792 -12.670 1.00173.88 N
ATOM 2816 CA MET B 25 0.397 33.815 -13.280 1.00173.76 C
ATOM 2817 C MET B 25 0.453 33.885 -14.803 1.00173.59 C
ATOM 2818 O MET B 25 0.493 32.856 -15.476 1.00173.73 O
ATOM 2819 CB MET B 25 -1.034 34.030 -12.796 1.00173.34 C
ATOM 2820 CG MET B 25 -1.988 32.949 -13.250 1.00172.73 C
ATOM 2821 SD MET B 25 -1.440 31.311 -12.735 1.00171.14 S
ATOM 2822 CE MET B 25 -2.003 31.289 -11.036 1.00173.74 C
ATOM 2823 N HIS B 26 0.456 35.103 -15.337 1.00173.23 N
ATOM 2824 CA HIS B 26 0.577 35.310 -16.777 1.00173.57 C
ATOM 2825 C HIS B 26 1.856 34.683 -17.320 1.00173.42 C
ATOM 2826 O HIS B 26 1.820 33.892 -18.264 1.00173.60 O
ATOM 2827 CB HIS B 26 0.551 36.799 -17.117 1.00174.41 C
ATOM 2828 CG HIS B 26 0.830 37.087 -18.560 1.00175.29 C
ATOM 2829 ND1 HIS B 26 2.105 37.271 -19.049 1.00174.87 N
ATOM 2830 CD2 HIS B 26 -0.001 37.212 -19.622 1.00174.86 C
ATOM 2831 CE1 HIS B 26 2.048 37.499 -20.348 1.00174.59 C
ATOM 2832 NE2 HIS B 26 0.781 37.470 -20.721 1.00174.38 N
ATOM 2833 N THR B 27 2.981 35.055 -16.719 1.00173.21 N
ATOM 2834 CA THR B 27 4.286 34.521 -17.093 1.00173.33 C
ATOM 2835 C THR B 27 4.291 32.994 -17.039 1.00173.69 C
ATOM 2836 O THR B 27 4.887 32.335 -17.893 1.00174.35 O
ATOM 2837 CB THR B 27 5.394 35.079 -16.178 1.00173.27 C
ATOM 2838 OG1 THR B 27 5.364 36.511 -16.210 1.00173.29 O
ATOM 2839 CG2 THR B 27 6.760 34.602 -16.631 1.00173.49 C
ATOM 2840 N ALA B 28 3.619 32.441 -16.034 1.00173.32 N
ATOM 2841 CA ALA B 28 3.480 30.994 -15.896 1.00173.27 C
ATOM 2842 C ALA B 28 2.744 30.389 -17.089 1.00173.39 C
ATOM 2843 O ALA B 28 3.139 29.345 -17.607 1.00174.09 O
ATOM 2844 CB ALA B 28 2.759 30.653 -14.601 1.00173.89 C
ATOM 2845 N LEU B 29 1.668 31.044 -17.515 1.00173.04 N
ATOM 2846 CA LEU B 29 0.884 30.573 -18.655 1.00173.43 C
ATOM 2847 C LEU B 29 1.679 30.622 -19.956 1.00173.48 C
ATOM 2848 O LEU B 29 1.615 29.700 -20.769 1.00173.19 O
ATOM 2849 CB LEU B 29 -0.393 31.400 -18.806 1.00173.25 C
ATOM 2850 CG LEU B 29 -1.435 31.266 -17.697 1.00172.98 C
ATOM 2851 CD1 LEU B 29 -2.518 32.319 -17.856 1.00173.44 C
ATOM 2852 CD2 LEU B 29 -2.034 29.871 -17.701 1.00172.82 C
ATOM 2853 N VAL B 30 2.424 31.706 -20.146 1.00173.43 N
ATOM 2854 CA VAL B 30 3.217 31.889 -21.355 1.00172.97 C
ATOM 2855 C VAL B 30 4.370 30.893 -21.393 1.00172.83 C
ATOM 2856 O VAL B 30 4.691 30.340 -22.445 1.00173.80 O
ATOM 2857 CB VAL B 30 3.763 33.326 -21.453 1.00173.67 C
ATOM 2858 CG1 VAL B 30 4.610 33.496 -22.700 1.00174.05 C
ATOM 2859 CG2 VAL B 30 2.616 34.319 -21.455 1.00174.29 C
ATOM 2860 N ALA B 31 4.977 30.652 -20.236 1.00172.64 N
ATOM 2861 CA ALA B 31 6.031 29.653 -20.125 1.00172.86 C
ATOM 2862 C ALA B 31 5.429 28.260 -20.253 1.00173.53 C
ATOM 2863 O ALA B 31 6.035 27.361 -20.835 1.00174.05 O
ATOM 2864 CB ALA B 31 6.773 29.799 -18.808 1.00173.53 C
ATOM 2865 N GLY B 32 4.234 28.093 -19.693 1.00173.76 N
ATOM 2866 CA GLY B 32 3.496 26.848 -19.791 1.00173.51 C
ATOM 2867 C GLY B 32 3.161 26.493 -21.226 1.00173.63 C
ATOM 2868 O GLY B 32 3.324 25.347 -21.644 1.00173.95 O
ATOM 2869 N TRP B 33 2.677 27.479 -21.976 1.00173.72 N
ATOM 2870 CA TRP B 33 2.378 27.291 -23.393 1.00174.06 C
ATOM 2871 C TRP B 33 3.608 26.866 -24.190 1.00173.52 C
ATOM 2872 O TRP B 33 3.561 25.887 -24.932 1.00172.86 O
ATOM 2873 CB TRP B 33 1.794 28.573 -23.997 1.00174.06 C
ATOM 2874 CG TRP B 33 1.637 28.501 -25.488 1.00173.36 C
ATOM 2875 CD1 TRP B 33 0.578 27.986 -26.174 1.00173.46 C
ATOM 2876 CD2 TRP B 33 2.569 28.964 -26.477 1.00173.10 C
ATOM 2877 NE1 TRP B 33 0.794 28.091 -27.526 1.00173.40 N
ATOM 2878 CE2 TRP B 33 2.006 28.689 -27.738 1.00173.23 C
ATOM 2879 CE3 TRP B 33 3.821 29.581 -26.416 1.00173.63 C
ATOM 2880 CZ2 TRP B 33 2.654 29.012 -28.930 1.00173.68 C
ATOM 2881 CZ3 TRP B 33 4.463 29.898 -27.601 1.00174.17 C
ATOM 2882 CH2 TRP B 33 3.879 29.612 -28.840 1.00174.39 C
ATOM 2883 N ALA B 34 4.703 27.604 -24.022 1.00173.96 N
ATOM 2884 CA ALA B 34 5.938 27.372 -24.771 1.00174.10 C
ATOM 2885 C ALA B 34 6.426 25.931 -24.666 1.00173.88 C
ATOM 2886 O ALA B 34 6.683 25.280 -25.678 1.00174.26 O
ATOM 2887 CB ALA B 34 7.024 28.328 -24.298 1.00174.61 C
ATOM 2888 N GLY B 35 6.555 25.444 -23.436 1.00173.90 N
ATOM 2889 CA GLY B 35 6.975 24.077 -23.192 1.00173.65 C
ATOM 2890 C GLY B 35 6.047 23.059 -23.824 1.00173.29 C
ATOM 2891 O GLY B 35 6.493 22.134 -24.502 1.00173.34 O
ATOM 2892 N SER B 36 4.750 23.232 -23.601 1.00173.01 N
ATOM 2893 CA SER B 36 3.758 22.269 -24.058 1.00172.94 C
ATOM 2894 C SER B 36 3.472 22.383 -25.557 1.00173.47 C
ATOM 2895 O SER B 36 3.073 21.405 -26.190 1.00174.06 O
ATOM 2896 CB SER B 36 2.467 22.433 -23.256 1.00172.87 C
ATOM 2897 OG SER B 36 2.064 23.791 -23.215 1.00173.19 O
ATOM 2898 N MET B 37 3.676 23.569 -26.125 1.00173.44 N
ATOM 2899 CA MET B 37 3.535 23.749 -27.570 1.00173.50 C
ATOM 2900 C MET B 37 4.666 23.036 -28.297 1.00172.66 C
ATOM 2901 O MET B 37 4.484 22.514 -29.397 1.00172.10 O
ATOM 2902 CB MET B 37 3.521 25.234 -27.941 1.00173.86 C
ATOM 2903 CG MET B 37 3.487 25.518 -29.437 1.00174.00 C
ATOM 2904 SD MET B 37 1.982 24.967 -30.258 1.00174.28 S
ATOM 2905 CE MET B 37 2.030 25.965 -31.746 1.00173.03 C
ATOM 2906 N ALA B 38 5.836 23.019 -27.667 1.00172.84 N
ATOM 2907 CA ALA B 38 6.994 22.315 -28.200 1.00173.13 C
ATOM 2908 C ALA B 38 6.731 20.815 -28.256 1.00173.16 C
ATOM 2909 O ALA B 38 6.956 20.176 -29.285 1.00173.36 O
ATOM 2910 CB ALA B 38 8.229 22.612 -27.362 1.00173.88 C
ATOM 2911 N LEU B 39 6.262 20.260 -27.141 1.00173.35 N
ATOM 2912 CA LEU B 39 5.899 18.846 -27.066 1.00173.67 C
ATOM 2913 C LEU B 39 4.922 18.448 -28.170 1.00173.78 C
ATOM 2914 O LEU B 39 5.009 17.350 -28.718 1.00174.26 O
ATOM 2915 CB LEU B 39 5.292 18.520 -25.699 1.00173.17 C
ATOM 2916 CG LEU B 39 6.171 18.761 -24.473 1.00172.84 C
ATOM 2917 CD1 LEU B 39 5.372 18.548 -23.200 1.00173.88 C
ATOM 2918 CD2 LEU B 39 7.381 17.845 -24.506 1.00172.45 C
ATOM 2919 N TYR B 40 3.992 19.344 -28.487 1.00173.66 N
ATOM 2920 CA TYR B 40 3.031 19.098 -29.555 1.00173.58 C
ATOM 2921 C TYR B 40 3.739 18.966 -30.896 1.00172.95 C
ATOM 2922 O TYR B 40 3.409 18.097 -31.702 1.00172.94 O
ATOM 2923 CB TYR B 40 1.990 20.218 -29.618 1.00173.79 C
ATOM 2924 CG TYR B 40 1.008 20.068 -30.757 1.00173.50 C
ATOM 2925 CD1 TYR B 40 -0.032 19.151 -30.688 1.00173.58 C
ATOM 2926 CD2 TYR B 40 1.125 20.840 -31.905 1.00173.72 C
ATOM 2927 CE1 TYR B 40 -0.929 19.010 -31.731 1.00173.50 C
ATOM 2928 CE2 TYR B 40 0.234 20.705 -32.952 1.00173.46 C
ATOM 2929 CZ TYR B 40 -0.791 19.789 -32.859 1.00173.12 C
ATOM 2930 OH TYR B 40 -1.681 19.653 -33.899 1.00172.80 O
ATOM 2931 N GLU B 41 4.718 19.832 -31.126 1.00172.74 N
ATOM 2932 CA GLU B 41 5.477 19.808 -32.367 1.00172.90 C
ATOM 2933 C GLU B 41 6.373 18.577 -32.429 1.00172.85 C
ATOM 2934 O GLU B 41 6.483 17.936 -33.471 1.00173.27 O
ATOM 2935 CB GLU B 41 6.306 21.086 -32.515 1.00173.25 C
ATOM 2936 CG GLU B 41 5.471 22.358 -32.564 1.00173.39 C
ATOM 2937 CD GLU B 41 6.241 23.544 -33.115 1.00173.39 C
ATOM 2938 OE1 GLU B 41 7.489 23.500 -33.108 1.00173.77 O
ATOM 2939 OE2 GLU B 41 5.597 24.519 -33.557 1.00173.02 O
ATOM 2940 N LEU B 42 6.999 18.242 -31.305 1.00172.77 N
ATOM 2941 CA LEU B 42 7.873 17.076 -31.234 1.00173.05 C
ATOM 2942 C LEU B 42 7.103 15.777 -31.442 1.00172.57 C
ATOM 2943 O LEU B 42 7.675 14.762 -31.842 1.00172.96 O
ATOM 2944 CB LEU B 42 8.605 17.034 -29.892 1.00174.11 C
ATOM 2945 CG LEU B 42 9.723 18.061 -29.711 1.00174.77 C
ATOM 2946 CD1 LEU B 42 10.391 17.889 -28.358 1.00175.30 C
ATOM 2947 CD2 LEU B 42 10.737 17.933 -30.837 1.00174.20 C
ATOM 2948 N ALA B 43 5.805 15.813 -31.166 1.00171.83 N
ATOM 2949 CA ALA B 43 4.967 14.634 -31.321 1.00172.33 C
ATOM 2950 C ALA B 43 4.434 14.501 -32.744 1.00173.41 C
ATOM 2951 O ALA B 43 3.809 13.497 -33.085 1.00173.67 O
ATOM 2952 CB ALA B 43 3.816 14.675 -30.327 1.00173.33 C
ATOM 2953 N THR B 44 4.686 15.510 -33.575 1.00173.89 N
ATOM 2954 CA THR B 44 4.154 15.525 -34.938 1.00173.70 C
ATOM 2955 C THR B 44 5.206 15.820 -36.007 1.00172.52 C
ATOM 2956 O THR B 44 4.970 15.590 -37.192 1.00171.60 O
ATOM 2957 CB THR B 44 3.022 16.564 -35.082 1.00173.97 C
ATOM 2958 OG1 THR B 44 3.543 17.875 -34.836 1.00174.60 O
ATOM 2959 CG2 THR B 44 1.896 16.279 -34.097 1.00174.00 C
ATOM 2960 N PHE B 45 6.361 16.329 -35.593 1.00172.38 N
ATOM 2961 CA PHE B 45 7.405 16.697 -36.544 1.00172.12 C
ATOM 2962 C PHE B 45 8.144 15.476 -37.081 1.00172.49 C
ATOM 2963 O PHE B 45 8.494 14.569 -36.327 1.00172.88 O
ATOM 2964 CB PHE B 45 8.401 17.666 -35.905 1.00172.86 C
ATOM 2965 CG PHE B 45 9.629 17.900 -36.733 1.00173.39 C
ATOM 2966 CD1 PHE B 45 9.573 18.690 -37.868 1.00173.71 C
ATOM 2967 CD2 PHE B 45 10.841 17.331 -36.377 1.00173.92 C
ATOM 2968 CE1 PHE B 45 10.702 18.909 -38.634 1.00173.93 C
ATOM 2969 CE2 PHE B 45 11.973 17.546 -37.139 1.00173.99 C
ATOM 2970 CZ PHE B 45 11.903 18.336 -38.269 1.00173.88 C
ATOM 2971 N ASP B 46 8.373 15.459 -38.390 1.00173.29 N
ATOM 2972 CA ASP B 46 9.098 14.367 -39.029 1.00173.89 C
ATOM 2973 C ASP B 46 10.485 14.815 -39.494 1.00173.51 C
ATOM 2974 O ASP B 46 10.601 15.607 -40.429 1.00173.48 O
ATOM 2975 CB ASP B 46 8.301 13.816 -40.212 1.00174.60 C
ATOM 2976 CG ASP B 46 9.016 12.682 -40.916 1.00174.76 C
ATOM 2977 OD1 ASP B 46 9.716 11.906 -40.231 1.00173.79 O
ATOM 2978 OD2 ASP B 46 8.886 12.571 -42.154 1.00175.40 O
ATOM 2979 N PRO B 47 11.540 14.311 -38.834 1.00173.21 N
ATOM 2980 CA PRO B 47 12.936 14.633 -39.143 1.00173.10 C
ATOM 2981 C PRO B 47 13.528 13.771 -40.256 1.00173.17 C
ATOM 2982 O PRO B 47 14.712 13.904 -40.563 1.00173.70 O
ATOM 2983 CB PRO B 47 13.645 14.352 -37.821 1.00173.65 C
ATOM 2984 CG PRO B 47 12.879 13.206 -37.263 1.00174.02 C
ATOM 2985 CD PRO B 47 11.436 13.505 -37.605 1.00174.05 C
ATOM 2986 N SER B 48 12.715 12.894 -40.838 1.00173.44 N
ATOM 2987 CA SER B 48 13.186 11.923 -41.827 1.00174.21 C
ATOM 2988 C SER B 48 13.869 12.540 -43.050 1.00174.66 C
ATOM 2989 O SER B 48 14.652 11.871 -43.724 1.00174.96 O
ATOM 2990 CB SER B 48 12.018 11.051 -42.295 1.00174.57 C
ATOM 2991 OG SER B 48 11.110 11.797 -43.088 1.00174.76 O
ATOM 2992 N ASP B 49 13.578 13.805 -43.338 1.00174.49 N
ATOM 2993 CA ASP B 49 14.145 14.458 -44.516 1.00173.96 C
ATOM 2994 C ASP B 49 14.182 15.976 -44.375 1.00173.40 C
ATOM 2995 O ASP B 49 13.166 16.642 -44.553 1.00173.56 O
ATOM 2996 CB ASP B 49 13.350 14.073 -45.767 1.00174.13 C
ATOM 2997 CG ASP B 49 13.818 14.811 -47.008 1.00174.21 C
ATOM 2998 OD1 ASP B 49 15.045 14.944 -47.197 1.00174.78 O
ATOM 2999 OD2 ASP B 49 12.958 15.256 -47.799 1.00173.75 O
ATOM 3000 N PRO B 50 15.363 16.526 -44.058 1.00172.91 N
ATOM 3001 CA PRO B 50 15.548 17.971 -43.902 1.00173.17 C
ATOM 3002 C PRO B 50 15.634 18.705 -45.238 1.00173.45 C
ATOM 3003 O PRO B 50 15.616 19.936 -45.265 1.00173.47 O
ATOM 3004 CB PRO B 50 16.874 18.060 -43.147 1.00173.74 C
ATOM 3005 CG PRO B 50 17.634 16.879 -43.641 1.00173.11 C
ATOM 3006 CD PRO B 50 16.599 15.787 -43.743 1.00173.05 C
ATOM 3007 N VAL B 51 15.726 17.955 -46.331 1.00173.79 N
ATOM 3008 CA VAL B 51 15.855 18.545 -47.659 1.00173.97 C
ATOM 3009 C VAL B 51 14.516 18.981 -48.245 1.00173.49 C
ATOM 3010 O VAL B 51 14.285 20.168 -48.464 1.00173.81 O
ATOM 3011 CB VAL B 51 16.521 17.564 -48.643 1.00174.41 C
ATOM 3012 CG1 VAL B 51 16.814 18.256 -49.967 1.00174.03 C
ATOM 3013 CG2 VAL B 51 17.792 16.981 -48.034 1.00174.95 C
ATOM 3014 N LEU B 52 13.638 18.018 -48.498 1.00173.11 N
ATOM 3015 CA LEU B 52 12.367 18.303 -49.151 1.00173.31 C
ATOM 3016 C LEU B 52 11.200 18.368 -48.171 1.00174.10 C
ATOM 3017 O LEU B 52 10.093 18.757 -48.543 1.00174.38 O
ATOM 3018 CB LEU B 52 12.084 17.258 -50.229 1.00173.03 C
ATOM 3019 CG LEU B 52 12.981 17.342 -51.465 1.00173.31 C
ATOM 3020 CD1 LEU B 52 12.382 16.546 -52.608 1.00174.11 C
ATOM 3021 CD2 LEU B 52 13.205 18.791 -51.876 1.00173.36 C
ATOM 3022 N ASN B 53 11.444 17.993 -46.920 1.00174.17 N
ATOM 3023 CA ASN B 53 10.410 18.100 -45.893 1.00174.06 C
ATOM 3024 C ASN B 53 10.922 18.697 -44.578 1.00173.89 C
ATOM 3025 O ASN B 53 10.935 18.023 -43.548 1.00174.10 O
ATOM 3026 CB ASN B 53 9.792 16.725 -45.635 1.00174.10 C
ATOM 3027 CG ASN B 53 8.500 16.804 -44.847 1.00174.20 C
ATOM 3028 OD1 ASN B 53 7.685 17.702 -45.056 1.00174.12 O
ATOM 3029 ND2 ASN B 53 8.305 15.858 -43.936 1.00174.32 N
ATOM 3030 N PRO B 54 11.344 19.971 -44.607 1.00173.34 N
ATOM 3031 CA PRO B 54 11.857 20.626 -43.401 1.00172.83 C
ATOM 3032 C PRO B 54 10.742 21.170 -42.511 1.00172.80 C
ATOM 3033 O PRO B 54 9.582 21.192 -42.926 1.00172.55 O
ATOM 3034 CB PRO B 54 12.706 21.760 -43.970 1.00172.87 C
ATOM 3035 CG PRO B 54 11.978 22.139 -45.209 1.00173.81 C
ATOM 3036 CD PRO B 54 11.452 20.853 -45.784 1.00173.84 C
ATOM 3037 N MET B 55 11.103 21.582 -41.298 1.00173.31 N
ATOM 3038 CA MET B 55 10.164 22.113 -40.309 1.00173.31 C
ATOM 3039 C MET B 55 9.128 23.097 -40.862 1.00172.88 C
ATOM 3040 O MET B 55 7.949 23.015 -40.520 1.00173.23 O
ATOM 3041 CB MET B 55 10.943 22.778 -39.169 1.00173.42 C
ATOM 3042 CG MET B 55 11.949 23.830 -39.616 1.00173.72 C
ATOM 3043 SD MET B 55 12.720 24.656 -38.212 1.00172.58 S
ATOM 3044 CE MET B 55 13.891 23.413 -37.673 1.00172.38 C
ATOM 3045 N TRP B 56 9.559 24.018 -41.719 1.00172.77 N
ATOM 3046 CA TRP B 56 8.658 25.055 -42.214 1.00173.04 C
ATOM 3047 C TRP B 56 7.684 24.522 -43.263 1.00172.97 C
ATOM 3048 O TRP B 56 6.833 25.258 -43.761 1.00172.85 O
ATOM 3049 CB TRP B 56 9.448 26.238 -42.781 1.00173.87 C
ATOM 3050 CG TRP B 56 10.433 25.880 -43.851 1.00174.22 C
ATOM 3051 CD1 TRP B 56 11.752 25.574 -43.681 1.00174.28 C
ATOM 3052 CD2 TRP B 56 10.183 25.807 -45.261 1.00173.82 C
ATOM 3053 NE1 TRP B 56 12.338 25.312 -44.895 1.00174.37 N
ATOM 3054 CE2 TRP B 56 11.396 25.447 -45.881 1.00173.66 C
ATOM 3055 CE3 TRP B 56 9.053 26.009 -46.057 1.00173.45 C
ATOM 3056 CZ2 TRP B 56 11.508 25.281 -47.260 1.00172.88 C
ATOM 3057 CZ3 TRP B 56 9.167 25.846 -47.425 1.00172.97 C
ATOM 3058 CH2 TRP B 56 10.385 25.485 -48.012 1.00172.81 C
ATOM 3059 N ARG B 57 7.809 23.242 -43.593 1.00173.03 N
ATOM 3060 CA ARG B 57 6.847 22.585 -44.468 1.00173.60 C
ATOM 3061 C ARG B 57 5.822 21.829 -43.633 1.00173.54 C
ATOM 3062 O ARG B 57 4.724 21.527 -44.098 1.00173.65 O
ATOM 3063 CB ARG B 57 7.549 21.634 -45.439 1.00174.03 C
ATOM 3064 CG ARG B 57 8.275 22.327 -46.582 1.00174.17 C
ATOM 3065 CD ARG B 57 7.304 22.880 -47.615 1.00174.28 C
ATOM 3066 NE ARG B 57 6.489 21.832 -48.226 1.00174.46 N
ATOM 3067 CZ ARG B 57 5.627 22.037 -49.217 1.00174.33 C
ATOM 3068 NH1 ARG B 57 5.467 23.255 -49.716 1.00173.98 N
ATOM 3069 NH2 ARG B 57 4.927 21.025 -49.711 1.00174.23 N
ATOM 3070 N GLN B 58 6.191 21.532 -42.391 1.00173.53 N
ATOM 3071 CA GLN B 58 5.331 20.763 -41.500 1.00173.91 C
ATOM 3072 C GLN B 58 4.617 21.661 -40.497 1.00173.86 C
ATOM 3073 O GLN B 58 4.208 21.204 -39.432 1.00173.48 O
ATOM 3074 CB GLN B 58 6.145 19.702 -40.760 1.00173.81 C
ATOM 3075 CG GLN B 58 6.872 18.733 -41.673 1.00173.85 C
ATOM 3076 CD GLN B 58 7.769 17.781 -40.908 1.00174.26 C
ATOM 3077 OE1 GLN B 58 7.372 17.223 -39.885 1.00174.72 O
ATOM 3078 NE2 GLN B 58 8.986 17.589 -41.403 1.00174.16 N
ATOM 3079 N GLY B 59 4.467 22.934 -40.850 1.00173.93 N
ATOM 3080 CA GLY B 59 3.795 23.899 -39.998 1.00173.86 C
ATOM 3081 C GLY B 59 4.392 24.032 -38.609 1.00174.31 C
ATOM 3082 O GLY B 59 3.665 24.169 -37.626 1.00174.30 O
ATOM 3083 N MET B 60 5.718 23.991 -38.528 1.00174.73 N
ATOM 3084 CA MET B 60 6.419 24.165 -37.259 1.00174.51 C
ATOM 3085 C MET B 60 6.593 25.648 -36.943 1.00174.19 C
ATOM 3086 O MET B 60 7.079 26.411 -37.776 1.00174.19 O
ATOM 3087 CB MET B 60 7.780 23.466 -37.299 1.00174.29 C
ATOM 3088 CG MET B 60 7.704 21.951 -37.427 1.00173.83 C
ATOM 3089 SD MET B 60 7.031 21.156 -35.955 1.00173.28 S
ATOM 3090 CE MET B 60 5.423 20.626 -36.538 1.00173.25 C
ATOM 3091 N PHE B 61 6.208 26.051 -35.737 1.00173.41 N
ATOM 3092 CA PHE B 61 6.223 27.464 -35.374 1.00172.86 C
ATOM 3093 C PHE B 61 7.209 27.763 -34.251 1.00173.04 C
ATOM 3094 O PHE B 61 7.885 28.790 -34.266 1.00172.67 O
ATOM 3095 CB PHE B 61 4.818 27.920 -34.972 1.00172.92 C
ATOM 3096 CG PHE B 61 4.741 29.363 -34.565 1.00173.16 C
ATOM 3097 CD1 PHE B 61 5.023 30.368 -35.475 1.00173.52 C
ATOM 3098 CD2 PHE B 61 4.372 29.717 -33.277 1.00173.54 C
ATOM 3099 CE1 PHE B 61 4.952 31.698 -35.107 1.00173.45 C
ATOM 3100 CE2 PHE B 61 4.296 31.047 -32.904 1.00174.07 C
ATOM 3101 CZ PHE B 61 4.586 32.038 -33.821 1.00173.86 C
ATOM 3102 N VAL B 62 7.290 26.857 -33.282 1.00173.75 N
ATOM 3103 CA VAL B 62 8.175 27.033 -32.137 1.00174.52 C
ATOM 3104 C VAL B 62 9.549 26.424 -32.410 1.00173.98 C
ATOM 3105 O VAL B 62 10.579 26.980 -32.020 1.00173.94 O
ATOM 3106 CB VAL B 62 7.558 26.409 -30.865 1.00175.05 C
ATOM 3107 CG1 VAL B 62 8.617 26.156 -29.804 1.00174.40 C
ATOM 3108 CG2 VAL B 62 6.460 27.307 -30.321 1.00174.93 C
ATOM 3109 N LEU B 63 9.551 25.293 -33.109 1.00173.41 N
ATOM 3110 CA LEU B 63 10.778 24.574 -33.446 1.00172.91 C
ATOM 3111 C LEU B 63 11.891 25.426 -34.080 1.00172.97 C
ATOM 3112 O LEU B 63 13.057 25.259 -33.723 1.00173.37 O
ATOM 3113 CB LEU B 63 10.450 23.407 -34.382 1.00173.34 C
ATOM 3114 CG LEU B 63 11.515 22.315 -34.492 1.00173.84 C
ATOM 3115 CD1 LEU B 63 11.574 21.508 -33.206 1.00173.25 C
ATOM 3116 CD2 LEU B 63 11.242 21.415 -35.686 1.00174.41 C
ATOM 3117 N PRO B 64 11.552 26.335 -35.019 1.00173.11 N
ATOM 3118 CA PRO B 64 12.648 27.125 -35.592 1.00173.69 C
ATOM 3119 C PRO B 64 13.307 28.068 -34.591 1.00173.37 C
ATOM 3120 O PRO B 64 14.526 28.239 -34.624 1.00173.51 O
ATOM 3121 CB PRO B 64 11.959 27.921 -36.706 1.00173.76 C
ATOM 3122 CG PRO B 64 10.528 27.969 -36.306 1.00173.42 C
ATOM 3123 CD PRO B 64 10.277 26.628 -35.699 1.00173.50 C
ATOM 3124 N PHE B 65 12.511 28.671 -33.716 1.00172.90 N
ATOM 3125 CA PHE B 65 13.038 29.597 -32.721 1.00173.43 C
ATOM 3126 C PHE B 65 13.964 28.899 -31.726 1.00174.26 C
ATOM 3127 O PHE B 65 14.766 29.548 -31.057 1.00175.42 O
ATOM 3128 CB PHE B 65 11.892 30.291 -31.984 1.00173.81 C
ATOM 3129 CG PHE B 65 11.138 31.274 -32.833 1.00173.42 C
ATOM 3130 CD1 PHE B 65 11.562 32.588 -32.940 1.00173.75 C
ATOM 3131 CD2 PHE B 65 10.009 30.882 -33.532 1.00173.10 C
ATOM 3132 CE1 PHE B 65 10.871 33.494 -33.722 1.00173.66 C
ATOM 3133 CE2 PHE B 65 9.313 31.783 -34.316 1.00172.96 C
ATOM 3134 CZ PHE B 65 9.745 33.090 -34.411 1.00173.30 C
ATOM 3135 N MET B 66 13.858 27.577 -31.636 1.00173.80 N
ATOM 3136 CA MET B 66 14.731 26.805 -30.759 1.00173.54 C
ATOM 3137 C MET B 66 16.036 26.449 -31.462 1.00172.99 C
ATOM 3138 O MET B 66 17.063 26.233 -30.820 1.00172.75 O
ATOM 3139 CB MET B 66 14.032 25.532 -30.283 1.00173.30 C
ATOM 3140 CG MET B 66 12.990 25.754 -29.201 1.00173.10 C
ATOM 3141 SD MET B 66 12.397 24.198 -28.511 1.00171.02 S
ATOM 3142 CE MET B 66 11.321 23.627 -29.822 1.00172.95 C
ATOM 3143 N ALA B 67 15.988 26.394 -32.787 1.00173.08 N
ATOM 3144 CA ALA B 67 17.154 26.028 -33.579 1.00173.81 C
ATOM 3145 C ALA B 67 18.040 27.240 -33.841 1.00173.93 C
ATOM 3146 O ALA B 67 19.260 27.117 -33.959 1.00174.43 O
ATOM 3147 CB ALA B 67 16.720 25.390 -34.891 1.00174.43 C
ATOM 3148 N ARG B 68 17.415 28.409 -33.926 1.00173.33 N
ATOM 3149 CA ARG B 68 18.124 29.655 -34.192 1.00173.56 C
ATOM 3150 C ARG B 68 19.183 29.975 -33.137 1.00174.03 C
ATOM 3151 O ARG B 68 20.173 30.645 -33.425 1.00174.30 O
ATOM 3152 CB ARG B 68 17.125 30.811 -34.288 1.00173.24 C
ATOM 3153 CG ARG B 68 17.739 32.133 -34.710 1.00174.22 C
ATOM 3154 CD ARG B 68 16.678 33.202 -34.866 1.00174.02 C
ATOM 3155 NE ARG B 68 15.859 33.336 -33.667 1.00173.43 N
ATOM 3156 CZ ARG B 68 14.955 34.292 -33.483 1.00173.95 C
ATOM 3157 NH1 ARG B 68 14.752 35.208 -34.421 1.00173.93 N
ATOM 3158 NH2 ARG B 68 14.257 34.332 -32.358 1.00174.32 N
ATOM 3159 N LEU B 69 18.983 29.483 -31.920 1.00174.52 N
ATOM 3160 CA LEU B 69 19.865 29.845 -30.818 1.00175.46 C
ATOM 3161 C LEU B 69 20.684 28.668 -30.290 1.00175.56 C
ATOM 3162 O LEU B 69 21.313 28.770 -29.237 1.00175.42 O
ATOM 3163 CB LEU B 69 19.054 30.466 -29.679 1.00175.86 C
ATOM 3164 CG LEU B 69 18.294 31.753 -30.009 1.00175.35 C
ATOM 3165 CD1 LEU B 69 17.572 32.289 -28.779 1.00174.75 C
ATOM 3166 CD2 LEU B 69 19.234 32.801 -30.584 1.00174.90 C
ATOM 3167 N GLY B 70 20.675 27.553 -31.015 1.00174.93 N
ATOM 3168 CA GLY B 70 21.535 26.434 -30.671 1.00174.82 C
ATOM 3169 C GLY B 70 20.892 25.060 -30.636 1.00174.19 C
ATOM 3170 O GLY B 70 21.421 24.112 -31.218 1.00173.88 O
ATOM 3171 N VAL B 71 19.757 24.949 -29.953 1.00173.85 N
ATOM 3172 CA VAL B 71 19.094 23.660 -29.775 1.00173.52 C
ATOM 3173 C VAL B 71 18.649 23.081 -31.113 1.00173.19 C
ATOM 3174 O VAL B 71 17.665 23.526 -31.700 1.00173.01 O
ATOM 3175 CB VAL B 71 17.878 23.779 -28.840 1.00173.98 C
ATOM 3176 CG1 VAL B 71 17.149 22.448 -28.743 1.00174.06 C
ATOM 3177 CG2 VAL B 71 18.322 24.240 -27.463 1.00174.53 C
ATOM 3178 N THR B 72 19.387 22.082 -31.587 1.00172.88 N
ATOM 3179 CA THR B 72 19.134 21.496 -32.898 1.00173.12 C
ATOM 3180 C THR B 72 19.127 19.972 -32.865 1.00172.73 C
ATOM 3181 O THR B 72 19.234 19.324 -33.904 1.00173.45 O
ATOM 3182 CB THR B 72 20.185 21.957 -33.925 1.00174.22 C
ATOM 3183 OG1 THR B 72 21.499 21.689 -33.417 1.00174.17 O
ATOM 3184 CG2 THR B 72 20.050 23.446 -34.200 1.00174.84 C
ATOM 3185 N GLY B 73 19.003 19.401 -31.673 1.00172.10 N
ATOM 3186 CA GLY B 73 19.020 17.957 -31.535 1.00172.25 C
ATOM 3187 C GLY B 73 17.925 17.429 -30.632 1.00172.93 C
ATOM 3188 O GLY B 73 17.306 18.181 -29.882 1.00173.33 O
ATOM 3189 N SER B 74 17.687 16.124 -30.710 1.00173.53 N
ATOM 3190 CA SER B 74 16.679 15.473 -29.884 1.00173.59 C
ATOM 3191 C SER B 74 17.290 14.322 -29.094 1.00174.14 C
ATOM 3192 O SER B 74 18.285 13.732 -29.513 1.00174.13 O
ATOM 3193 CB SER B 74 15.524 14.964 -30.747 1.00173.40 C
ATOM 3194 OG SER B 74 14.624 14.181 -29.983 1.00172.65 O
ATOM 3195 N TRP B 75 16.688 14.006 -27.950 1.00174.85 N
ATOM 3196 CA TRP B 75 17.145 12.894 -27.120 1.00175.96 C
ATOM 3197 C TRP B 75 17.026 11.557 -27.846 1.00175.46 C
ATOM 3198 O TRP B 75 17.697 10.587 -27.492 1.00176.35 O
ATOM 3199 CB TRP B 75 16.358 12.840 -25.808 1.00176.59 C
ATOM 3200 CG TRP B 75 16.769 13.875 -24.801 1.00176.09 C
ATOM 3201 CD1 TRP B 75 17.933 14.588 -24.783 1.00175.30 C
ATOM 3202 CD2 TRP B 75 16.018 14.305 -23.660 1.00175.85 C
ATOM 3203 NE1 TRP B 75 17.951 15.439 -23.704 1.00174.95 N
ATOM 3204 CE2 TRP B 75 16.785 15.284 -22.997 1.00175.10 C
ATOM 3205 CE3 TRP B 75 14.768 13.959 -23.132 1.00175.25 C
ATOM 3206 CZ2 TRP B 75 16.347 15.920 -21.838 1.00174.53 C
ATOM 3207 CZ3 TRP B 75 14.333 14.593 -21.981 1.00174.46 C
ATOM 3208 CH2 TRP B 75 15.121 15.562 -21.346 1.00174.22 C
ATOM 3209 N SER B 76 16.172 11.511 -28.863 1.00174.21 N
ATOM 3210 CA SER B 76 15.948 10.276 -29.599 1.00173.67 C
ATOM 3211 C SER B 76 17.046 10.021 -30.630 1.00173.28 C
ATOM 3212 O SER B 76 17.124 8.934 -31.200 1.00173.06 O
ATOM 3213 CB SER B 76 14.580 10.310 -30.280 1.00173.54 C
ATOM 3214 OG SER B 76 14.503 11.384 -31.201 1.00173.49 O
ATOM 3215 N GLY B 77 17.906 11.013 -30.847 1.00173.07 N
ATOM 3216 CA GLY B 77 19.059 10.835 -31.713 1.00173.74 C
ATOM 3217 C GLY B 77 19.150 11.712 -32.952 1.00174.01 C
ATOM 3218 O GLY B 77 20.252 12.057 -33.381 1.00174.39 O
ATOM 3219 N TRP B 78 18.012 12.072 -33.541 1.00173.76 N
ATOM 3220 CA TRP B 78 18.032 12.852 -34.778 1.00173.45 C
ATOM 3221 C TRP B 78 18.386 14.315 -34.529 1.00173.72 C
ATOM 3222 O TRP B 78 18.471 14.758 -33.383 1.00174.08 O
ATOM 3223 CB TRP B 78 16.687 12.758 -35.508 1.00173.35 C
ATOM 3224 CG TRP B 78 15.514 13.221 -34.705 1.00173.21 C
ATOM 3225 CD1 TRP B 78 14.688 12.448 -33.949 1.00173.16 C
ATOM 3226 CD2 TRP B 78 15.035 14.566 -34.577 1.00173.37 C
ATOM 3227 NE1 TRP B 78 13.722 13.224 -33.357 1.00172.95 N
ATOM 3228 CE2 TRP B 78 13.913 14.529 -33.727 1.00173.37 C
ATOM 3229 CE3 TRP B 78 15.445 15.797 -35.099 1.00173.84 C
ATOM 3230 CZ2 TRP B 78 13.197 15.673 -33.384 1.00173.98 C
ATOM 3231 CZ3 TRP B 78 14.733 16.932 -34.758 1.00174.55 C
ATOM 3232 CH2 TRP B 78 13.621 16.862 -33.909 1.00174.67 C
ATOM 3233 N SER B 79 18.586 15.058 -35.614 1.00173.37 N
ATOM 3234 CA SER B 79 18.973 16.462 -35.528 1.00173.30 C
ATOM 3235 C SER B 79 18.464 17.253 -36.729 1.00172.70 C
ATOM 3236 O SER B 79 18.297 16.703 -37.817 1.00172.41 O
ATOM 3237 CB SER B 79 20.494 16.594 -35.421 1.00173.65 C
ATOM 3238 OG SER B 79 21.118 16.373 -36.675 1.00173.15 O
ATOM 3239 N ILE B 80 18.216 18.543 -36.515 1.00172.87 N
ATOM 3240 CA ILE B 80 17.688 19.430 -37.550 1.00172.30 C
ATOM 3241 C ILE B 80 18.546 19.430 -38.812 1.00172.02 C
ATOM 3242 O ILE B 80 18.024 19.397 -39.926 1.00171.99 O
ATOM 3243 CB ILE B 80 17.563 20.879 -37.027 1.00173.07 C
ATOM 3244 CG1 ILE B 80 16.482 20.960 -35.948 1.00174.11 C
ATOM 3245 CG2 ILE B 80 17.256 21.847 -38.161 1.00172.24 C
ATOM 3246 CD1 ILE B 80 15.181 20.289 -36.333 1.00173.54 C
ATOM 3247 N THR B 81 19.862 19.440 -38.631 1.00172.52 N
ATOM 3248 CA THR B 81 20.786 19.479 -39.759 1.00173.40 C
ATOM 3249 C THR B 81 20.758 18.169 -40.539 1.00173.33 C
ATOM 3250 O THR B 81 21.162 18.119 -41.701 1.00173.29 O
ATOM 3251 CB THR B 81 22.228 19.765 -39.300 1.00173.73 C
ATOM 3252 OG1 THR B 81 22.675 18.713 -38.437 1.00173.51 O
ATOM 3253 CG2 THR B 81 22.294 21.085 -38.549 1.00173.44 C
ATOM 3254 N GLY B 82 20.276 17.113 -39.895 1.00173.04 N
ATOM 3255 CA GLY B 82 20.133 15.827 -40.549 1.00172.85 C
ATOM 3256 C GLY B 82 21.239 14.860 -40.182 1.00173.62 C
ATOM 3257 O GLY B 82 21.409 13.827 -40.829 1.00173.72 O
ATOM 3258 N GLU B 83 21.993 15.196 -39.140 1.00173.78 N
ATOM 3259 CA GLU B 83 23.098 14.355 -38.693 1.00173.98 C
ATOM 3260 C GLU B 83 22.627 13.273 -37.731 1.00173.75 C
ATOM 3261 O GLU B 83 21.512 13.328 -37.213 1.00173.60 O
ATOM 3262 CB GLU B 83 24.184 15.200 -38.024 1.00173.65 C
ATOM 3263 CG GLU B 83 24.782 16.272 -38.916 1.00174.45 C
ATOM 3264 CD GLU B 83 25.897 17.036 -38.230 1.00175.44 C
ATOM 3265 OE1 GLU B 83 26.848 16.390 -37.741 1.00175.56 O
ATOM 3266 OE2 GLU B 83 25.823 18.282 -38.179 1.00176.00 O
ATOM 3267 N THR B 84 23.487 12.288 -37.499 1.00173.89 N
ATOM 3268 CA THR B 84 23.203 11.225 -36.543 1.00174.40 C
ATOM 3269 C THR B 84 24.398 11.000 -35.624 1.00174.24 C
ATOM 3270 O THR B 84 25.481 11.540 -35.854 1.00173.43 O
ATOM 3271 CB THR B 84 22.849 9.906 -37.249 1.00174.68 C
ATOM 3272 OG1 THR B 84 23.735 9.701 -38.356 1.00175.78 O
ATOM 3273 CG2 THR B 84 21.412 9.937 -37.748 1.00173.22 C
ATOM 3274 N GLY B 85 24.194 10.204 -34.579 1.00174.46 N
ATOM 3275 CA GLY B 85 25.243 9.923 -33.616 1.00174.93 C
ATOM 3276 C GLY B 85 25.589 11.101 -32.721 1.00176.43 C
ATOM 3277 O GLY B 85 26.418 10.975 -31.818 1.00177.23 O
ATOM 3278 N ILE B 86 24.958 12.245 -32.972 1.00176.20 N
ATOM 3279 CA ILE B 86 25.212 13.457 -32.199 1.00175.72 C
ATOM 3280 C ILE B 86 24.646 13.356 -30.782 1.00175.21 C
ATOM 3281 O ILE B 86 23.682 12.630 -30.534 1.00174.62 O
ATOM 3282 CB ILE B 86 24.640 14.712 -32.914 1.00174.11 C
ATOM 3283 CG1 ILE B 86 23.209 14.472 -33.406 1.00173.82 C
ATOM 3284 CG2 ILE B 86 25.505 15.077 -34.109 1.00172.83 C
ATOM 3285 CD1 ILE B 86 22.116 14.745 -32.384 1.00173.99 C
ATOM 3286 N ASP B 87 25.263 14.078 -29.853 1.00174.86 N
ATOM 3287 CA ASP B 87 24.817 14.087 -28.467 1.00174.65 C
ATOM 3288 C ASP B 87 24.473 15.513 -28.056 1.00174.71 C
ATOM 3289 O ASP B 87 25.359 16.289 -27.699 1.00175.00 O
ATOM 3290 CB ASP B 87 25.894 13.502 -27.547 1.00175.24 C
ATOM 3291 CG ASP B 87 25.395 13.267 -26.129 1.00175.39 C
ATOM 3292 OD1 ASP B 87 24.856 14.206 -25.505 1.00175.00 O
ATOM 3293 OD2 ASP B 87 25.549 12.132 -25.634 1.00175.66 O
ATOM 3294 N PRO B 88 23.180 15.864 -28.113 1.00174.42 N
ATOM 3295 CA PRO B 88 22.692 17.205 -27.779 1.00174.21 C
ATOM 3296 C PRO B 88 22.853 17.537 -26.299 1.00174.60 C
ATOM 3297 O PRO B 88 22.743 18.701 -25.914 1.00174.86 O
ATOM 3298 CB PRO B 88 21.212 17.136 -28.160 1.00174.05 C
ATOM 3299 CG PRO B 88 20.863 15.699 -27.969 1.00173.89 C
ATOM 3300 CD PRO B 88 22.073 14.958 -28.464 1.00174.04 C
ATOM 3301 N GLY B 89 23.108 16.520 -25.483 1.00174.38 N
ATOM 3302 CA GLY B 89 23.203 16.704 -24.048 1.00174.36 C
ATOM 3303 C GLY B 89 21.820 16.752 -23.432 1.00174.24 C
ATOM 3304 O GLY B 89 20.925 16.015 -23.845 1.00173.99 O
ATOM 3305 N PHE B 90 21.639 17.623 -22.445 1.00173.84 N
ATOM 3306 CA PHE B 90 20.329 17.800 -21.829 1.00173.49 C
ATOM 3307 C PHE B 90 19.486 18.787 -22.625 1.00173.25 C
ATOM 3308 O PHE B 90 18.281 18.598 -22.785 1.00173.53 O
ATOM 3309 CB PHE B 90 20.466 18.274 -20.380 1.00173.52 C
ATOM 3310 CG PHE B 90 19.161 18.674 -19.747 1.00173.96 C
ATOM 3311 CD1 PHE B 90 18.298 17.715 -19.243 1.00174.24 C
ATOM 3312 CD2 PHE B 90 18.801 20.008 -19.647 1.00174.29 C
ATOM 3313 CE1 PHE B 90 17.097 18.077 -18.660 1.00173.94 C
ATOM 3314 CE2 PHE B 90 17.601 20.376 -19.065 1.00174.49 C
ATOM 3315 CZ PHE B 90 16.749 19.408 -18.570 1.00173.82 C
ATOM 3316 N TRP B 91 20.124 19.839 -23.124 1.00173.16 N
ATOM 3317 CA TRP B 91 19.401 20.901 -23.809 1.00173.64 C
ATOM 3318 C TRP B 91 19.002 20.510 -25.228 1.00174.47 C
ATOM 3319 O TRP B 91 19.508 21.063 -26.207 1.00174.31 O
ATOM 3320 CB TRP B 91 20.232 22.183 -23.833 1.00173.44 C
ATOM 3321 CG TRP B 91 20.428 22.784 -22.478 1.00173.56 C
ATOM 3322 CD1 TRP B 91 21.614 23.009 -21.846 1.00174.21 C
ATOM 3323 CD2 TRP B 91 19.403 23.223 -21.576 1.00173.98 C
ATOM 3324 NE1 TRP B 91 21.394 23.568 -20.610 1.00173.93 N
ATOM 3325 CE2 TRP B 91 20.045 23.709 -20.420 1.00173.89 C
ATOM 3326 CE3 TRP B 91 18.007 23.254 -21.636 1.00174.39 C
ATOM 3327 CZ2 TRP B 91 19.340 24.220 -19.334 1.00174.07 C
ATOM 3328 CZ3 TRP B 91 17.308 23.761 -20.556 1.00174.84 C
ATOM 3329 CH2 TRP B 91 17.975 24.238 -19.420 1.00174.76 C
ATOM 3330 N SER B 92 18.090 19.547 -25.324 1.00174.88 N
ATOM 3331 CA SER B 92 17.475 19.180 -26.592 1.00174.67 C
ATOM 3332 C SER B 92 16.097 19.825 -26.660 1.00174.13 C
ATOM 3333 O SER B 92 15.683 20.498 -25.716 1.00174.17 O
ATOM 3334 CB SER B 92 17.368 17.660 -26.734 1.00174.07 C
ATOM 3335 OG SER B 92 16.457 17.122 -25.791 1.00173.86 O
ATOM 3336 N PHE B 93 15.399 19.641 -27.776 1.00173.73 N
ATOM 3337 CA PHE B 93 14.025 20.121 -27.901 1.00173.23 C
ATOM 3338 C PHE B 93 13.163 19.612 -26.751 1.00173.17 C
ATOM 3339 O PHE B 93 12.324 20.340 -26.223 1.00173.43 O
ATOM 3340 CB PHE B 93 13.427 19.698 -29.242 1.00173.31 C
ATOM 3341 CG PHE B 93 14.149 20.260 -30.428 1.00173.48 C
ATOM 3342 CD1 PHE B 93 14.109 21.617 -30.695 1.00173.36 C
ATOM 3343 CD2 PHE B 93 14.858 19.433 -31.282 1.00173.44 C
ATOM 3344 CE1 PHE B 93 14.773 22.142 -31.784 1.00173.63 C
ATOM 3345 CE2 PHE B 93 15.523 19.951 -32.375 1.00173.44 C
ATOM 3346 CZ PHE B 93 15.479 21.308 -32.625 1.00173.77 C
ATOM 3347 N GLU B 94 13.377 18.355 -26.372 1.00173.05 N
ATOM 3348 CA GLU B 94 12.708 17.776 -25.213 1.00173.34 C
ATOM 3349 C GLU B 94 13.118 18.517 -23.945 1.00173.38 C
ATOM 3350 O GLU B 94 12.275 18.877 -23.125 1.00174.02 O
ATOM 3351 CB GLU B 94 13.035 16.286 -25.079 1.00173.80 C
ATOM 3352 CG GLU B 94 12.531 15.417 -26.222 1.00174.79 C
ATOM 3353 CD GLU B 94 13.438 15.465 -27.435 1.00174.53 C
ATOM 3354 OE1 GLU B 94 14.662 15.632 -27.255 1.00174.37 O
ATOM 3355 OE2 GLU B 94 12.930 15.331 -28.568 1.00174.07 O
ATOM 3356 N GLY B 95 14.423 18.729 -23.794 1.00173.41 N
ATOM 3357 CA GLY B 95 14.974 19.455 -22.663 1.00173.88 C
ATOM 3358 C GLY B 95 14.388 20.844 -22.490 1.00173.86 C
ATOM 3359 O GLY B 95 13.943 21.205 -21.401 1.00174.47 O
ATOM 3360 N VAL B 96 14.401 21.624 -23.566 1.00173.48 N
ATOM 3361 CA VAL B 96 13.816 22.962 -23.569 1.00173.49 C
ATOM 3362 C VAL B 96 12.348 22.939 -23.151 1.00173.27 C
ATOM 3363 O VAL B 96 11.928 23.699 -22.276 1.00172.86 O
ATOM 3364 CB VAL B 96 13.928 23.619 -24.955 1.00173.95 C
ATOM 3365 CG1 VAL B 96 13.203 24.954 -24.972 1.00174.24 C
ATOM 3366 CG2 VAL B 96 15.387 23.796 -25.336 1.00174.43 C
ATOM 3367 N ALA B 97 11.575 22.067 -23.792 1.00173.48 N
ATOM 3368 CA ALA B 97 10.165 21.891 -23.463 1.00173.30 C
ATOM 3369 C ALA B 97 9.984 21.527 -21.992 1.00173.31 C
ATOM 3370 O ALA B 97 9.104 22.062 -21.319 1.00173.35 O
ATOM 3371 CB ALA B 97 9.545 20.827 -24.355 1.00173.77 C
ATOM 3372 N LEU B 98 10.824 20.618 -21.506 1.00173.95 N
ATOM 3373 CA LEU B 98 10.816 20.214 -20.102 1.00174.01 C
ATOM 3374 C LEU B 98 11.040 21.404 -19.177 1.00173.94 C
ATOM 3375 O LEU B 98 10.269 21.631 -18.248 1.00174.12 O
ATOM 3376 CB LEU B 98 11.885 19.150 -19.845 1.00174.40 C
ATOM 3377 CG LEU B 98 12.138 18.775 -18.383 1.00173.63 C
ATOM 3378 CD1 LEU B 98 10.898 18.161 -17.753 1.00173.27 C
ATOM 3379 CD2 LEU B 98 13.325 17.831 -18.271 1.00173.62 C
ATOM 3380 N ALA B 99 12.105 22.153 -19.447 1.00174.13 N
ATOM 3381 CA ALA B 99 12.470 23.337 -18.672 1.00174.53 C
ATOM 3382 C ALA B 99 11.294 24.294 -18.481 1.00174.42 C
ATOM 3383 O ALA B 99 10.948 24.651 -17.354 1.00174.70 O
ATOM 3384 CB ALA B 99 13.630 24.060 -19.342 1.00174.77 C
ATOM 3385 N HIS B 100 10.707 24.721 -19.596 1.00173.81 N
ATOM 3386 CA HIS B 100 9.600 25.672 -19.592 1.00173.59 C
ATOM 3387 C HIS B 100 8.415 25.209 -18.754 1.00173.70 C
ATOM 3388 O HIS B 100 7.804 25.999 -18.032 1.00173.72 O
ATOM 3389 CB HIS B 100 9.138 25.923 -21.022 1.00172.88 C
ATOM 3390 CG HIS B 100 10.043 26.829 -21.789 1.00172.32 C
ATOM 3391 ND1 HIS B 100 11.331 26.477 -22.129 1.00172.44 N
ATOM 3392 CD2 HIS B 100 9.851 28.077 -22.275 1.00172.44 C
ATOM 3393 CE1 HIS B 100 11.892 27.468 -22.798 1.00173.02 C
ATOM 3394 NE2 HIS B 100 11.015 28.450 -22.899 1.00172.64 N
ATOM 3395 N ILE B 101 8.095 23.925 -18.865 1.00173.61 N
ATOM 3396 CA ILE B 101 7.003 23.337 -18.106 1.00173.23 C
ATOM 3397 C ILE B 101 7.270 23.438 -16.607 1.00173.66 C
ATOM 3398 O ILE B 101 6.386 23.812 -15.835 1.00173.72 O
ATOM 3399 CB ILE B 101 6.782 21.868 -18.500 1.00173.08 C
ATOM 3400 CG1 ILE B 101 6.235 21.786 -19.925 1.00174.34 C
ATOM 3401 CG2 ILE B 101 5.828 21.188 -17.536 1.00173.30 C
ATOM 3402 CD1 ILE B 101 4.932 22.533 -20.120 1.00174.32 C
ATOM 3403 N VAL B 102 8.502 23.136 -16.204 1.00174.16 N
ATOM 3404 CA VAL B 102 8.881 23.186 -14.797 1.00173.77 C
ATOM 3405 C VAL B 102 8.883 24.620 -14.284 1.00173.95 C
ATOM 3406 O VAL B 102 8.374 24.900 -13.200 1.00174.58 O
ATOM 3407 CB VAL B 102 10.271 22.559 -14.557 1.00172.90 C
ATOM 3408 CG1 VAL B 102 10.627 22.603 -13.076 1.00172.48 C
ATOM 3409 CG2 VAL B 102 10.317 21.134 -15.083 1.00173.80 C
ATOM 3410 N LEU B 103 9.461 25.525 -15.069 1.00173.86 N
ATOM 3411 CA LEU B 103 9.474 26.942 -14.724 1.00173.90 C
ATOM 3412 C LEU B 103 8.057 27.489 -14.557 1.00173.91 C
ATOM 3413 O LEU B 103 7.814 28.355 -13.718 1.00174.02 O
ATOM 3414 CB LEU B 103 10.226 27.743 -15.791 1.00173.33 C
ATOM 3415 CG LEU B 103 10.208 29.266 -15.646 1.00173.08 C
ATOM 3416 CD1 LEU B 103 10.813 29.678 -14.315 1.00174.23 C
ATOM 3417 CD2 LEU B 103 10.946 29.921 -16.795 1.00173.36 C
ATOM 3418 N SER B 104 7.124 26.965 -15.345 1.00173.61 N
ATOM 3419 CA SER B 104 5.731 27.393 -15.270 1.00173.46 C
ATOM 3420 C SER B 104 5.116 26.996 -13.933 1.00173.68 C
ATOM 3421 O SER B 104 4.389 27.776 -13.318 1.00173.99 O
ATOM 3422 CB SER B 104 4.919 26.794 -16.420 1.00174.00 C
ATOM 3423 OG SER B 104 3.550 27.142 -16.312 1.00174.10 O
ATOM 3424 N GLY B 105 5.414 25.778 -13.492 1.00173.91 N
ATOM 3425 CA GLY B 105 4.935 25.282 -12.215 1.00173.95 C
ATOM 3426 C GLY B 105 5.440 26.090 -11.035 1.00173.32 C
ATOM 3427 O GLY B 105 4.711 26.315 -10.070 1.00172.61 O
ATOM 3428 N LEU B 106 6.696 26.517 -11.108 1.00173.38 N
ATOM 3429 CA LEU B 106 7.301 27.309 -10.043 1.00172.97 C
ATOM 3430 C LEU B 106 6.689 28.703 -9.979 1.00173.49 C
ATOM 3431 O LEU B 106 6.391 29.213 -8.899 1.00174.15 O
ATOM 3432 CB LEU B 106 8.813 27.409 -10.243 1.00172.79 C
ATOM 3433 CG LEU B 106 9.586 26.096 -10.123 1.00173.03 C
ATOM 3434 CD1 LEU B 106 11.018 26.275 -10.598 1.00173.48 C
ATOM 3435 CD2 LEU B 106 9.549 25.575 -8.694 1.00173.92 C
ATOM 3436 N LEU B 107 6.505 29.313 -11.146 1.00173.42 N
ATOM 3437 CA LEU B 107 5.891 30.632 -11.243 1.00173.49 C
ATOM 3438 C LEU B 107 4.443 30.587 -10.769 1.00173.53 C
ATOM 3439 O LEU B 107 3.913 31.575 -10.262 1.00173.62 O
ATOM 3440 CB LEU B 107 5.963 31.152 -12.679 1.00173.77 C
ATOM 3441 CG LEU B 107 7.367 31.436 -13.215 1.00174.03 C
ATOM 3442 CD1 LEU B 107 7.340 31.596 -14.727 1.00173.30 C
ATOM 3443 CD2 LEU B 107 7.981 32.660 -12.546 1.00174.67 C
ATOM 3444 N PHE B 108 3.815 29.429 -10.945 1.00173.42 N
ATOM 3445 CA PHE B 108 2.456 29.196 -10.474 1.00173.33 C
ATOM 3446 C PHE B 108 2.392 29.279 -8.952 1.00173.62 C
ATOM 3447 O PHE B 108 1.638 30.078 -8.396 1.00173.73 O
ATOM 3448 CB PHE B 108 1.954 27.833 -10.957 1.00173.58 C
ATOM 3449 CG PHE B 108 0.587 27.476 -10.454 1.00173.39 C
ATOM 3450 CD1 PHE B 108 -0.543 28.033 -11.029 1.00172.44 C
ATOM 3451 CD2 PHE B 108 0.430 26.580 -9.409 1.00174.25 C
ATOM 3452 CE1 PHE B 108 -1.803 27.708 -10.567 1.00173.25 C
ATOM 3453 CE2 PHE B 108 -0.827 26.251 -8.943 1.00174.71 C
ATOM 3454 CZ PHE B 108 -1.945 26.816 -9.523 1.00174.72 C
ATOM 3455 N LEU B 109 3.185 28.440 -8.290 1.00173.63 N
ATOM 3456 CA LEU B 109 3.286 28.439 -6.833 1.00173.70 C
ATOM 3457 C LEU B 109 3.640 29.821 -6.284 1.00173.76 C
ATOM 3458 O LEU B 109 3.065 30.269 -5.293 1.00174.18 O
ATOM 3459 CB LEU B 109 4.326 27.413 -6.374 1.00173.96 C
ATOM 3460 CG LEU B 109 4.077 25.958 -6.776 1.00174.10 C
ATOM 3461 CD1 LEU B 109 5.193 25.062 -6.257 1.00174.69 C
ATOM 3462 CD2 LEU B 109 2.721 25.484 -6.274 1.00173.64 C
ATOM 3463 N ALA B 110 4.586 30.488 -6.939 1.00173.72 N
ATOM 3464 CA ALA B 110 5.005 31.831 -6.548 1.00173.43 C
ATOM 3465 C ALA B 110 3.851 32.823 -6.646 1.00173.05 C
ATOM 3466 O ALA B 110 3.692 33.692 -5.790 1.00172.91 O
ATOM 3467 CB ALA B 110 6.173 32.294 -7.406 1.00173.68 C
ATOM 3468 N ALA B 111 3.057 32.695 -7.705 1.00172.94 N
ATOM 3469 CA ALA B 111 1.896 33.555 -7.905 1.00172.76 C
ATOM 3470 C ALA B 111 0.898 33.399 -6.764 1.00172.31 C
ATOM 3471 O ALA B 111 0.249 34.360 -6.354 1.00172.30 O
ATOM 3472 CB ALA B 111 1.232 33.244 -9.235 1.00173.28 C
ATOM 3473 N CYS B 112 0.786 32.175 -6.258 1.00171.96 N
ATOM 3474 CA CYS B 112 -0.106 31.873 -5.147 1.00172.48 C
ATOM 3475 C CYS B 112 0.366 32.528 -3.854 1.00173.04 C
ATOM 3476 O CYS B 112 -0.422 33.146 -3.139 1.00173.00 O
ATOM 3477 CB CYS B 112 -0.222 30.364 -4.959 1.00172.66 C
ATOM 3478 SG CYS B 112 -1.185 29.550 -6.248 1.00171.09 S
ATOM 3479 N TRP B 113 1.655 32.382 -3.561 1.00173.34 N
ATOM 3480 CA TRP B 113 2.251 32.981 -2.374 1.00173.69 C
ATOM 3481 C TRP B 113 2.054 34.497 -2.389 1.00173.69 C
ATOM 3482 O TRP B 113 1.605 35.081 -1.403 1.00173.36 O
ATOM 3483 CB TRP B 113 3.742 32.631 -2.280 1.00174.61 C
ATOM 3484 CG TRP B 113 4.382 33.028 -0.976 1.00174.62 C
ATOM 3485 CD1 TRP B 113 4.585 32.230 0.113 1.00174.28 C
ATOM 3486 CD2 TRP B 113 4.903 34.318 -0.629 1.00174.97 C
ATOM 3487 NE1 TRP B 113 5.196 32.942 1.116 1.00174.51 N
ATOM 3488 CE2 TRP B 113 5.403 34.226 0.686 1.00174.67 C
ATOM 3489 CE3 TRP B 113 4.994 35.541 -1.301 1.00174.58 C
ATOM 3490 CZ2 TRP B 113 5.984 35.311 1.341 1.00174.56 C
ATOM 3491 CZ3 TRP B 113 5.571 36.616 -0.649 1.00173.96 C
ATOM 3492 CH2 TRP B 113 6.058 36.494 0.658 1.00174.11 C
ATOM 3493 N HIS B 114 2.385 35.126 -3.515 1.00173.52 N
ATOM 3494 CA HIS B 114 2.276 36.577 -3.649 1.00173.23 C
ATOM 3495 C HIS B 114 0.844 37.074 -3.639 1.00173.08 C
ATOM 3496 O HIS B 114 0.590 38.270 -3.495 1.00173.31 O
ATOM 3497 CB HIS B 114 2.940 37.046 -4.935 1.00172.81 C
ATOM 3498 CG HIS B 114 4.408 37.269 -4.798 1.00172.18 C
ATOM 3499 ND1 HIS B 114 4.933 38.292 -4.040 1.00172.10 N
ATOM 3500 CD2 HIS B 114 5.464 36.600 -5.315 1.00172.41 C
ATOM 3501 CE1 HIS B 114 6.251 38.244 -4.096 1.00172.22 C
ATOM 3502 NE2 HIS B 114 6.597 37.229 -4.866 1.00172.48 N
ATOM 3503 N TRP B 115 -0.093 36.153 -3.787 1.00172.87 N
ATOM 3504 CA TRP B 115 -1.492 36.513 -3.760 1.00173.41 C
ATOM 3505 C TRP B 115 -1.979 36.539 -2.317 1.00174.33 C
ATOM 3506 O TRP B 115 -2.626 37.493 -1.888 1.00174.90 O
ATOM 3507 CB TRP B 115 -2.307 35.538 -4.600 1.00174.12 C
ATOM 3508 CG TRP B 115 -3.753 35.847 -4.600 1.00174.77 C
ATOM 3509 CD1 TRP B 115 -4.699 35.328 -3.771 1.00174.95 C
ATOM 3510 CD2 TRP B 115 -4.434 36.759 -5.468 1.00175.02 C
ATOM 3511 NE1 TRP B 115 -5.930 35.859 -4.068 1.00174.88 N
ATOM 3512 CE2 TRP B 115 -5.794 36.742 -5.110 1.00174.67 C
ATOM 3513 CE3 TRP B 115 -4.025 37.591 -6.519 1.00175.23 C
ATOM 3514 CZ2 TRP B 115 -6.749 37.518 -5.756 1.00174.10 C
ATOM 3515 CZ3 TRP B 115 -4.975 38.363 -7.162 1.00175.04 C
ATOM 3516 CH2 TRP B 115 -6.322 38.321 -6.778 1.00174.68 C
ATOM 3517 N VAL B 116 -1.648 35.489 -1.571 1.00174.29 N
ATOM 3518 CA VAL B 116 -2.057 35.376 -0.174 1.00174.04 C
ATOM 3519 C VAL B 116 -1.337 36.410 0.694 1.00173.85 C
ATOM 3520 O VAL B 116 -1.963 37.093 1.507 1.00173.80 O
ATOM 3521 CB VAL B 116 -1.792 33.955 0.376 1.00173.41 C
ATOM 3522 CG1 VAL B 116 -1.621 33.983 1.883 1.00173.56 C
ATOM 3523 CG2 VAL B 116 -2.926 33.024 -0.001 1.00172.22 C
ATOM 3524 N TYR B 117 -0.027 36.539 0.503 1.00173.20 N
ATOM 3525 CA TYR B 117 0.771 37.502 1.259 1.00172.54 C
ATOM 3526 C TYR B 117 0.945 38.798 0.476 1.00172.77 C
ATOM 3527 O TYR B 117 2.062 39.195 0.144 1.00172.15 O
ATOM 3528 CB TYR B 117 2.131 36.902 1.616 1.00172.48 C
ATOM 3529 CG TYR B 117 2.025 35.676 2.491 1.00173.60 C
ATOM 3530 CD1 TYR B 117 1.609 35.777 3.812 1.00174.62 C
ATOM 3531 CD2 TYR B 117 2.324 34.416 1.994 1.00173.81 C
ATOM 3532 CE1 TYR B 117 1.503 34.657 4.616 1.00174.62 C
ATOM 3533 CE2 TYR B 117 2.223 33.291 2.790 1.00174.13 C
ATOM 3534 CZ TYR B 117 1.811 33.416 4.099 1.00174.23 C
ATOM 3535 OH TYR B 117 1.710 32.294 4.889 1.00174.01 O
ATOM 3536 N TRP B 118 -0.177 39.449 0.190 1.00173.78 N
ATOM 3537 CA TRP B 118 -0.199 40.659 -0.624 1.00174.34 C
ATOM 3538 C TRP B 118 0.291 41.893 0.127 1.00174.44 C
ATOM 3539 O TRP B 118 0.871 42.801 -0.470 1.00174.14 O
ATOM 3540 CB TRP B 118 -1.617 40.911 -1.138 1.00174.44 C
ATOM 3541 CG TRP B 118 -2.606 41.140 -0.034 1.00174.93 C
ATOM 3542 CD1 TRP B 118 -3.340 40.192 0.618 1.00174.89 C
ATOM 3543 CD2 TRP B 118 -2.964 42.398 0.554 1.00175.20 C
ATOM 3544 NE1 TRP B 118 -4.133 40.781 1.574 1.00175.15 N
ATOM 3545 CE2 TRP B 118 -3.921 42.133 1.555 1.00175.23 C
ATOM 3546 CE3 TRP B 118 -2.569 43.721 0.329 1.00174.89 C
ATOM 3547 CZ2 TRP B 118 -4.488 43.144 2.330 1.00174.41 C
ATOM 3548 CZ3 TRP B 118 -3.132 44.721 1.101 1.00175.06 C
ATOM 3549 CH2 TRP B 118 -4.080 44.427 2.089 1.00174.54 C
ATOM 3550 N ASP B 119 0.060 41.923 1.436 1.00174.83 N
ATOM 3551 CA ASP B 119 0.326 43.121 2.224 1.00174.50 C
ATOM 3552 C ASP B 119 1.729 43.124 2.812 1.00174.02 C
ATOM 3553 O ASP B 119 1.908 43.256 4.022 1.00173.49 O
ATOM 3554 CB ASP B 119 -0.709 43.266 3.341 1.00174.71 C
ATOM 3555 CG ASP B 119 -0.792 44.684 3.876 1.00174.82 C
ATOM 3556 OD1 ASP B 119 -0.414 45.621 3.140 1.00173.41 O
ATOM 3557 OD2 ASP B 119 -1.240 44.862 5.028 1.00176.63 O
ATOM 3558 N LEU B 120 2.721 42.972 1.943 1.00174.56 N
ATOM 3559 CA LEU B 120 4.109 43.105 2.354 1.00174.97 C
ATOM 3560 C LEU B 120 4.420 44.579 2.588 1.00174.58 C
ATOM 3561 O LEU B 120 3.871 45.450 1.911 1.00174.09 O
ATOM 3562 CB LEU B 120 5.046 42.512 1.300 1.00174.92 C
ATOM 3563 CG LEU B 120 4.775 41.055 0.913 1.00174.57 C
ATOM 3564 CD1 LEU B 120 5.625 40.640 -0.280 1.00174.12 C
ATOM 3565 CD2 LEU B 120 5.007 40.122 2.094 1.00174.68 C
ATOM 3566 N GLU B 121 5.291 44.851 3.555 1.00174.83 N
ATOM 3567 CA GLU B 121 5.643 46.220 3.916 1.00175.08 C
ATOM 3568 C GLU B 121 6.386 46.926 2.785 1.00175.43 C
ATOM 3569 O GLU B 121 6.308 48.147 2.651 1.00175.30 O
ATOM 3570 CB GLU B 121 6.479 46.233 5.206 1.00175.08 C
ATOM 3571 CG GLU B 121 7.871 45.605 5.093 1.00175.48 C
ATOM 3572 CD GLU B 121 8.931 46.578 4.609 1.00176.12 C
ATOM 3573 OE1 GLU B 121 9.001 47.703 5.146 1.00176.13 O
ATOM 3574 OE2 GLU B 121 9.694 46.212 3.690 1.00175.92 O
ATOM 3575 N LEU B 122 7.098 46.148 1.974 1.00175.33 N
ATOM 3576 CA LEU B 122 7.900 46.672 0.869 1.00174.54 C
ATOM 3577 C LEU B 122 7.101 47.556 -0.089 1.00174.23 C
ATOM 3578 O LEU B 122 7.659 48.426 -0.759 1.00173.64 O
ATOM 3579 CB LEU B 122 8.534 45.514 0.095 1.00174.21 C
ATOM 3580 CG LEU B 122 9.607 45.869 -0.933 1.00174.35 C
ATOM 3581 CD1 LEU B 122 10.666 46.752 -0.301 1.00173.41 C
ATOM 3582 CD2 LEU B 122 10.229 44.606 -1.509 1.00174.51 C
ATOM 3583 N PHE B 123 5.792 47.335 -0.139 1.00174.78 N
ATOM 3584 CA PHE B 123 4.921 48.062 -1.053 1.00174.89 C
ATOM 3585 C PHE B 123 4.307 49.279 -0.372 1.00174.51 C
ATOM 3586 O PHE B 123 3.656 50.100 -1.015 1.00174.12 O
ATOM 3587 CB PHE B 123 3.823 47.137 -1.580 1.00174.60 C
ATOM 3588 CG PHE B 123 4.339 45.828 -2.104 1.00173.97 C
ATOM 3589 CD1 PHE B 123 5.471 45.784 -2.901 1.00173.84 C
ATOM 3590 CD2 PHE B 123 3.698 44.641 -1.792 1.00173.84 C
ATOM 3591 CE1 PHE B 123 5.951 44.582 -3.382 1.00174.18 C
ATOM 3592 CE2 PHE B 123 4.174 43.435 -2.270 1.00174.13 C
ATOM 3593 CZ PHE B 123 5.302 43.406 -3.066 1.00174.46 C
ATOM 3594 N ARG B 124 4.523 49.385 0.934 1.00174.22 N
ATOM 3595 CA ARG B 124 4.027 50.517 1.706 1.00173.85 C
ATOM 3596 C ARG B 124 5.092 51.604 1.829 1.00173.82 C
ATOM 3597 O ARG B 124 6.242 51.322 2.164 1.00174.03 O
ATOM 3598 CB ARG B 124 3.573 50.060 3.095 1.00174.40 C
ATOM 3599 CG ARG B 124 2.307 49.214 3.092 1.00173.71 C
ATOM 3600 CD ARG B 124 1.086 50.053 2.741 1.00174.08 C
ATOM 3601 NE ARG B 124 -0.146 49.273 2.611 1.00173.62 N
ATOM 3602 CZ ARG B 124 -0.746 48.624 3.606 1.00173.55 C
ATOM 3603 NH1 ARG B 124 -0.255 48.674 4.836 1.00175.05 N
ATOM 3604 NH2 ARG B 124 -1.858 47.942 3.374 1.00173.05 N
ATOM 3605 N ASP B 125 4.705 52.844 1.545 1.00173.65 N
ATOM 3606 CA ASP B 125 5.614 53.979 1.659 1.00174.14 C
ATOM 3607 C ASP B 125 5.751 54.409 3.120 1.00175.03 C
ATOM 3608 O ASP B 125 4.751 54.695 3.775 1.00175.26 O
ATOM 3609 CB ASP B 125 5.119 55.147 0.800 1.00173.81 C
ATOM 3610 CG ASP B 125 6.001 56.375 0.914 1.00173.89 C
ATOM 3611 OD1 ASP B 125 7.229 56.249 0.732 1.00173.54 O
ATOM 3612 OD2 ASP B 125 5.463 57.470 1.184 1.00174.10 O
ATOM 3613 N PRO B 126 6.994 54.452 3.633 1.00175.17 N
ATOM 3614 CA PRO B 126 7.296 54.837 5.018 1.00174.45 C
ATOM 3615 C PRO B 126 6.654 56.161 5.425 1.00174.10 C
ATOM 3616 O PRO B 126 6.131 56.277 6.535 1.00174.37 O
ATOM 3617 CB PRO B 126 8.821 54.950 5.017 1.00174.20 C
ATOM 3618 CG PRO B 126 9.252 53.981 3.972 1.00174.61 C
ATOM 3619 CD PRO B 126 8.221 54.121 2.886 1.00174.62 C
ATOM 3620 N ARG B 127 6.702 57.142 4.531 1.00173.81 N
ATOM 3621 CA ARG B 127 6.097 58.448 4.770 1.00174.28 C
ATOM 3622 C ARG B 127 4.576 58.347 4.929 1.00174.82 C
ATOM 3623 O ARG B 127 4.052 58.503 6.033 1.00174.62 O
ATOM 3624 CB ARG B 127 6.473 59.412 3.632 1.00174.02 C
ATOM 3625 CG ARG B 127 5.593 60.659 3.469 1.00174.91 C
ATOM 3626 CD ARG B 127 5.438 61.472 4.749 1.00175.29 C
ATOM 3627 NE ARG B 127 4.351 62.440 4.623 1.00174.99 N
ATOM 3628 CZ ARG B 127 3.619 62.889 5.638 1.00175.40 C
ATOM 3629 NH1 ARG B 127 3.854 62.463 6.872 1.00175.51 N
ATOM 3630 NH2 ARG B 127 2.651 63.769 5.419 1.00175.31 N
ATOM 3631 N THR B 128 3.873 58.085 3.832 1.00175.15 N
ATOM 3632 CA THR B 128 2.415 58.144 3.829 1.00175.15 C
ATOM 3633 C THR B 128 1.750 56.931 4.487 1.00175.66 C
ATOM 3634 O THR B 128 0.564 56.971 4.812 1.00176.06 O
ATOM 3635 CB THR B 128 1.879 58.287 2.391 1.00174.91 C
ATOM 3636 OG1 THR B 128 2.488 57.297 1.553 1.00174.68 O
ATOM 3637 CG2 THR B 128 2.191 59.671 1.841 1.00174.52 C
ATOM 3638 N GLY B 129 2.511 55.858 4.685 1.00175.55 N
ATOM 3639 CA GLY B 129 1.975 54.648 5.286 1.00175.05 C
ATOM 3640 C GLY B 129 0.966 53.921 4.413 1.00175.58 C
ATOM 3641 O GLY B 129 0.311 52.978 4.860 1.00175.58 O
ATOM 3642 N GLU B 130 0.842 54.358 3.163 1.00175.22 N
ATOM 3643 CA GLU B 130 -0.095 53.758 2.218 1.00175.11 C
ATOM 3644 C GLU B 130 0.669 53.152 1.036 1.00174.74 C
ATOM 3645 O GLU B 130 1.796 53.566 0.760 1.00174.03 O
ATOM 3646 CB GLU B 130 -1.109 54.805 1.746 1.00174.92 C
ATOM 3647 CG GLU B 130 -0.499 55.987 1.021 1.00175.52 C
ATOM 3648 CD GLU B 130 -1.446 57.167 0.945 1.00176.22 C
ATOM 3649 OE1 GLU B 130 -1.123 58.150 0.243 1.00176.79 O
ATOM 3650 OE2 GLU B 130 -2.514 57.112 1.592 1.00176.26 O
ATOM 3651 N PRO B 131 0.068 52.161 0.346 1.00175.17 N
ATOM 3652 CA PRO B 131 0.734 51.480 -0.773 1.00174.24 C
ATOM 3653 C PRO B 131 1.264 52.429 -1.845 1.00174.01 C
ATOM 3654 O PRO B 131 0.546 53.327 -2.287 1.00174.18 O
ATOM 3655 CB PRO B 131 -0.372 50.584 -1.347 1.00173.87 C
ATOM 3656 CG PRO B 131 -1.652 51.168 -0.833 1.00174.26 C
ATOM 3657 CD PRO B 131 -1.300 51.649 0.536 1.00175.29 C
ATOM 3658 N ALA B 132 2.512 52.221 -2.253 1.00173.97 N
ATOM 3659 CA ALA B 132 3.163 53.086 -3.230 1.00174.13 C
ATOM 3660 C ALA B 132 4.384 52.404 -3.843 1.00175.21 C
ATOM 3661 O ALA B 132 5.101 51.665 -3.165 1.00175.45 O
ATOM 3662 CB ALA B 132 3.561 54.406 -2.586 1.00173.69 C
ATOM 3663 N LEU B 133 4.611 52.654 -5.130 1.00175.26 N
ATOM 3664 CA LEU B 133 5.762 52.096 -5.836 1.00174.54 C
ATOM 3665 C LEU B 133 6.554 53.190 -6.542 1.00173.90 C
ATOM 3666 O LEU B 133 6.004 53.951 -7.338 1.00173.42 O
ATOM 3667 CB LEU B 133 5.319 51.038 -6.850 1.00174.32 C
ATOM 3668 CG LEU B 133 4.652 49.766 -6.328 1.00174.80 C
ATOM 3669 CD1 LEU B 133 4.070 48.961 -7.479 1.00173.79 C
ATOM 3670 CD2 LEU B 133 5.640 48.928 -5.530 1.00174.32 C
ATOM 3671 N ASP B 134 7.848 53.259 -6.250 1.00173.71 N
ATOM 3672 CA ASP B 134 8.716 54.265 -6.849 1.00174.32 C
ATOM 3673 C ASP B 134 9.127 53.842 -8.256 1.00174.36 C
ATOM 3674 O ASP B 134 10.192 53.257 -8.454 1.00175.38 O
ATOM 3675 CB ASP B 134 9.948 54.501 -5.972 1.00174.61 C
ATOM 3676 CG ASP B 134 10.819 55.635 -6.478 1.00174.93 C
ATOM 3677 OD1 ASP B 134 10.269 56.596 -7.056 1.00175.76 O
ATOM 3678 OD2 ASP B 134 12.050 55.574 -6.283 1.00173.98 O
ATOM 3679 N LEU B 135 8.260 54.133 -9.221 1.00173.74 N
ATOM 3680 CA LEU B 135 8.479 53.777 -10.623 1.00173.33 C
ATOM 3681 C LEU B 135 9.833 54.215 -11.221 1.00173.09 C
ATOM 3682 O LEU B 135 10.518 53.387 -11.822 1.00172.94 O
ATOM 3683 CB LEU B 135 7.333 54.332 -11.480 1.00173.41 C
ATOM 3684 CG LEU B 135 5.918 53.898 -11.099 1.00173.91 C
ATOM 3685 CD1 LEU B 135 4.890 54.776 -11.788 1.00174.56 C
ATOM 3686 CD2 LEU B 135 5.693 52.441 -11.459 1.00173.93 C
ATOM 3687 N PRO B 136 10.222 55.504 -11.077 1.00173.06 N
ATOM 3688 CA PRO B 136 11.489 55.947 -11.679 1.00173.28 C
ATOM 3689 C PRO B 136 12.717 55.108 -11.307 1.00173.60 C
ATOM 3690 O PRO B 136 13.538 54.816 -12.179 1.00172.81 O
ATOM 3691 CB PRO B 136 11.639 57.372 -11.141 1.00173.64 C
ATOM 3692 CG PRO B 136 10.245 57.832 -10.957 1.00173.72 C
ATOM 3693 CD PRO B 136 9.540 56.628 -10.406 1.00173.65 C
ATOM 3694 N LYS B 137 12.840 54.730 -10.038 1.00174.90 N
ATOM 3695 CA LYS B 137 13.993 53.952 -9.595 1.00174.99 C
ATOM 3696 C LYS B 137 13.880 52.500 -10.055 1.00175.23 C
ATOM 3697 O LYS B 137 14.883 51.877 -10.408 1.00175.03 O
ATOM 3698 CB LYS B 137 14.145 54.011 -8.072 1.00173.49 C
ATOM 3699 CG LYS B 137 15.562 53.715 -7.586 1.00172.28 C
ATOM 3700 CD LYS B 137 15.620 53.539 -6.077 1.00171.65 C
ATOM 3701 CE LYS B 137 14.996 54.718 -5.353 1.00172.45 C
ATOM 3702 NZ LYS B 137 14.641 54.376 -3.949 1.00173.24 N
ATOM 3703 N MET B 138 12.659 51.970 -10.047 1.00175.15 N
ATOM 3704 CA MET B 138 12.404 50.615 -10.531 1.00174.00 C
ATOM 3705 C MET B 138 12.874 50.440 -11.965 1.00173.46 C
ATOM 3706 O MET B 138 13.604 49.498 -12.278 1.00173.57 O
ATOM 3707 CB MET B 138 10.917 50.272 -10.448 1.00173.23 C
ATOM 3708 CG MET B 138 10.441 49.815 -9.090 1.00174.00 C
ATOM 3709 SD MET B 138 8.823 49.039 -9.241 1.00173.43 S
ATOM 3710 CE MET B 138 7.752 50.465 -9.320 1.00173.35 C
ATOM 3711 N PHE B 139 12.425 51.345 -12.830 1.00173.14 N
ATOM 3712 CA PHE B 139 12.815 51.341 -14.233 1.00173.73 C
ATOM 3713 C PHE B 139 14.328 51.269 -14.376 1.00173.21 C
ATOM 3714 O PHE B 139 14.842 50.502 -15.185 1.00173.58 O
ATOM 3715 CB PHE B 139 12.277 52.581 -14.948 1.00174.40 C
ATOM 3716 CG PHE B 139 12.863 52.788 -16.314 1.00174.00 C
ATOM 3717 CD1 PHE B 139 12.544 51.929 -17.353 1.00173.70 C
ATOM 3718 CD2 PHE B 139 13.732 53.837 -16.561 1.00173.58 C
ATOM 3719 CE1 PHE B 139 13.082 52.111 -18.612 1.00173.40 C
ATOM 3720 CE2 PHE B 139 14.272 54.025 -17.819 1.00173.05 C
ATOM 3721 CZ PHE B 139 13.947 53.160 -18.844 1.00173.26 C
ATOM 3722 N GLY B 140 15.033 52.066 -13.578 1.00172.57 N
ATOM 3723 CA GLY B 140 16.483 52.057 -13.578 1.00173.19 C
ATOM 3724 C GLY B 140 17.044 50.693 -13.233 1.00173.77 C
ATOM 3725 O GLY B 140 17.943 50.196 -13.909 1.00174.27 O
ATOM 3726 N ILE B 141 16.509 50.093 -12.174 1.00173.78 N
ATOM 3727 CA ILE B 141 16.913 48.754 -11.755 1.00174.42 C
ATOM 3728 C ILE B 141 16.708 47.727 -12.866 1.00174.22 C
ATOM 3729 O ILE B 141 17.645 47.034 -13.264 1.00174.13 O
ATOM 3730 CB ILE B 141 16.142 48.301 -10.500 1.00174.14 C
ATOM 3731 CG1 ILE B 141 16.422 49.252 -9.333 1.00174.09 C
ATOM 3732 CG2 ILE B 141 16.515 46.872 -10.130 1.00173.46 C
ATOM 3733 CD1 ILE B 141 15.799 48.818 -8.026 1.00174.42 C
ATOM 3734 N HIS B 142 15.473 47.626 -13.352 1.00174.01 N
ATOM 3735 CA HIS B 142 15.136 46.709 -14.439 1.00173.49 C
ATOM 3736 C HIS B 142 15.988 46.944 -15.682 1.00173.28 C
ATOM 3737 O HIS B 142 16.528 45.999 -16.254 1.00173.38 O
ATOM 3738 CB HIS B 142 13.652 46.828 -14.795 1.00173.58 C
ATOM 3739 CG HIS B 142 12.734 46.383 -13.701 1.00174.32 C
ATOM 3740 ND1 HIS B 142 11.365 46.522 -13.776 1.00174.52 N
ATOM 3741 CD2 HIS B 142 12.988 45.799 -12.505 1.00174.28 C
ATOM 3742 CE1 HIS B 142 10.815 46.045 -12.673 1.00174.26 C
ATOM 3743 NE2 HIS B 142 11.778 45.600 -11.886 1.00174.07 N
ATOM 3744 N LEU B 143 16.095 48.202 -16.100 1.00173.55 N
ATOM 3745 CA LEU B 143 16.888 48.562 -17.273 1.00173.71 C
ATOM 3746 C LEU B 143 18.345 48.144 -17.108 1.00173.83 C
ATOM 3747 O LEU B 143 19.004 47.761 -18.076 1.00174.07 O
ATOM 3748 CB LEU B 143 16.805 50.066 -17.538 1.00173.23 C
ATOM 3749 CG LEU B 143 17.600 50.616 -18.723 1.00172.64 C
ATOM 3750 CD1 LEU B 143 17.206 49.896 -20.003 1.00173.36 C
ATOM 3751 CD2 LEU B 143 17.394 52.116 -18.859 1.00172.79 C
ATOM 3752 N PHE B 144 18.841 48.221 -15.878 1.00173.51 N
ATOM 3753 CA PHE B 144 20.201 47.795 -15.574 1.00173.59 C
ATOM 3754 C PHE B 144 20.328 46.290 -15.769 1.00173.98 C
ATOM 3755 O PHE B 144 21.285 45.813 -16.377 1.00174.40 O
ATOM 3756 CB PHE B 144 20.588 48.186 -14.147 1.00173.81 C
ATOM 3757 CG PHE B 144 21.924 47.651 -13.712 1.00174.58 C
ATOM 3758 CD1 PHE B 144 23.093 48.303 -14.067 1.00174.40 C
ATOM 3759 CD2 PHE B 144 22.011 46.501 -12.946 1.00176.03 C
ATOM 3760 CE1 PHE B 144 24.325 47.815 -13.670 1.00175.19 C
ATOM 3761 CE2 PHE B 144 23.239 46.007 -12.546 1.00177.09 C
ATOM 3762 CZ PHE B 144 24.398 46.666 -12.908 1.00176.70 C
ATOM 3763 N LEU B 145 19.353 45.550 -15.247 1.00173.51 N
ATOM 3764 CA LEU B 145 19.328 44.097 -15.373 1.00173.48 C
ATOM 3765 C LEU B 145 19.180 43.666 -16.826 1.00173.83 C
ATOM 3766 O LEU B 145 19.808 42.702 -17.264 1.00173.65 O
ATOM 3767 CB LEU B 145 18.190 43.508 -14.541 1.00172.67 C
ATOM 3768 CG LEU B 145 18.290 43.714 -13.031 1.00173.10 C
ATOM 3769 CD1 LEU B 145 16.902 43.751 -12.418 1.00173.54 C
ATOM 3770 CD2 LEU B 145 19.139 42.622 -12.394 1.00172.73 C
ATOM 3771 N ALA B 146 18.336 44.382 -17.562 1.00174.05 N
ATOM 3772 CA ALA B 146 18.105 44.101 -18.975 1.00173.82 C
ATOM 3773 C ALA B 146 19.393 44.229 -19.781 1.00173.69 C
ATOM 3774 O ALA B 146 19.801 43.291 -20.462 1.00174.19 O
ATOM 3775 CB ALA B 146 17.038 45.030 -19.532 1.00173.57 C
ATOM 3776 N GLY B 147 20.024 45.397 -19.699 1.00173.49 N
ATOM 3777 CA GLY B 147 21.284 45.642 -20.378 1.00173.75 C
ATOM 3778 C GLY B 147 22.386 44.689 -19.954 1.00174.31 C
ATOM 3779 O GLY B 147 23.221 44.291 -20.767 1.00174.52 O
ATOM 3780 N LEU B 148 22.390 44.328 -18.674 1.00174.63 N
ATOM 3781 CA LEU B 148 23.363 43.381 -18.140 1.00175.23 C
ATOM 3782 C LEU B 148 23.157 41.999 -18.755 1.00175.47 C
ATOM 3783 O LEU B 148 24.118 41.296 -19.069 1.00175.43 O
ATOM 3784 CB LEU B 148 23.259 43.303 -16.615 1.00175.05 C
ATOM 3785 CG LEU B 148 24.182 42.325 -15.883 1.00174.70 C
ATOM 3786 CD1 LEU B 148 25.631 42.526 -16.307 1.00175.01 C
ATOM 3787 CD2 LEU B 148 24.031 42.463 -14.374 1.00173.39 C
ATOM 3788 N LEU B 149 21.894 41.620 -18.925 1.00175.38 N
ATOM 3789 CA LEU B 149 21.551 40.331 -19.512 1.00174.93 C
ATOM 3790 C LEU B 149 21.710 40.387 -21.029 1.00173.99 C
ATOM 3791 O LEU B 149 22.097 39.401 -21.660 1.00172.99 O
ATOM 3792 CB LEU B 149 20.122 39.931 -19.132 1.00174.60 C
ATOM 3793 CG LEU B 149 19.658 38.528 -19.528 1.00174.33 C
ATOM 3794 CD1 LEU B 149 20.548 37.462 -18.901 1.00175.15 C
ATOM 3795 CD2 LEU B 149 18.198 38.308 -19.152 1.00174.39 C
ATOM 3796 N CYS B 150 21.399 41.546 -21.605 1.00174.39 N
ATOM 3797 CA CYS B 150 21.585 41.786 -23.035 1.00174.82 C
ATOM 3798 C CYS B 150 23.046 41.626 -23.435 1.00174.70 C
ATOM 3799 O CYS B 150 23.362 40.938 -24.407 1.00174.62 O
ATOM 3800 CB CYS B 150 21.090 43.185 -23.414 1.00175.30 C
ATOM 3801 SG CYS B 150 21.178 43.561 -25.182 1.00175.23 S
ATOM 3802 N PHE B 151 23.926 42.287 -22.686 1.00174.82 N
ATOM 3803 CA PHE B 151 25.367 42.191 -22.896 1.00174.74 C
ATOM 3804 C PHE B 151 25.839 40.740 -22.925 1.00174.60 C
ATOM 3805 O PHE B 151 26.444 40.299 -23.900 1.00174.51 O
ATOM 3806 CB PHE B 151 26.118 42.964 -21.809 1.00174.43 C
ATOM 3807 CG PHE B 151 27.605 42.760 -21.839 1.00174.42 C
ATOM 3808 CD1 PHE B 151 28.376 43.348 -22.828 1.00173.88 C
ATOM 3809 CD2 PHE B 151 28.233 41.981 -20.881 1.00174.69 C
ATOM 3810 CE1 PHE B 151 29.745 43.163 -22.862 1.00173.45 C
ATOM 3811 CE2 PHE B 151 29.602 41.792 -20.909 1.00175.04 C
ATOM 3812 CZ PHE B 151 30.360 42.384 -21.902 1.00174.14 C
ATOM 3813 N GLY B 152 25.559 40.013 -21.846 1.00174.10 N
ATOM 3814 CA GLY B 152 25.925 38.612 -21.728 1.00173.85 C
ATOM 3815 C GLY B 152 25.491 37.751 -22.899 1.00174.10 C
ATOM 3816 O GLY B 152 26.265 36.928 -23.390 1.00174.10 O
ATOM 3817 N PHE B 153 24.245 37.929 -23.331 1.00174.18 N
ATOM 3818 CA PHE B 153 23.701 37.189 -24.467 1.00174.49 C
ATOM 3819 C PHE B 153 24.543 37.399 -25.723 1.00174.38 C
ATOM 3820 O PHE B 153 24.876 36.448 -26.428 1.00174.43 O
ATOM 3821 CB PHE B 153 22.251 37.601 -24.733 1.00174.55 C
ATOM 3822 CG PHE B 153 21.644 36.937 -25.938 1.00174.32 C
ATOM 3823 CD1 PHE B 153 21.538 35.558 -26.005 1.00173.93 C
ATOM 3824 CD2 PHE B 153 21.184 37.692 -27.004 1.00174.02 C
ATOM 3825 CE1 PHE B 153 20.982 34.945 -27.112 1.00173.86 C
ATOM 3826 CE2 PHE B 153 20.628 37.085 -28.114 1.00173.90 C
ATOM 3827 CZ PHE B 153 20.527 35.709 -28.168 1.00174.16 C
ATOM 3828 N GLY B 154 24.880 38.654 -26.000 1.00174.24 N
ATOM 3829 CA GLY B 154 25.733 38.979 -27.127 1.00174.36 C
ATOM 3830 C GLY B 154 27.168 38.544 -26.899 1.00174.80 C
ATOM 3831 O GLY B 154 27.793 37.951 -27.778 1.00174.89 O
ATOM 3832 N ALA B 155 27.686 38.840 -25.710 1.00174.73 N
ATOM 3833 CA ALA B 155 29.085 38.582 -25.373 1.00174.52 C
ATOM 3834 C ALA B 155 29.456 37.100 -25.314 1.00174.38 C
ATOM 3835 O ALA B 155 30.493 36.697 -25.841 1.00174.35 O
ATOM 3836 CB ALA B 155 29.428 39.246 -24.045 1.00173.86 C
ATOM 3837 N PHE B 156 28.618 36.290 -24.673 1.00174.25 N
ATOM 3838 CA PHE B 156 28.981 34.899 -24.409 1.00174.10 C
ATOM 3839 C PHE B 156 28.238 33.881 -25.262 1.00174.40 C
ATOM 3840 O PHE B 156 28.834 32.922 -25.748 1.00174.43 O
ATOM 3841 CB PHE B 156 28.756 34.571 -22.932 1.00173.42 C
ATOM 3842 CG PHE B 156 29.542 35.436 -21.998 1.00174.23 C
ATOM 3843 CD1 PHE B 156 30.798 35.044 -21.569 1.00174.50 C
ATOM 3844 CD2 PHE B 156 29.033 36.645 -21.555 1.00174.69 C
ATOM 3845 CE1 PHE B 156 31.531 35.837 -20.712 1.00174.99 C
ATOM 3846 CE2 PHE B 156 29.762 37.444 -20.695 1.00175.19 C
ATOM 3847 CZ PHE B 156 31.013 37.039 -20.274 1.00175.14 C
ATOM 3848 N HIS B 157 26.940 34.082 -25.441 1.00174.71 N
ATOM 3849 CA HIS B 157 26.134 33.124 -26.189 1.00174.76 C
ATOM 3850 C HIS B 157 26.394 33.171 -27.693 1.00174.02 C
ATOM 3851 O HIS B 157 26.804 32.175 -28.287 1.00174.06 O
ATOM 3852 CB HIS B 157 24.649 33.353 -25.908 1.00174.87 C
ATOM 3853 CG HIS B 157 23.753 32.313 -26.506 1.00174.33 C
ATOM 3854 ND1 HIS B 157 23.161 31.322 -25.758 1.00173.68 N
ATOM 3855 CD2 HIS B 157 23.338 32.124 -27.781 1.00174.14 C
ATOM 3856 CE1 HIS B 157 22.424 30.557 -26.547 1.00173.27 C
ATOM 3857 NE2 HIS B 157 22.517 31.021 -27.778 1.00173.86 N
ATOM 3858 N LEU B 158 26.144 34.324 -28.303 1.00173.28 N
ATOM 3859 CA LEU B 158 26.280 34.471 -29.747 1.00172.86 C
ATOM 3860 C LEU B 158 27.721 34.314 -30.229 1.00173.44 C
ATOM 3861 O LEU B 158 27.962 33.814 -31.327 1.00174.07 O
ATOM 3862 CB LEU B 158 25.736 35.830 -30.188 1.00172.28 C
ATOM 3863 CG LEU B 158 24.270 36.096 -29.846 1.00172.63 C
ATOM 3864 CD1 LEU B 158 23.815 37.409 -30.457 1.00173.12 C
ATOM 3865 CD2 LEU B 158 23.392 34.948 -30.318 1.00173.13 C
ATOM 3866 N THR B 159 28.676 34.737 -29.407 1.00173.55 N
ATOM 3867 CA THR B 159 30.084 34.689 -29.793 1.00173.66 C
ATOM 3868 C THR B 159 30.663 33.282 -29.701 1.00172.66 C
ATOM 3869 O THR B 159 31.641 32.960 -30.376 1.00171.82 O
ATOM 3870 CB THR B 159 30.943 35.623 -28.922 1.00174.10 C
ATOM 3871 OG1 THR B 159 30.755 35.291 -27.542 1.00174.47 O
ATOM 3872 CG2 THR B 159 30.555 37.074 -29.147 1.00174.09 C
ATOM 3873 N GLY B 160 30.062 32.445 -28.864 1.00172.62 N
ATOM 3874 CA GLY B 160 30.554 31.095 -28.675 1.00172.78 C
ATOM 3875 C GLY B 160 31.514 30.989 -27.506 1.00173.86 C
ATOM 3876 O GLY B 160 31.953 29.892 -27.159 1.00174.16 O
ATOM 3877 N LEU B 161 31.857 32.136 -26.922 1.00174.71 N
ATOM 3878 CA LEU B 161 32.715 32.198 -25.739 1.00175.04 C
ATOM 3879 C LEU B 161 32.234 31.241 -24.656 1.00173.80 C
ATOM 3880 O LEU B 161 32.970 30.356 -24.217 1.00172.76 O
ATOM 3881 CB LEU B 161 32.762 33.624 -25.183 1.00175.21 C
ATOM 3882 CG LEU B 161 33.976 34.486 -25.538 1.00176.39 C
ATOM 3883 CD1 LEU B 161 34.047 34.734 -27.040 1.00175.80 C
ATOM 3884 CD2 LEU B 161 33.952 35.798 -24.767 1.00175.55 C
ATOM 3885 N PHE B 162 30.992 31.433 -24.228 1.00173.87 N
ATOM 3886 CA PHE B 162 30.353 30.516 -23.299 1.00174.30 C
ATOM 3887 C PHE B 162 28.931 30.258 -23.775 1.00174.21 C
ATOM 3888 O PHE B 162 27.962 30.618 -23.108 1.00173.55 O
ATOM 3889 CB PHE B 162 30.364 31.079 -21.877 1.00174.13 C
ATOM 3890 CG PHE B 162 29.884 30.107 -20.837 1.00174.27 C
ATOM 3891 CD1 PHE B 162 30.436 28.839 -20.751 1.00174.36 C
ATOM 3892 CD2 PHE B 162 28.887 30.460 -19.944 1.00174.31 C
ATOM 3893 CE1 PHE B 162 30.001 27.941 -19.796 1.00174.01 C
ATOM 3894 CE2 PHE B 162 28.448 29.567 -18.986 1.00174.63 C
ATOM 3895 CZ PHE B 162 29.006 28.306 -18.912 1.00174.66 C
ATOM 3896 N GLY B 163 28.821 29.643 -24.949 1.00174.41 N
ATOM 3897 CA GLY B 163 27.533 29.363 -25.556 1.00174.80 C
ATOM 3898 C GLY B 163 27.671 28.727 -26.927 1.00175.33 C
ATOM 3899 O GLY B 163 28.783 28.572 -27.433 1.00174.86 O
ATOM 3900 N PRO B 164 26.536 28.351 -27.536 1.00175.72 N
ATOM 3901 CA PRO B 164 26.476 27.681 -28.839 1.00174.95 C
ATOM 3902 C PRO B 164 26.749 28.607 -30.025 1.00174.53 C
ATOM 3903 O PRO B 164 27.525 28.252 -30.910 1.00174.28 O
ATOM 3904 CB PRO B 164 25.037 27.163 -28.886 1.00174.13 C
ATOM 3905 CG PRO B 164 24.278 28.162 -28.086 1.00174.13 C
ATOM 3906 CD PRO B 164 25.195 28.489 -26.940 1.00174.83 C
ATOM 3907 N GLY B 165 26.110 29.772 -30.040 1.00174.39 N
ATOM 3908 CA GLY B 165 26.180 30.673 -31.174 1.00173.77 C
ATOM 3909 C GLY B 165 24.788 30.930 -31.717 1.00173.66 C
ATOM 3910 O GLY B 165 23.837 31.081 -30.951 1.00173.85 O
ATOM 3911 N MET B 166 24.663 30.977 -33.039 1.00173.84 N
ATOM 3912 CA MET B 166 23.364 31.173 -33.675 1.00173.95 C
ATOM 3913 C MET B 166 23.339 30.550 -35.066 1.00173.70 C
ATOM 3914 O MET B 166 24.370 30.121 -35.582 1.00173.67 O
ATOM 3915 CB MET B 166 23.016 32.661 -33.758 1.00173.69 C
ATOM 3916 CG MET B 166 23.911 33.460 -34.685 1.00173.49 C
ATOM 3917 SD MET B 166 23.443 35.198 -34.759 1.00172.26 S
ATOM 3918 CE MET B 166 21.874 35.090 -35.617 1.00172.60 C
ATOM 3919 N TRP B 167 22.156 30.503 -35.669 1.00173.70 N
ATOM 3920 CA TRP B 167 22.001 29.912 -36.992 1.00173.24 C
ATOM 3921 C TRP B 167 22.591 30.806 -38.075 1.00172.78 C
ATOM 3922 O TRP B 167 22.232 31.978 -38.193 1.00172.10 O
ATOM 3923 CB TRP B 167 20.526 29.637 -37.286 1.00173.91 C
ATOM 3924 CG TRP B 167 20.315 28.742 -38.465 1.00173.62 C
ATOM 3925 CD1 TRP B 167 20.145 29.122 -39.763 1.00173.12 C
ATOM 3926 CD2 TRP B 167 20.259 27.311 -38.454 1.00174.10 C
ATOM 3927 NE1 TRP B 167 19.983 28.016 -40.562 1.00173.41 N
ATOM 3928 CE2 TRP B 167 20.049 26.892 -39.782 1.00173.98 C
ATOM 3929 CE3 TRP B 167 20.364 26.344 -37.449 1.00174.34 C
ATOM 3930 CZ2 TRP B 167 19.943 25.547 -40.132 1.00174.46 C
ATOM 3931 CZ3 TRP B 167 20.258 25.010 -37.799 1.00174.06 C
ATOM 3932 CH2 TRP B 167 20.049 24.623 -39.128 1.00174.09 C
ATOM 3933 N VAL B 168 23.492 30.238 -38.869 1.00173.03 N
ATOM 3934 CA VAL B 168 24.136 30.964 -39.958 1.00173.70 C
ATOM 3935 C VAL B 168 24.142 30.109 -41.218 1.00173.95 C
ATOM 3936 O VAL B 168 24.503 28.934 -41.174 1.00174.20 O
ATOM 3937 CB VAL B 168 25.582 31.360 -39.600 1.00174.57 C
ATOM 3938 CG1 VAL B 168 26.311 31.904 -40.821 1.00173.90 C
ATOM 3939 CG2 VAL B 168 25.591 32.381 -38.474 1.00175.78 C
ATOM 3940 N SER B 169 23.755 30.704 -42.342 1.00174.00 N
ATOM 3941 CA SER B 169 23.621 29.960 -43.589 1.00174.77 C
ATOM 3942 C SER B 169 24.252 30.685 -44.771 1.00174.25 C
ATOM 3943 O SER B 169 24.657 31.840 -44.661 1.00173.73 O
ATOM 3944 CB SER B 169 22.146 29.687 -43.885 1.00175.28 C
ATOM 3945 OG SER B 169 22.005 28.782 -44.967 1.00175.21 O
ATOM 3946 N ASP B 170 24.338 29.987 -45.899 1.00174.24 N
ATOM 3947 CA ASP B 170 24.838 30.567 -47.139 1.00173.80 C
ATOM 3948 C ASP B 170 23.766 31.476 -47.748 1.00174.11 C
ATOM 3949 O ASP B 170 22.636 31.505 -47.259 1.00174.10 O
ATOM 3950 CB ASP B 170 25.241 29.452 -48.114 1.00173.30 C
ATOM 3951 CG ASP B 170 24.135 28.447 -48.336 1.00173.19 C
ATOM 3952 OD1 ASP B 170 23.898 27.621 -47.431 1.00173.45 O
ATOM 3953 OD2 ASP B 170 23.505 28.482 -49.414 1.00172.90 O
ATOM 3954 N PRO B 171 24.104 32.221 -48.818 1.00174.46 N
ATOM 3955 CA PRO B 171 23.091 33.100 -49.415 1.00174.15 C
ATOM 3956 C PRO B 171 21.914 32.375 -50.064 1.00173.78 C
ATOM 3957 O PRO B 171 21.012 33.039 -50.575 1.00174.00 O
ATOM 3958 CB PRO B 171 23.888 33.864 -50.473 1.00173.27 C
ATOM 3959 CG PRO B 171 25.257 33.920 -49.915 1.00174.08 C
ATOM 3960 CD PRO B 171 25.453 32.559 -49.309 1.00174.67 C
ATOM 3961 N TYR B 172 21.917 31.047 -50.050 1.00173.39 N
ATOM 3962 CA TYR B 172 20.832 30.296 -50.666 1.00172.98 C
ATOM 3963 C TYR B 172 20.335 29.150 -49.789 1.00172.61 C
ATOM 3964 O TYR B 172 19.771 28.180 -50.294 1.00172.22 O
ATOM 3965 CB TYR B 172 21.284 29.764 -52.027 1.00173.25 C
ATOM 3966 CG TYR B 172 21.568 30.858 -53.031 1.00173.38 C
ATOM 3967 CD1 TYR B 172 20.542 31.426 -53.773 1.00173.25 C
ATOM 3968 CD2 TYR B 172 22.857 31.338 -53.221 1.00173.43 C
ATOM 3969 CE1 TYR B 172 20.792 32.428 -54.687 1.00172.97 C
ATOM 3970 CE2 TYR B 172 23.117 32.344 -54.133 1.00173.40 C
ATOM 3971 CZ TYR B 172 22.081 32.886 -54.862 1.00172.90 C
ATOM 3972 OH TYR B 172 22.331 33.888 -55.772 1.00172.32 O
ATOM 3973 N GLY B 173 20.524 29.289 -48.479 1.00173.12 N
ATOM 3974 CA GLY B 173 20.099 28.294 -47.507 1.00173.36 C
ATOM 3975 C GLY B 173 20.368 26.847 -47.879 1.00173.37 C
ATOM 3976 O GLY B 173 19.446 26.104 -48.213 1.00173.25 O
ATOM 3977 N LEU B 174 21.634 26.443 -47.818 1.00173.56 N
ATOM 3978 CA LEU B 174 22.020 25.081 -48.177 1.00173.43 C
ATOM 3979 C LEU B 174 22.976 24.470 -47.157 1.00173.21 C
ATOM 3980 O LEU B 174 23.047 23.250 -47.015 1.00173.47 O
ATOM 3981 CB LEU B 174 22.668 25.058 -49.564 1.00173.75 C
ATOM 3982 CG LEU B 174 21.859 25.631 -50.730 1.00173.83 C
ATOM 3983 CD1 LEU B 174 22.717 25.722 -51.984 1.00174.22 C
ATOM 3984 CD2 LEU B 174 20.614 24.799 -50.988 1.00173.70 C
ATOM 3985 N THR B 175 23.703 25.325 -46.446 1.00172.98 N
ATOM 3986 CA THR B 175 24.771 24.878 -45.557 1.00173.12 C
ATOM 3987 C THR B 175 24.426 25.152 -44.094 1.00173.24 C
ATOM 3988 O THR B 175 25.033 24.584 -43.185 1.00173.26 O
ATOM 3989 CB THR B 175 26.108 25.570 -45.905 1.00173.19 C
ATOM 3990 OG1 THR B 175 26.287 25.587 -47.326 1.00173.19 O
ATOM 3991 CG2 THR B 175 27.287 24.856 -45.250 1.00173.40 C
ATOM 3992 N GLY B 176 23.441 26.024 -43.892 1.00173.26 N
ATOM 3993 CA GLY B 176 23.027 26.505 -42.582 1.00173.52 C
ATOM 3994 C GLY B 176 23.156 25.600 -41.372 1.00173.89 C
ATOM 3995 O GLY B 176 22.846 24.410 -41.429 1.00173.72 O
ATOM 3996 N SER B 177 23.609 26.191 -40.270 1.00174.47 N
ATOM 3997 CA SER B 177 23.828 25.476 -39.019 1.00174.41 C
ATOM 3998 C SER B 177 24.098 26.468 -37.893 1.00173.84 C
ATOM 3999 O SER B 177 24.143 27.677 -38.119 1.00173.59 O
ATOM 4000 CB SER B 177 24.997 24.496 -39.150 1.00174.32 C
ATOM 4001 OG SER B 177 26.234 25.181 -39.241 1.00174.66 O
ATOM 4002 N VAL B 178 24.286 25.954 -36.683 1.00173.49 N
ATOM 4003 CA VAL B 178 24.613 26.805 -35.546 1.00173.59 C
ATOM 4004 C VAL B 178 26.119 27.019 -35.462 1.00174.07 C
ATOM 4005 O VAL B 178 26.887 26.064 -35.355 1.00174.04 O
ATOM 4006 CB VAL B 178 24.106 26.205 -34.222 1.00174.20 C
ATOM 4007 CG1 VAL B 178 24.606 27.025 -33.041 1.00174.18 C
ATOM 4008 CG2 VAL B 178 22.589 26.130 -34.223 1.00174.08 C
ATOM 4009 N GLN B 179 26.535 28.280 -35.512 1.00174.28 N
ATOM 4010 CA GLN B 179 27.953 28.621 -35.495 1.00174.91 C
ATOM 4011 C GLN B 179 28.218 29.866 -34.657 1.00175.01 C
ATOM 4012 O GLN B 179 27.394 30.779 -34.619 1.00174.64 O
ATOM 4013 CB GLN B 179 28.470 28.840 -36.918 1.00174.31 C
ATOM 4014 CG GLN B 179 28.590 27.573 -37.743 1.00174.19 C
ATOM 4015 CD GLN B 179 29.854 26.801 -37.429 1.00175.41 C
ATOM 4016 OE1 GLN B 179 30.957 27.342 -37.497 1.00176.04 O
ATOM 4017 NE2 GLN B 179 29.700 25.526 -37.088 1.00175.55 N
ATOM 4018 N PRO B 180 29.375 29.904 -33.978 1.00175.41 N
ATOM 4019 CA PRO B 180 29.794 31.085 -33.221 1.00174.53 C
ATOM 4020 C PRO B 180 30.043 32.276 -34.140 1.00173.75 C
ATOM 4021 O PRO B 180 30.799 32.159 -35.105 1.00173.41 O
ATOM 4022 CB PRO B 180 31.093 30.627 -32.554 1.00174.95 C
ATOM 4023 CG PRO B 180 30.965 29.138 -32.476 1.00175.25 C
ATOM 4024 CD PRO B 180 30.292 28.773 -33.764 1.00175.23 C
ATOM 4025 N VAL B 181 29.417 33.408 -33.842 1.00173.58 N
ATOM 4026 CA VAL B 181 29.553 34.589 -34.684 1.00173.50 C
ATOM 4027 C VAL B 181 30.347 35.693 -34.000 1.00173.23 C
ATOM 4028 O VAL B 181 30.036 36.099 -32.882 1.00173.52 O
ATOM 4029 CB VAL B 181 28.179 35.148 -35.088 1.00173.90 C
ATOM 4030 CG1 VAL B 181 28.346 36.326 -36.038 1.00173.80 C
ATOM 4031 CG2 VAL B 181 27.338 34.060 -35.729 1.00174.28 C
ATOM 4032 N ALA B 182 31.375 36.175 -34.688 1.00173.13 N
ATOM 4033 CA ALA B 182 32.181 37.274 -34.181 1.00173.30 C
ATOM 4034 C ALA B 182 31.451 38.592 -34.406 1.00173.06 C
ATOM 4035 O ALA B 182 30.753 38.754 -35.407 1.00172.71 O
ATOM 4036 CB ALA B 182 33.544 37.289 -34.855 1.00174.26 C
ATOM 4037 N PRO B 183 31.599 39.537 -33.465 1.00173.26 N
ATOM 4038 CA PRO B 183 30.953 40.850 -33.551 1.00173.39 C
ATOM 4039 C PRO B 183 31.349 41.636 -34.797 1.00173.01 C
ATOM 4040 O PRO B 183 32.211 41.204 -35.562 1.00172.90 O
ATOM 4041 CB PRO B 183 31.447 41.559 -32.288 1.00173.67 C
ATOM 4042 CG PRO B 183 31.724 40.454 -31.331 1.00174.26 C
ATOM 4043 CD PRO B 183 32.309 39.367 -32.185 1.00173.84 C
ATOM 4044 N GLU B 184 30.722 42.792 -34.982 1.00173.42 N
ATOM 4045 CA GLU B 184 30.959 43.620 -36.156 1.00173.84 C
ATOM 4046 C GLU B 184 30.535 45.056 -35.875 1.00174.22 C
ATOM 4047 O GLU B 184 29.354 45.396 -35.956 1.00174.69 O
ATOM 4048 CB GLU B 184 30.205 43.063 -37.367 1.00173.75 C
ATOM 4049 CG GLU B 184 30.281 43.919 -38.627 1.00173.83 C
ATOM 4050 CD GLU B 184 31.667 43.961 -39.241 1.00173.99 C
ATOM 4051 OE1 GLU B 184 32.552 44.641 -38.680 1.00174.23 O
ATOM 4052 OE2 GLU B 184 31.869 43.313 -40.288 1.00173.87 O
ATOM 4053 N TRP B 185 31.509 45.895 -35.539 1.00174.02 N
ATOM 4054 CA TRP B 185 31.231 47.274 -35.159 1.00173.92 C
ATOM 4055 C TRP B 185 31.381 48.213 -36.348 1.00173.43 C
ATOM 4056 O TRP B 185 31.099 49.405 -36.248 1.00173.91 O
ATOM 4057 CB TRP B 185 32.157 47.710 -34.022 1.00174.31 C
ATOM 4058 CG TRP B 185 32.056 46.842 -32.806 1.00174.48 C
ATOM 4059 CD1 TRP B 185 31.125 46.929 -31.812 1.00174.14 C
ATOM 4060 CD2 TRP B 185 32.916 45.752 -32.457 1.00174.66 C
ATOM 4061 NE1 TRP B 185 31.354 45.961 -30.864 1.00173.54 N
ATOM 4062 CE2 TRP B 185 32.448 45.225 -31.237 1.00174.58 C
ATOM 4063 CE3 TRP B 185 34.037 45.170 -33.058 1.00174.48 C
ATOM 4064 CZ2 TRP B 185 33.063 44.146 -30.605 1.00174.85 C
ATOM 4065 CZ3 TRP B 185 34.645 44.099 -32.430 1.00174.53 C
ATOM 4066 CH2 TRP B 185 34.157 43.598 -31.216 1.00175.16 C
ATOM 4067 N GLY B 186 31.828 47.668 -37.474 1.00172.48 N
ATOM 4068 CA GLY B 186 31.937 48.437 -38.700 1.00172.75 C
ATOM 4069 C GLY B 186 30.590 48.869 -39.251 1.00173.31 C
ATOM 4070 O GLY B 186 29.555 48.646 -38.625 1.00173.75 O
ATOM 4071 N PRO B 187 30.597 49.488 -40.440 1.00173.84 N
ATOM 4072 CA PRO B 187 29.373 49.963 -41.093 1.00173.83 C
ATOM 4073 C PRO B 187 28.463 48.818 -41.528 1.00173.65 C
ATOM 4074 O PRO B 187 27.242 48.931 -41.431 1.00173.85 O
ATOM 4075 CB PRO B 187 29.904 50.733 -42.304 1.00174.35 C
ATOM 4076 CG PRO B 187 31.230 50.115 -42.587 1.00175.04 C
ATOM 4077 CD PRO B 187 31.797 49.800 -41.234 1.00174.62 C
ATOM 4078 N ASP B 188 29.061 47.731 -42.005 1.00173.45 N
ATOM 4079 CA ASP B 188 28.313 46.562 -42.454 1.00173.99 C
ATOM 4080 C ASP B 188 27.611 45.847 -41.293 1.00174.64 C
ATOM 4081 O ASP B 188 26.859 44.898 -41.504 1.00175.20 O
ATOM 4082 CB ASP B 188 29.251 45.596 -43.191 1.00174.33 C
ATOM 4083 CG ASP B 188 28.513 44.442 -43.844 1.00174.44 C
ATOM 4084 OD1 ASP B 188 27.953 44.638 -44.942 1.00173.64 O
ATOM 4085 OD2 ASP B 188 28.499 43.337 -43.263 1.00174.99 O
ATOM 4086 N GLY B 189 27.846 46.308 -40.068 1.00174.88 N
ATOM 4087 CA GLY B 189 27.222 45.707 -38.903 1.00174.73 C
ATOM 4088 C GLY B 189 25.794 46.173 -38.688 1.00174.18 C
ATOM 4089 O GLY B 189 25.102 45.704 -37.787 1.00173.15 O
ATOM 4090 N PHE B 190 25.347 47.101 -39.525 1.00174.60 N
ATOM 4091 CA PHE B 190 23.972 47.576 -39.466 1.00174.39 C
ATOM 4092 C PHE B 190 23.188 46.974 -40.621 1.00174.66 C
ATOM 4093 O PHE B 190 22.082 47.410 -40.942 1.00174.38 O
ATOM 4094 CB PHE B 190 23.924 49.104 -39.491 1.00173.96 C
ATOM 4095 CG PHE B 190 24.373 49.735 -38.205 1.00173.66 C
ATOM 4096 CD1 PHE B 190 25.720 49.863 -37.916 1.00174.04 C
ATOM 4097 CD2 PHE B 190 23.447 50.176 -37.275 1.00173.93 C
ATOM 4098 CE1 PHE B 190 26.139 50.433 -36.730 1.00174.33 C
ATOM 4099 CE2 PHE B 190 23.859 50.748 -36.086 1.00174.99 C
ATOM 4100 CZ PHE B 190 25.208 50.876 -35.814 1.00175.19 C
ATOM 4101 N ASN B 191 23.791 45.968 -41.246 1.00175.09 N
ATOM 4102 CA ASN B 191 23.135 45.185 -42.284 1.00174.61 C
ATOM 4103 C ASN B 191 22.275 44.099 -41.649 1.00174.66 C
ATOM 4104 O ASN B 191 22.780 43.272 -40.889 1.00174.66 O
ATOM 4105 CB ASN B 191 24.171 44.564 -43.222 1.00174.56 C
ATOM 4106 CG ASN B 191 23.548 43.896 -44.435 1.00174.37 C
ATOM 4107 OD1 ASN B 191 22.626 43.087 -44.322 1.00173.76 O
ATOM 4108 ND2 ASN B 191 24.065 44.228 -45.608 1.00174.79 N
ATOM 4109 N PRO B 192 20.971 44.098 -41.956 1.00173.90 N
ATOM 4110 CA PRO B 192 20.025 43.108 -41.428 1.00173.78 C
ATOM 4111 C PRO B 192 20.424 41.667 -41.756 1.00173.06 C
ATOM 4112 O PRO B 192 20.088 40.751 -41.006 1.00172.74 O
ATOM 4113 CB PRO B 192 18.713 43.480 -42.124 1.00173.66 C
ATOM 4114 CG PRO B 192 19.141 44.199 -43.368 1.00173.38 C
ATOM 4115 CD PRO B 192 20.327 44.996 -42.928 1.00172.65 C
ATOM 4116 N TYR B 193 21.124 41.477 -42.870 1.00173.02 N
ATOM 4117 CA TYR B 193 21.509 40.144 -43.320 1.00173.45 C
ATOM 4118 C TYR B 193 22.904 39.742 -42.848 1.00173.53 C
ATOM 4119 O TYR B 193 23.449 38.736 -43.299 1.00173.88 O
ATOM 4120 CB TYR B 193 21.436 40.063 -44.845 1.00173.89 C
ATOM 4121 CG TYR B 193 20.049 40.301 -45.399 1.00174.29 C
ATOM 4122 CD1 TYR B 193 19.062 39.331 -45.293 1.00174.52 C
ATOM 4123 CD2 TYR B 193 19.726 41.499 -46.024 1.00174.26 C
ATOM 4124 CE1 TYR B 193 17.791 39.546 -45.794 1.00174.56 C
ATOM 4125 CE2 TYR B 193 18.459 41.723 -46.529 1.00174.16 C
ATOM 4126 CZ TYR B 193 17.496 40.743 -46.411 1.00174.00 C
ATOM 4127 OH TYR B 193 16.233 40.962 -46.911 1.00173.14 O
ATOM 4128 N ASN B 194 23.482 40.524 -41.942 1.00172.82 N
ATOM 4129 CA ASN B 194 24.799 40.207 -41.401 1.00172.15 C
ATOM 4130 C ASN B 194 24.734 39.836 -39.924 1.00172.57 C
ATOM 4131 O ASN B 194 24.422 40.676 -39.082 1.00173.32 O
ATOM 4132 CB ASN B 194 25.761 41.379 -41.604 1.00172.47 C
ATOM 4133 CG ASN B 194 27.167 41.066 -41.125 1.00172.93 C
ATOM 4134 OD1 ASN B 194 27.462 41.145 -39.933 1.00173.27 O
ATOM 4135 ND2 ASN B 194 28.041 40.705 -42.055 1.00173.77 N
ATOM 4136 N PRO B 195 25.028 38.565 -39.612 1.00172.49 N
ATOM 4137 CA PRO B 195 24.999 38.000 -38.259 1.00173.78 C
ATOM 4138 C PRO B 195 25.867 38.764 -37.264 1.00174.61 C
ATOM 4139 O PRO B 195 25.477 38.920 -36.106 1.00174.74 O
ATOM 4140 CB PRO B 195 25.540 36.584 -38.470 1.00173.87 C
ATOM 4141 CG PRO B 195 25.166 36.259 -39.872 1.00173.46 C
ATOM 4142 CD PRO B 195 25.385 37.545 -40.613 1.00172.69 C
ATOM 4143 N GLY B 196 27.032 39.220 -37.717 1.00174.54 N
ATOM 4144 CA GLY B 196 27.939 39.996 -36.890 1.00174.26 C
ATOM 4145 C GLY B 196 27.294 41.216 -36.260 1.00174.15 C
ATOM 4146 O GLY B 196 27.668 41.629 -35.162 1.00174.01 O
ATOM 4147 N GLY B 197 26.320 41.792 -36.958 1.00174.15 N
ATOM 4148 CA GLY B 197 25.610 42.955 -36.463 1.00173.41 C
ATOM 4149 C GLY B 197 24.676 42.638 -35.312 1.00174.04 C
ATOM 4150 O GLY B 197 24.444 43.477 -34.442 1.00174.43 O
ATOM 4151 N VAL B 198 24.140 41.422 -35.310 1.00174.02 N
ATOM 4152 CA VAL B 198 23.250 40.979 -34.244 1.00174.27 C
ATOM 4153 C VAL B 198 24.042 40.787 -32.952 1.00173.99 C
ATOM 4154 O VAL B 198 23.528 40.998 -31.852 1.00173.80 O
ATOM 4155 CB VAL B 198 22.533 39.667 -34.623 1.00173.79 C
ATOM 4156 CG1 VAL B 198 21.585 39.230 -33.517 1.00174.96 C
ATOM 4157 CG2 VAL B 198 21.779 39.839 -35.930 1.00172.92 C
ATOM 4158 N VAL B 199 25.306 40.407 -33.100 1.00173.66 N
ATOM 4159 CA VAL B 199 26.186 40.197 -31.959 1.00173.68 C
ATOM 4160 C VAL B 199 26.637 41.528 -31.364 1.00174.68 C
ATOM 4161 O VAL B 199 26.412 41.794 -30.181 1.00174.63 O
ATOM 4162 CB VAL B 199 27.423 39.369 -32.347 1.00173.44 C
ATOM 4163 CG1 VAL B 199 28.241 39.041 -31.113 1.00173.70 C
ATOM 4164 CG2 VAL B 199 27.005 38.097 -33.077 1.00172.95 C
ATOM 4165 N ALA B 200 27.287 42.345 -32.192 1.00175.26 N
ATOM 4166 CA ALA B 200 27.738 43.686 -31.811 1.00175.30 C
ATOM 4167 C ALA B 200 26.636 44.498 -31.136 1.00174.93 C
ATOM 4168 O ALA B 200 26.886 45.201 -30.158 1.00174.84 O
ATOM 4169 CB ALA B 200 28.263 44.432 -33.031 1.00175.12 C
ATOM 4170 N HIS B 201 25.424 44.410 -31.676 1.00174.35 N
ATOM 4171 CA HIS B 201 24.267 45.091 -31.102 1.00173.70 C
ATOM 4172 C HIS B 201 24.092 44.816 -29.613 1.00174.19 C
ATOM 4173 O HIS B 201 24.146 45.732 -28.795 1.00174.40 O
ATOM 4174 CB HIS B 201 22.991 44.692 -31.836 1.00172.78 C
ATOM 4175 CG HIS B 201 21.739 45.019 -31.083 1.00172.31 C
ATOM 4176 ND1 HIS B 201 21.047 44.077 -30.356 1.00173.46 N
ATOM 4177 CD2 HIS B 201 21.063 46.183 -30.934 1.00172.32 C
ATOM 4178 CE1 HIS B 201 19.993 44.645 -29.794 1.00173.75 C
ATOM 4179 NE2 HIS B 201 19.981 45.921 -30.129 1.00173.10 N
ATOM 4180 N HIS B 202 23.868 43.550 -29.276 1.00174.09 N
ATOM 4181 CA HIS B 202 23.562 43.150 -27.908 1.00174.01 C
ATOM 4182 C HIS B 202 24.694 43.471 -26.950 1.00173.77 C
ATOM 4183 O HIS B 202 24.484 43.633 -25.749 1.00173.50 O
ATOM 4184 CB HIS B 202 23.262 41.657 -27.854 1.00174.02 C
ATOM 4185 CG HIS B 202 21.981 41.278 -28.524 1.00174.19 C
ATOM 4186 ND1 HIS B 202 21.840 41.245 -29.894 1.00174.10 N
ATOM 4187 CD2 HIS B 202 20.782 40.915 -28.012 1.00173.74 C
ATOM 4188 CE1 HIS B 202 20.609 40.873 -30.198 1.00173.98 C
ATOM 4189 NE2 HIS B 202 19.947 40.668 -29.074 1.00173.28 N
ATOM 4190 N ILE B 203 25.898 43.568 -27.493 1.00174.02 N
ATOM 4191 CA ILE B 203 27.051 43.950 -26.702 1.00174.58 C
ATOM 4192 C ILE B 203 27.052 45.458 -26.482 1.00174.87 C
ATOM 4193 O ILE B 203 27.181 45.929 -25.354 1.00174.71 O
ATOM 4194 CB ILE B 203 28.359 43.521 -27.378 1.00175.20 C
ATOM 4195 CG1 ILE B 203 28.401 41.997 -27.529 1.00174.65 C
ATOM 4196 CG2 ILE B 203 29.555 44.027 -26.591 1.00176.08 C
ATOM 4197 CD1 ILE B 203 29.560 41.492 -28.358 1.00174.33 C
ATOM 4198 N ALA B 204 26.888 46.211 -27.567 1.00174.85 N
ATOM 4199 CA ALA B 204 26.859 47.669 -27.495 1.00174.77 C
ATOM 4200 C ALA B 204 25.620 48.176 -26.762 1.00174.97 C
ATOM 4201 O ALA B 204 25.730 48.919 -25.784 1.00174.93 O
ATOM 4202 CB ALA B 204 26.929 48.266 -28.894 1.00173.73 C
ATOM 4203 N ALA B 205 24.445 47.775 -27.241 1.00174.72 N
ATOM 4204 CA ALA B 205 23.181 48.152 -26.609 1.00174.64 C
ATOM 4205 C ALA B 205 23.119 47.669 -25.163 1.00174.67 C
ATOM 4206 O ALA B 205 22.530 48.327 -24.304 1.00174.18 O
ATOM 4207 CB ALA B 205 22.004 47.601 -27.401 1.00174.16 C
ATOM 4208 N GLY B 206 23.727 46.515 -24.905 1.00174.48 N
ATOM 4209 CA GLY B 206 23.801 45.974 -23.561 1.00173.92 C
ATOM 4210 C GLY B 206 24.546 46.907 -22.628 1.00174.04 C
ATOM 4211 O GLY B 206 24.049 47.249 -21.556 1.00174.12 O
ATOM 4212 N ILE B 207 25.738 47.324 -23.046 1.00174.24 N
ATOM 4213 CA ILE B 207 26.556 48.248 -22.266 1.00174.72 C
ATOM 4214 C ILE B 207 25.835 49.572 -22.047 1.00174.89 C
ATOM 4215 O ILE B 207 25.761 50.071 -20.922 1.00175.33 O
ATOM 4216 CB ILE B 207 27.909 48.518 -22.949 1.00174.18 C
ATOM 4217 CG1 ILE B 207 28.749 47.240 -22.982 1.00174.30 C
ATOM 4218 CG2 ILE B 207 28.663 49.619 -22.224 1.00174.52 C
ATOM 4219 CD1 ILE B 207 30.082 47.402 -23.670 1.00173.70 C
ATOM 4220 N VAL B 208 25.316 50.140 -23.131 1.00174.15 N
ATOM 4221 CA VAL B 208 24.515 51.355 -23.056 1.00173.93 C
ATOM 4222 C VAL B 208 23.334 51.160 -22.103 1.00174.39 C
ATOM 4223 O VAL B 208 22.988 52.059 -21.334 1.00174.89 O
ATOM 4224 CB VAL B 208 24.010 51.772 -24.452 1.00172.73 C
ATOM 4225 CG1 VAL B 208 22.958 52.861 -24.344 1.00173.12 C
ATOM 4226 CG2 VAL B 208 25.171 52.244 -25.306 1.00172.22 C
ATOM 4227 N GLY B 209 22.742 49.969 -22.137 1.00173.94 N
ATOM 4228 CA GLY B 209 21.639 49.636 -21.254 1.00173.75 C
ATOM 4229 C GLY B 209 22.070 49.574 -19.802 1.00173.67 C
ATOM 4230 O GLY B 209 21.315 49.946 -18.903 1.00173.49 O
ATOM 4231 N ILE B 210 23.292 49.102 -19.576 1.00173.88 N
ATOM 4232 CA ILE B 210 23.858 49.050 -18.234 1.00173.56 C
ATOM 4233 C ILE B 210 24.104 50.460 -17.709 1.00173.01 C
ATOM 4234 O ILE B 210 23.742 50.784 -16.578 1.00173.59 O
ATOM 4235 CB ILE B 210 25.178 48.252 -18.200 1.00173.55 C
ATOM 4236 CG1 ILE B 210 24.928 46.785 -18.554 1.00173.76 C
ATOM 4237 CG2 ILE B 210 25.827 48.349 -16.832 1.00174.25 C
ATOM 4238 CD1 ILE B 210 26.147 45.900 -18.396 1.00173.36 C
ATOM 4239 N ILE B 211 24.718 51.295 -18.542 1.00171.87 N
ATOM 4240 CA ILE B 211 24.972 52.690 -18.199 1.00172.14 C
ATOM 4241 C ILE B 211 23.671 53.442 -17.933 1.00172.54 C
ATOM 4242 O ILE B 211 23.501 54.038 -16.869 1.00173.25 O
ATOM 4243 CB ILE B 211 25.751 53.411 -19.312 1.00172.50 C
ATOM 4244 CG1 ILE B 211 27.163 52.834 -19.436 1.00173.11 C
ATOM 4245 CG2 ILE B 211 25.806 54.905 -19.042 1.00173.16 C
ATOM 4246 CD1 ILE B 211 27.928 53.344 -20.637 1.00173.39 C
ATOM 4247 N ALA B 212 22.771 53.425 -18.913 1.00172.56 N
ATOM 4248 CA ALA B 212 21.457 54.055 -18.788 1.00173.20 C
ATOM 4249 C ALA B 212 20.730 53.614 -17.521 1.00174.01 C
ATOM 4250 O ALA B 212 20.057 54.415 -16.872 1.00174.57 O
ATOM 4251 CB ALA B 212 20.607 53.747 -20.009 1.00173.84 C
ATOM 4252 N GLY B 213 20.863 52.334 -17.185 1.00174.10 N
ATOM 4253 CA GLY B 213 20.255 51.785 -15.987 1.00174.58 C
ATOM 4254 C GLY B 213 20.752 52.471 -14.731 1.00174.39 C
ATOM 4255 O GLY B 213 19.957 52.993 -13.948 1.00174.38 O
ATOM 4256 N LEU B 214 22.070 52.467 -14.546 1.00174.00 N
ATOM 4257 CA LEU B 214 22.710 53.130 -13.413 1.00173.68 C
ATOM 4258 C LEU B 214 22.262 54.580 -13.268 1.00174.22 C
ATOM 4259 O LEU B 214 22.004 55.045 -12.160 1.00174.91 O
ATOM 4260 CB LEU B 214 24.232 53.067 -13.547 1.00173.32 C
ATOM 4261 CG LEU B 214 24.855 51.677 -13.413 1.00173.12 C
ATOM 4262 CD1 LEU B 214 26.354 51.735 -13.666 1.00173.55 C
ATOM 4263 CD2 LEU B 214 24.554 51.084 -12.043 1.00173.24 C
ATOM 4264 N PHE B 215 22.179 55.286 -14.393 1.00173.79 N
ATOM 4265 CA PHE B 215 21.719 56.673 -14.416 1.00174.08 C
ATOM 4266 C PHE B 215 20.355 56.826 -13.741 1.00174.56 C
ATOM 4267 O PHE B 215 20.207 57.598 -12.794 1.00174.84 O
ATOM 4268 CB PHE B 215 21.662 57.193 -15.861 1.00173.63 C
ATOM 4269 CG PHE B 215 21.174 58.612 -15.980 1.00174.05 C
ATOM 4270 CD1 PHE B 215 22.066 59.671 -15.939 1.00174.94 C
ATOM 4271 CD2 PHE B 215 19.822 58.888 -16.125 1.00173.61 C
ATOM 4272 CE1 PHE B 215 21.620 60.976 -16.042 1.00175.30 C
ATOM 4273 CE2 PHE B 215 19.372 60.190 -16.228 1.00173.51 C
ATOM 4274 CZ PHE B 215 20.273 61.234 -16.183 1.00174.59 C
ATOM 4275 N HIS B 216 19.364 56.088 -14.235 1.00174.71 N
ATOM 4276 CA HIS B 216 17.993 56.171 -13.728 1.00174.32 C
ATOM 4277 C HIS B 216 17.835 55.662 -12.302 1.00173.94 C
ATOM 4278 O HIS B 216 16.800 55.876 -11.668 1.00173.69 O
ATOM 4279 CB HIS B 216 17.058 55.404 -14.654 1.00174.37 C
ATOM 4280 CG HIS B 216 17.021 55.960 -16.038 1.00174.21 C
ATOM 4281 ND1 HIS B 216 17.781 55.448 -17.067 1.00174.09 N
ATOM 4282 CD2 HIS B 216 16.348 57.014 -16.552 1.00173.04 C
ATOM 4283 CE1 HIS B 216 17.558 56.150 -18.163 1.00173.38 C
ATOM 4284 NE2 HIS B 216 16.694 57.106 -17.876 1.00172.78 N
ATOM 4285 N ILE B 217 18.861 54.987 -11.801 1.00174.29 N
ATOM 4286 CA ILE B 217 18.870 54.559 -10.414 1.00174.87 C
ATOM 4287 C ILE B 217 19.322 55.726 -9.545 1.00175.13 C
ATOM 4288 O ILE B 217 18.851 55.900 -8.420 1.00176.15 O
ATOM 4289 CB ILE B 217 19.790 53.339 -10.202 1.00174.42 C
ATOM 4290 CG1 ILE B 217 19.282 52.149 -11.019 1.00174.03 C
ATOM 4291 CG2 ILE B 217 19.869 52.962 -8.730 1.00174.62 C
ATOM 4292 CD1 ILE B 217 20.022 50.857 -10.757 1.00173.53 C
ATOM 4293 N LEU B 218 20.205 56.553 -10.096 1.00174.44 N
ATOM 4294 CA LEU B 218 20.786 57.657 -9.341 1.00174.27 C
ATOM 4295 C LEU B 218 20.035 58.966 -9.566 1.00174.40 C
ATOM 4296 O LEU B 218 19.395 59.487 -8.651 1.00175.34 O
ATOM 4297 CB LEU B 218 22.262 57.835 -9.708 1.00173.45 C
ATOM 4298 CG LEU B 218 23.158 56.598 -9.614 1.00173.46 C
ATOM 4299 CD1 LEU B 218 24.597 56.950 -9.958 1.00172.69 C
ATOM 4300 CD2 LEU B 218 23.066 55.970 -8.233 1.00173.68 C
ATOM 4301 N VAL B 219 20.117 59.496 -10.782 1.00174.08 N
ATOM 4302 CA VAL B 219 19.455 60.753 -11.118 1.00174.24 C
ATOM 4303 C VAL B 219 17.935 60.623 -11.060 1.00174.33 C
ATOM 4304 O VAL B 219 17.361 59.677 -11.597 1.00174.56 O
ATOM 4305 CB VAL B 219 19.875 61.244 -12.518 1.00173.91 C
ATOM 4306 CG1 VAL B 219 19.160 62.540 -12.873 1.00173.44 C
ATOM 4307 CG2 VAL B 219 21.385 61.433 -12.574 1.00173.82 C
ATOM 4308 N ARG B 220 17.291 61.586 -10.409 1.00174.09 N
ATOM 4309 CA ARG B 220 15.842 61.575 -10.259 1.00173.67 C
ATOM 4310 C ARG B 220 15.176 62.321 -11.412 1.00173.22 C
ATOM 4311 O ARG B 220 15.792 63.190 -12.028 1.00173.55 O
ATOM 4312 CB ARG B 220 15.447 62.196 -8.916 1.00174.50 C
ATOM 4313 CG ARG B 220 15.975 61.439 -7.706 1.00175.09 C
ATOM 4314 CD ARG B 220 15.412 60.030 -7.639 1.00174.73 C
ATOM 4315 NE ARG B 220 13.956 60.031 -7.542 1.00174.59 N
ATOM 4316 CZ ARG B 220 13.220 58.943 -7.342 1.00174.18 C
ATOM 4317 NH1 ARG B 220 11.900 59.040 -7.265 1.00174.75 N
ATOM 4318 NH2 ARG B 220 13.804 57.758 -7.218 1.00173.30 N
ATOM 4319 N PRO B 221 13.914 61.979 -11.716 1.00172.91 N
ATOM 4320 CA PRO B 221 13.197 62.632 -12.815 1.00173.85 C
ATOM 4321 C PRO B 221 12.858 64.093 -12.524 1.00174.20 C
ATOM 4322 O PRO B 221 12.318 64.393 -11.460 1.00174.15 O
ATOM 4323 CB PRO B 221 11.924 61.789 -12.943 1.00173.50 C
ATOM 4324 CG PRO B 221 11.720 61.222 -11.581 1.00173.19 C
ATOM 4325 CD PRO B 221 13.105 60.911 -11.103 1.00172.60 C
ATOM 4326 N PRO B 222 13.190 64.995 -13.463 1.00174.36 N
ATOM 4327 CA PRO B 222 12.876 66.426 -13.384 1.00174.38 C
ATOM 4328 C PRO B 222 11.400 66.683 -13.093 1.00174.59 C
ATOM 4329 O PRO B 222 10.547 66.084 -13.748 1.00174.04 O
ATOM 4330 CB PRO B 222 13.255 66.940 -14.776 1.00173.69 C
ATOM 4331 CG PRO B 222 14.334 66.017 -15.219 1.00173.64 C
ATOM 4332 CD PRO B 222 13.926 64.669 -14.698 1.00174.13 C
ATOM 4333 N GLN B 223 11.125 67.535 -12.105 1.00175.11 N
ATOM 4334 CA GLN B 223 9.765 67.924 -11.719 1.00175.01 C
ATOM 4335 C GLN B 223 8.826 68.128 -12.907 1.00175.56 C
ATOM 4336 O GLN B 223 7.710 67.609 -12.921 1.00176.05 O
ATOM 4337 CB GLN B 223 9.803 69.202 -10.876 1.00174.02 C
ATOM 4338 CG GLN B 223 8.444 69.645 -10.356 1.00173.23 C
ATOM 4339 CD GLN B 223 8.114 71.076 -10.733 1.00173.41 C
ATOM 4340 OE1 GLN B 223 7.833 71.378 -11.894 1.00172.58 O
ATOM 4341 NE2 GLN B 223 8.141 71.967 -9.749 1.00173.96 N
ATOM 4342 N ARG B 224 9.286 68.903 -13.886 1.00175.42 N
ATOM 4343 CA ARG B 224 8.540 69.150 -15.118 1.00174.76 C
ATOM 4344 C ARG B 224 8.042 67.856 -15.764 1.00174.34 C
ATOM 4345 O ARG B 224 6.874 67.749 -16.141 1.00173.91 O
ATOM 4346 CB ARG B 224 9.408 69.925 -16.112 1.00174.30 C
ATOM 4347 CG ARG B 224 10.010 71.204 -15.547 1.00174.14 C
ATOM 4348 CD ARG B 224 8.956 72.275 -15.300 1.00174.73 C
ATOM 4349 NE ARG B 224 8.510 72.896 -16.545 1.00175.24 N
ATOM 4350 CZ ARG B 224 7.706 73.953 -16.610 1.00175.27 C
ATOM 4351 NH1 ARG B 224 7.256 74.518 -15.498 1.00176.20 N
ATOM 4352 NH2 ARG B 224 7.354 74.449 -17.788 1.00173.63 N
ATOM 4353 N LEU B 225 8.933 66.875 -15.876 1.00174.33 N
ATOM 4354 CA LEU B 225 8.607 65.595 -16.503 1.00174.17 C
ATOM 4355 C LEU B 225 7.687 64.737 -15.636 1.00173.75 C
ATOM 4356 O LEU B 225 6.672 64.228 -16.115 1.00173.36 O
ATOM 4357 CB LEU B 225 9.888 64.822 -16.828 1.00174.21 C
ATOM 4358 CG LEU B 225 10.841 65.487 -17.823 1.00173.93 C
ATOM 4359 CD1 LEU B 225 12.055 64.608 -18.070 1.00173.71 C
ATOM 4360 CD2 LEU B 225 10.125 65.800 -19.130 1.00173.37 C
ATOM 4361 N TYR B 226 8.061 64.570 -14.368 1.00173.62 N
ATOM 4362 CA TYR B 226 7.262 63.824 -13.395 1.00173.74 C
ATOM 4363 C TYR B 226 5.804 64.286 -13.385 1.00173.85 C
ATOM 4364 O TYR B 226 4.890 63.481 -13.216 1.00174.02 O
ATOM 4365 CB TYR B 226 7.871 63.967 -11.996 1.00174.27 C
ATOM 4366 CG TYR B 226 7.331 62.997 -10.964 1.00174.95 C
ATOM 4367 CD1 TYR B 226 8.025 61.835 -10.650 1.00175.58 C
ATOM 4368 CD2 TYR B 226 6.138 63.248 -10.295 1.00174.62 C
ATOM 4369 CE1 TYR B 226 7.543 60.945 -9.705 1.00175.58 C
ATOM 4370 CE2 TYR B 226 5.648 62.362 -9.348 1.00174.96 C
ATOM 4371 CZ TYR B 226 6.356 61.213 -9.058 1.00175.04 C
ATOM 4372 OH TYR B 226 5.879 60.326 -8.120 1.00174.20 O
ATOM 4373 N LYS B 227 5.599 65.586 -13.574 1.00173.98 N
ATOM 4374 CA LYS B 227 4.259 66.158 -13.641 1.00173.52 C
ATOM 4375 C LYS B 227 3.628 65.899 -15.002 1.00173.75 C
ATOM 4376 O LYS B 227 2.481 65.462 -15.093 1.00174.10 O
ATOM 4377 CB LYS B 227 4.299 67.662 -13.361 1.00173.62 C
ATOM 4378 CG LYS B 227 4.682 68.028 -11.936 1.00174.37 C
ATOM 4379 CD LYS B 227 4.896 69.526 -11.802 1.00174.38 C
ATOM 4380 CE LYS B 227 3.637 70.299 -12.159 1.00173.41 C
ATOM 4381 NZ LYS B 227 3.866 71.769 -12.112 1.00172.56 N
ATOM 4382 N ALA B 228 4.391 66.177 -16.055 1.00173.49 N
ATOM 4383 CA ALA B 228 3.936 65.985 -17.428 1.00173.88 C
ATOM 4384 C ALA B 228 3.510 64.546 -17.702 1.00173.95 C
ATOM 4385 O ALA B 228 2.346 64.283 -18.003 1.00174.40 O
ATOM 4386 CB ALA B 228 5.026 66.402 -18.404 1.00173.69 C
ATOM 4387 N LEU B 229 4.453 63.615 -17.596 1.00173.58 N
ATOM 4388 CA LEU B 229 4.176 62.216 -17.910 1.00173.90 C
ATOM 4389 C LEU B 229 3.526 61.458 -16.758 1.00173.71 C
ATOM 4390 O LEU B 229 3.670 60.238 -16.666 1.00173.67 O
ATOM 4391 CB LEU B 229 5.465 61.502 -18.323 1.00174.44 C
ATOM 4392 CG LEU B 229 6.176 62.078 -19.549 1.00175.27 C
ATOM 4393 CD1 LEU B 229 7.464 61.316 -19.837 1.00174.74 C
ATOM 4394 CD2 LEU B 229 5.254 62.060 -20.756 1.00174.96 C
ATOM 4395 N ARG B 230 2.800 62.186 -15.909 1.00174.17 N
ATOM 4396 CA ARG B 230 2.119 61.643 -14.726 1.00175.15 C
ATOM 4397 C ARG B 230 2.822 60.452 -14.072 1.00175.16 C
ATOM 4398 O ARG B 230 2.217 59.400 -13.875 1.00174.75 O
ATOM 4399 CB ARG B 230 0.679 61.247 -15.084 1.00174.02 C
ATOM 4400 CG ARG B 230 -0.344 62.373 -14.964 1.00173.17 C
ATOM 4401 CD ARG B 230 -0.114 63.480 -15.980 1.00173.44 C
ATOM 4402 NE ARG B 230 -1.294 64.324 -16.146 1.00173.77 N
ATOM 4403 CZ ARG B 230 -1.369 65.347 -16.992 1.00174.52 C
ATOM 4404 NH1 ARG B 230 -0.329 65.656 -17.755 1.00174.63 N
ATOM 4405 NH2 ARG B 230 -2.483 66.060 -17.077 1.00174.50 N
ATOM 4406 N MET B 231 4.101 60.619 -13.750 1.00174.82 N
ATOM 4407 CA MET B 231 4.854 59.573 -13.068 1.00174.29 C
ATOM 4408 C MET B 231 4.287 59.316 -11.675 1.00174.23 C
ATOM 4409 O MET B 231 3.480 60.096 -11.169 1.00174.24 O
ATOM 4410 CB MET B 231 6.335 59.947 -12.979 1.00174.10 C
ATOM 4411 CG MET B 231 7.005 60.166 -14.327 1.00173.51 C
ATOM 4412 SD MET B 231 8.770 60.496 -14.169 1.00171.95 S
ATOM 4413 CE MET B 231 9.089 61.349 -15.709 1.00173.67 C
ATOM 4414 N GLY B 232 4.717 58.222 -11.054 1.00174.04 N
ATOM 4415 CA GLY B 232 4.124 57.782 -9.805 1.00174.93 C
ATOM 4416 C GLY B 232 2.686 57.341 -10.014 1.00175.92 C
ATOM 4417 O GLY B 232 1.897 57.271 -9.073 1.00176.85 O
ATOM 4418 N ASN B 233 2.352 57.043 -11.264 1.00175.19 N
ATOM 4419 CA ASN B 233 1.042 56.520 -11.625 1.00174.81 C
ATOM 4420 C ASN B 233 1.240 55.377 -12.611 1.00174.52 C
ATOM 4421 O ASN B 233 1.425 55.606 -13.803 1.00174.26 O
ATOM 4422 CB ASN B 233 0.159 57.622 -12.220 1.00173.76 C
ATOM 4423 CG ASN B 233 -1.164 57.098 -12.749 1.00173.58 C
ATOM 4424 OD1 ASN B 233 -1.638 56.038 -12.341 1.00173.72 O
ATOM 4425 ND2 ASN B 233 -1.767 57.844 -13.668 1.00173.50 N
ATOM 4426 N ILE B 234 1.203 54.150 -12.099 1.00174.62 N
ATOM 4427 CA ILE B 234 1.589 52.955 -12.851 1.00174.15 C
ATOM 4428 C ILE B 234 0.883 52.796 -14.203 1.00174.13 C
ATOM 4429 O ILE B 234 1.394 52.122 -15.100 1.00174.23 O
ATOM 4430 CB ILE B 234 1.348 51.681 -12.005 1.00174.26 C
ATOM 4431 CG1 ILE B 234 2.164 50.505 -12.548 1.00173.95 C
ATOM 4432 CG2 ILE B 234 -0.140 51.357 -11.911 1.00173.70 C
ATOM 4433 CD1 ILE B 234 2.107 49.277 -11.680 1.00174.06 C
ATOM 4434 N GLU B 235 -0.278 53.425 -14.360 1.00174.28 N
ATOM 4435 CA GLU B 235 -1.014 53.335 -15.617 1.00174.45 C
ATOM 4436 C GLU B 235 -0.417 54.246 -16.696 1.00173.45 C
ATOM 4437 O GLU B 235 -1.027 54.462 -17.743 1.00173.05 O
ATOM 4438 CB GLU B 235 -2.489 53.675 -15.394 1.00175.02 C
ATOM 4439 CG GLU B 235 -3.425 53.054 -16.420 1.00174.27 C
ATOM 4440 CD GLU B 235 -4.854 53.525 -16.267 1.00173.98 C
ATOM 4441 OE1 GLU B 235 -5.352 53.562 -15.121 1.00174.29 O
ATOM 4442 OE2 GLU B 235 -5.481 53.855 -17.295 1.00172.99 O
ATOM 4443 N THR B 236 0.777 54.774 -16.443 1.00173.31 N
ATOM 4444 CA THR B 236 1.490 55.555 -17.449 1.00173.23 C
ATOM 4445 C THR B 236 2.711 54.770 -17.901 1.00173.17 C
ATOM 4446 O THR B 236 3.251 55.002 -18.984 1.00173.13 O
ATOM 4447 CB THR B 236 1.918 56.944 -16.924 1.00173.79 C
ATOM 4448 OG1 THR B 236 2.141 57.827 -18.030 1.00173.72 O
ATOM 4449 CG2 THR B 236 3.191 56.857 -16.092 1.00174.23 C
ATOM 4450 N VAL B 237 3.140 53.834 -17.059 1.00172.98 N
ATOM 4451 CA VAL B 237 4.197 52.904 -17.420 1.00173.36 C
ATOM 4452 C VAL B 237 3.651 51.965 -18.484 1.00173.55 C
ATOM 4453 O VAL B 237 4.359 51.568 -19.409 1.00173.75 O
ATOM 4454 CB VAL B 237 4.692 52.099 -16.204 1.00173.29 C
ATOM 4455 CG1 VAL B 237 5.755 51.101 -16.623 1.00173.65 C
ATOM 4456 CG2 VAL B 237 5.228 53.029 -15.133 1.00173.37 C
ATOM 4457 N LEU B 238 2.373 51.627 -18.341 1.00173.13 N
ATOM 4458 CA LEU B 238 1.681 50.755 -19.279 1.00173.18 C
ATOM 4459 C LEU B 238 1.573 51.411 -20.649 1.00173.89 C
ATOM 4460 O LEU B 238 1.899 50.799 -21.666 1.00174.32 O
ATOM 4461 CB LEU B 238 0.291 50.400 -18.747 1.00172.41 C
ATOM 4462 CG LEU B 238 -0.511 49.379 -19.551 1.00172.93 C
ATOM 4463 CD1 LEU B 238 0.205 48.039 -19.581 1.00173.25 C
ATOM 4464 CD2 LEU B 238 -1.904 49.227 -18.966 1.00173.31 C
ATOM 4465 N SER B 239 1.117 52.660 -20.662 1.00173.99 N
ATOM 4466 CA SER B 239 0.961 53.430 -21.893 1.00173.35 C
ATOM 4467 C SER B 239 2.252 53.502 -22.701 1.00173.06 C
ATOM 4468 O SER B 239 2.231 53.414 -23.928 1.00173.38 O
ATOM 4469 CB SER B 239 0.478 54.844 -21.572 1.00173.89 C
ATOM 4470 OG SER B 239 -0.674 54.813 -20.751 1.00175.51 O
ATOM 4471 N SER B 240 3.373 53.666 -22.006 1.00173.54 N
ATOM 4472 CA SER B 240 4.676 53.761 -22.655 1.00174.08 C
ATOM 4473 C SER B 240 5.204 52.387 -23.058 1.00174.43 C
ATOM 4474 O SER B 240 5.766 52.224 -24.142 1.00174.81 O
ATOM 4475 CB SER B 240 5.679 54.461 -21.737 1.00174.08 C
ATOM 4476 OG SER B 240 5.847 53.746 -20.526 1.00174.31 O
ATOM 4477 N SER B 241 5.032 51.406 -22.176 1.00173.98 N
ATOM 4478 CA SER B 241 5.455 50.037 -22.455 1.00173.30 C
ATOM 4479 C SER B 241 4.744 49.473 -23.680 1.00173.52 C
ATOM 4480 O SER B 241 5.385 48.940 -24.584 1.00173.28 O
ATOM 4481 CB SER B 241 5.200 49.137 -21.245 1.00172.33 C
ATOM 4482 OG SER B 241 6.016 49.515 -20.152 1.00172.44 O
ATOM 4483 N ILE B 242 3.419 49.598 -23.699 1.00173.72 N
ATOM 4484 CA ILE B 242 2.610 49.184 -24.841 1.00173.40 C
ATOM 4485 C ILE B 242 3.093 49.855 -26.122 1.00173.37 C
ATOM 4486 O ILE B 242 3.188 49.218 -27.173 1.00173.24 O
ATOM 4487 CB ILE B 242 1.117 49.516 -24.621 1.00173.81 C
ATOM 4488 CG1 ILE B 242 0.522 48.610 -23.542 1.00174.64 C
ATOM 4489 CG2 ILE B 242 0.333 49.389 -25.919 1.00173.63 C
ATOM 4490 CD1 ILE B 242 -0.950 48.852 -23.281 1.00174.50 C
ATOM 4491 N ALA B 243 3.414 51.141 -26.017 1.00173.80 N
ATOM 4492 CA ALA B 243 3.918 51.906 -27.152 1.00173.99 C
ATOM 4493 C ALA B 243 5.208 51.299 -27.690 1.00173.69 C
ATOM 4494 O ALA B 243 5.406 51.206 -28.900 1.00173.74 O
ATOM 4495 CB ALA B 243 4.139 53.359 -26.759 1.00174.11 C
ATOM 4496 N ALA B 244 6.079 50.879 -26.780 1.00173.35 N
ATOM 4497 CA ALA B 244 7.332 50.245 -27.162 1.00173.12 C
ATOM 4498 C ALA B 244 7.077 48.830 -27.667 1.00173.21 C
ATOM 4499 O ALA B 244 7.725 48.369 -28.607 1.00173.98 O
ATOM 4500 CB ALA B 244 8.300 50.228 -25.989 1.00173.21 C
ATOM 4501 N VAL B 245 6.126 48.151 -27.034 1.00172.37 N
ATOM 4502 CA VAL B 245 5.786 46.778 -27.387 1.00172.41 C
ATOM 4503 C VAL B 245 5.297 46.639 -28.833 1.00173.39 C
ATOM 4504 O VAL B 245 5.763 45.761 -29.562 1.00173.91 O
ATOM 4505 CB VAL B 245 4.716 46.215 -26.425 1.00172.01 C
ATOM 4506 CG1 VAL B 245 4.003 45.032 -27.043 1.00172.08 C
ATOM 4507 CG2 VAL B 245 5.356 45.813 -25.109 1.00172.88 C
ATOM 4508 N PHE B 246 4.378 47.503 -29.257 1.00173.36 N
ATOM 4509 CA PHE B 246 3.841 47.399 -30.612 1.00173.34 C
ATOM 4510 C PHE B 246 4.844 47.955 -31.619 1.00172.81 C
ATOM 4511 O PHE B 246 4.791 47.628 -32.805 1.00172.60 O
ATOM 4512 CB PHE B 246 2.475 48.102 -30.724 1.00173.54 C
ATOM 4513 CG PHE B 246 2.548 49.574 -31.042 1.00173.08 C
ATOM 4514 CD1 PHE B 246 2.655 50.017 -32.353 1.00173.34 C
ATOM 4515 CD2 PHE B 246 2.477 50.516 -30.031 1.00173.60 C
ATOM 4516 CE1 PHE B 246 2.715 51.365 -32.643 1.00173.55 C
ATOM 4517 CE2 PHE B 246 2.533 51.867 -30.319 1.00173.91 C
ATOM 4518 CZ PHE B 246 2.653 52.290 -31.625 1.00173.68 C
ATOM 4519 N PHE B 247 5.758 48.793 -31.142 1.00172.53 N
ATOM 4520 CA PHE B 247 6.843 49.286 -31.982 1.00172.56 C
ATOM 4521 C PHE B 247 7.751 48.128 -32.362 1.00172.80 C
ATOM 4522 O PHE B 247 8.063 47.927 -33.534 1.00173.86 O
ATOM 4523 CB PHE B 247 7.646 50.375 -31.269 1.00172.90 C
ATOM 4524 CG PHE B 247 8.962 50.685 -31.928 1.00173.30 C
ATOM 4525 CD1 PHE B 247 9.009 51.135 -33.237 1.00173.58 C
ATOM 4526 CD2 PHE B 247 10.153 50.513 -31.241 1.00173.50 C
ATOM 4527 CE1 PHE B 247 10.220 51.416 -33.846 1.00173.57 C
ATOM 4528 CE2 PHE B 247 11.366 50.791 -31.845 1.00173.34 C
ATOM 4529 CZ PHE B 247 11.399 51.243 -33.149 1.00173.12 C
ATOM 4530 N ALA B 248 8.165 47.368 -31.355 1.00172.26 N
ATOM 4531 CA ALA B 248 8.969 46.170 -31.560 1.00172.80 C
ATOM 4532 C ALA B 248 8.228 45.155 -32.425 1.00173.42 C
ATOM 4533 O ALA B 248 8.828 44.481 -33.262 1.00174.19 O
ATOM 4534 CB ALA B 248 9.348 45.554 -30.223 1.00173.07 C
ATOM 4535 N ALA B 249 6.922 45.046 -32.206 1.00172.97 N
ATOM 4536 CA ALA B 249 6.081 44.121 -32.959 1.00173.11 C
ATOM 4537 C ALA B 249 6.066 44.433 -34.456 1.00173.40 C
ATOM 4538 O ALA B 249 6.191 43.531 -35.285 1.00173.69 O
ATOM 4539 CB ALA B 249 4.669 44.135 -32.408 1.00173.00 C
ATOM 4540 N PHE B 250 5.897 45.706 -34.800 1.00172.96 N
ATOM 4541 CA PHE B 250 5.915 46.128 -36.198 1.00173.09 C
ATOM 4542 C PHE B 250 7.261 45.842 -36.861 1.00172.73 C
ATOM 4543 O PHE B 250 7.332 45.640 -38.072 1.00173.06 O
ATOM 4544 CB PHE B 250 5.582 47.619 -36.317 1.00173.52 C
ATOM 4545 CG PHE B 250 4.127 47.898 -36.574 1.00173.92 C
ATOM 4546 CD1 PHE B 250 3.524 47.475 -37.747 1.00174.35 C
ATOM 4547 CD2 PHE B 250 3.364 48.589 -35.647 1.00174.45 C
ATOM 4548 CE1 PHE B 250 2.186 47.731 -37.989 1.00174.39 C
ATOM 4549 CE2 PHE B 250 2.025 48.848 -35.884 1.00174.39 C
ATOM 4550 CZ PHE B 250 1.436 48.418 -37.056 1.00173.38 C
ATOM 4551 N VAL B 251 8.324 45.820 -36.065 1.00172.63 N
ATOM 4552 CA VAL B 251 9.663 45.584 -36.595 1.00172.54 C
ATOM 4553 C VAL B 251 9.898 44.108 -36.900 1.00173.06 C
ATOM 4554 O VAL B 251 10.359 43.763 -37.987 1.00174.06 O
ATOM 4555 CB VAL B 251 10.750 46.078 -35.618 1.00173.59 C
ATOM 4556 CG1 VAL B 251 12.133 45.665 -36.102 1.00173.39 C
ATOM 4557 CG2 VAL B 251 10.667 47.587 -35.450 1.00174.37 C
ATOM 4558 N VAL B 252 9.571 43.240 -35.948 1.00173.11 N
ATOM 4559 CA VAL B 252 9.789 41.807 -36.124 1.00173.66 C
ATOM 4560 C VAL B 252 8.894 41.246 -37.224 1.00173.44 C
ATOM 4561 O VAL B 252 9.242 40.261 -37.876 1.00173.35 O
ATOM 4562 CB VAL B 252 9.549 41.020 -34.816 1.00174.17 C
ATOM 4563 CG1 VAL B 252 10.642 41.328 -33.810 1.00174.14 C
ATOM 4564 CG2 VAL B 252 8.187 41.342 -34.231 1.00174.39 C
ATOM 4565 N ALA B 253 7.740 41.873 -37.427 1.00173.19 N
ATOM 4566 CA ALA B 253 6.843 41.488 -38.508 1.00173.40 C
ATOM 4567 C ALA B 253 7.457 41.840 -39.858 1.00173.40 C
ATOM 4568 O ALA B 253 7.228 41.156 -40.856 1.00173.22 O
ATOM 4569 CB ALA B 253 5.491 42.163 -38.345 1.00173.85 C
ATOM 4570 N GLY B 254 8.234 42.919 -39.879 1.00173.60 N
ATOM 4571 CA GLY B 254 8.904 43.359 -41.089 1.00173.42 C
ATOM 4572 C GLY B 254 10.136 42.532 -41.405 1.00173.98 C
ATOM 4573 O GLY B 254 10.352 42.138 -42.550 1.00174.14 O
ATOM 4574 N THR B 255 10.944 42.260 -40.384 1.00174.62 N
ATOM 4575 CA THR B 255 12.167 41.482 -40.563 1.00174.65 C
ATOM 4576 C THR B 255 11.849 40.028 -40.894 1.00174.43 C
ATOM 4577 O THR B 255 12.690 39.307 -41.430 1.00174.45 O
ATOM 4578 CB THR B 255 13.062 41.526 -39.309 1.00174.70 C
ATOM 4579 OG1 THR B 255 12.368 40.942 -38.200 1.00174.30 O
ATOM 4580 CG2 THR B 255 13.441 42.961 -38.970 1.00175.14 C
ATOM 4581 N MET B 256 10.632 39.603 -40.569 1.00174.13 N
ATOM 4582 CA MET B 256 10.179 38.256 -40.885 1.00173.83 C
ATOM 4583 C MET B 256 9.744 38.170 -42.344 1.00174.46 C
ATOM 4584 O MET B 256 10.030 37.190 -43.031 1.00174.40 O
ATOM 4585 CB MET B 256 9.031 37.843 -39.961 1.00172.64 C
ATOM 4586 CG MET B 256 8.509 36.435 -40.202 1.00172.54 C
ATOM 4587 SD MET B 256 9.770 35.165 -39.987 1.00170.43 S
ATOM 4588 CE MET B 256 9.736 34.952 -38.212 1.00173.18 C
ATOM 4589 N TRP B 257 9.063 39.209 -42.816 1.00174.79 N
ATOM 4590 CA TRP B 257 8.530 39.214 -44.174 1.00174.10 C
ATOM 4591 C TRP B 257 9.603 39.511 -45.220 1.00173.95 C
ATOM 4592 O TRP B 257 9.653 38.860 -46.263 1.00174.13 O
ATOM 4593 CB TRP B 257 7.391 40.227 -44.295 1.00173.66 C
ATOM 4594 CG TRP B 257 6.575 40.045 -45.533 1.00172.70 C
ATOM 4595 CD1 TRP B 257 6.476 40.907 -46.585 1.00173.28 C
ATOM 4596 CD2 TRP B 257 5.751 38.920 -45.857 1.00171.87 C
ATOM 4597 NE1 TRP B 257 5.634 40.393 -47.540 1.00172.98 N
ATOM 4598 CE2 TRP B 257 5.176 39.173 -47.117 1.00172.63 C
ATOM 4599 CE3 TRP B 257 5.439 37.725 -45.200 1.00171.96 C
ATOM 4600 CZ2 TRP B 257 4.308 38.275 -47.735 1.00173.24 C
ATOM 4601 CZ3 TRP B 257 4.578 36.836 -45.815 1.00172.15 C
ATOM 4602 CH2 TRP B 257 4.022 37.115 -47.069 1.00173.10 C
ATOM 4603 N TYR B 258 10.457 40.492 -44.943 1.00174.01 N
ATOM 4604 CA TYR B 258 11.515 40.855 -45.881 1.00173.92 C
ATOM 4605 C TYR B 258 12.736 39.964 -45.699 1.00174.69 C
ATOM 4606 O TYR B 258 13.576 39.854 -46.592 1.00175.06 O
ATOM 4607 CB TYR B 258 11.913 42.323 -45.719 1.00173.32 C
ATOM 4608 CG TYR B 258 10.773 43.295 -45.912 1.00173.15 C
ATOM 4609 CD1 TYR B 258 10.154 43.429 -47.147 1.00172.95 C
ATOM 4610 CD2 TYR B 258 10.324 44.088 -44.866 1.00174.04 C
ATOM 4611 CE1 TYR B 258 9.114 44.316 -47.332 1.00173.27 C
ATOM 4612 CE2 TYR B 258 9.283 44.979 -45.041 1.00174.12 C
ATOM 4613 CZ TYR B 258 8.683 45.090 -46.277 1.00173.36 C
ATOM 4614 OH TYR B 258 7.646 45.975 -46.462 1.00173.03 O
ATOM 4615 N GLY B 259 12.832 39.331 -44.536 1.00174.20 N
ATOM 4616 CA GLY B 259 13.937 38.435 -44.255 1.00174.23 C
ATOM 4617 C GLY B 259 15.127 39.141 -43.637 1.00173.84 C
ATOM 4618 O GLY B 259 15.330 40.338 -43.844 1.00174.32 O
ATOM 4619 N SER B 260 15.917 38.385 -42.881 1.00172.91 N
ATOM 4620 CA SER B 260 17.115 38.908 -42.236 1.00172.46 C
ATOM 4621 C SER B 260 17.944 37.762 -41.676 1.00172.38 C
ATOM 4622 O SER B 260 17.542 36.601 -41.757 1.00172.51 O
ATOM 4623 CB SER B 260 16.752 39.890 -41.120 1.00173.01 C
ATOM 4624 OG SER B 260 16.396 39.209 -39.929 1.00174.09 O
ATOM 4625 N ALA B 261 19.099 38.089 -41.105 1.00172.29 N
ATOM 4626 CA ALA B 261 19.939 37.090 -40.452 1.00173.40 C
ATOM 4627 C ALA B 261 19.243 36.503 -39.226 1.00173.35 C
ATOM 4628 O ALA B 261 19.676 35.490 -38.677 1.00172.73 O
ATOM 4629 CB ALA B 261 21.279 37.694 -40.062 1.00173.94 C
ATOM 4630 N THR B 262 18.159 37.149 -38.807 1.00173.46 N
ATOM 4631 CA THR B 262 17.393 36.718 -37.645 1.00173.30 C
ATOM 4632 C THR B 262 16.283 35.765 -38.086 1.00173.48 C
ATOM 4633 O THR B 262 15.799 34.947 -37.303 1.00173.61 O
ATOM 4634 CB THR B 262 16.813 37.941 -36.878 1.00172.89 C
ATOM 4635 OG1 THR B 262 17.365 37.988 -35.558 1.00173.96 O
ATOM 4636 CG2 THR B 262 15.291 37.895 -36.788 1.00172.49 C
ATOM 4637 N THR B 263 15.907 35.851 -39.358 1.00173.61 N
ATOM 4638 CA THR B 263 14.894 34.962 -39.921 1.00173.49 C
ATOM 4639 C THR B 263 15.430 34.170 -41.112 1.00173.74 C
ATOM 4640 O THR B 263 15.102 34.472 -42.259 1.00173.85 O
ATOM 4641 CB THR B 263 13.645 35.745 -40.367 1.00173.65 C
ATOM 4642 OG1 THR B 263 14.015 36.731 -41.339 1.00173.61 O
ATOM 4643 CG2 THR B 263 12.995 36.429 -39.178 1.00174.29 C
ATOM 4644 N PRO B 264 16.263 33.153 -40.844 1.00173.98 N
ATOM 4645 CA PRO B 264 16.862 32.343 -41.910 1.00174.26 C
ATOM 4646 C PRO B 264 15.835 31.484 -42.649 1.00173.77 C
ATOM 4647 O PRO B 264 14.922 30.943 -42.026 1.00174.03 O
ATOM 4648 CB PRO B 264 17.864 31.467 -41.154 1.00174.31 C
ATOM 4649 CG PRO B 264 17.272 31.335 -39.796 1.00173.60 C
ATOM 4650 CD PRO B 264 16.666 32.676 -39.509 1.00173.62 C
ATOM 4651 N ILE B 265 15.991 31.370 -43.964 1.00172.71 N
ATOM 4652 CA ILE B 265 15.046 30.636 -44.800 1.00172.52 C
ATOM 4653 C ILE B 265 14.987 29.139 -44.489 1.00172.88 C
ATOM 4654 O ILE B 265 13.968 28.495 -44.732 1.00173.02 O
ATOM 4655 CB ILE B 265 15.369 30.822 -46.300 1.00173.15 C
ATOM 4656 CG1 ILE B 265 16.682 30.129 -46.664 1.00174.16 C
ATOM 4657 CG2 ILE B 265 15.446 32.302 -46.645 1.00173.31 C
ATOM 4658 CD1 ILE B 265 16.987 30.142 -48.146 1.00174.16 C
ATOM 4659 N GLU B 266 16.070 28.582 -43.957 1.00172.94 N
ATOM 4660 CA GLU B 266 16.099 27.157 -43.631 1.00173.79 C
ATOM 4661 C GLU B 266 15.268 26.810 -42.394 1.00174.42 C
ATOM 4662 O GLU B 266 15.093 25.636 -42.073 1.00174.57 O
ATOM 4663 CB GLU B 266 17.539 26.681 -43.423 1.00173.69 C
ATOM 4664 CG GLU B 266 18.399 26.680 -44.674 1.00173.28 C
ATOM 4665 CD GLU B 266 19.582 25.742 -44.545 1.00173.79 C
ATOM 4666 OE1 GLU B 266 20.161 25.668 -43.443 1.00173.91 O
ATOM 4667 OE2 GLU B 266 19.928 25.070 -45.539 1.00174.15 O
ATOM 4668 N LEU B 267 14.753 27.824 -41.706 1.00174.26 N
ATOM 4669 CA LEU B 267 13.994 27.593 -40.481 1.00173.63 C
ATOM 4670 C LEU B 267 12.586 28.162 -40.570 1.00173.55 C
ATOM 4671 O LEU B 267 11.674 27.692 -39.890 1.00173.60 O
ATOM 4672 CB LEU B 267 14.718 28.197 -39.276 1.00173.12 C
ATOM 4673 CG LEU B 267 16.123 27.664 -38.989 1.00173.73 C
ATOM 4674 CD1 LEU B 267 16.744 28.382 -37.799 1.00174.19 C
ATOM 4675 CD2 LEU B 267 16.089 26.164 -38.752 1.00173.52 C
ATOM 4676 N PHE B 268 12.410 29.173 -41.413 1.00173.97 N
ATOM 4677 CA PHE B 268 11.120 29.837 -41.530 1.00174.56 C
ATOM 4678 C PHE B 268 10.541 29.739 -42.940 1.00174.82 C
ATOM 4679 O PHE B 268 9.357 30.002 -43.148 1.00174.60 O
ATOM 4680 CB PHE B 268 11.244 31.303 -41.114 1.00174.30 C
ATOM 4681 CG PHE B 268 11.560 31.493 -39.659 1.00172.94 C
ATOM 4682 CD1 PHE B 268 10.585 31.304 -38.694 1.00173.33 C
ATOM 4683 CD2 PHE B 268 12.834 31.855 -39.255 1.00172.53 C
ATOM 4684 CE1 PHE B 268 10.873 31.475 -37.355 1.00173.35 C
ATOM 4685 CE2 PHE B 268 13.128 32.028 -37.918 1.00173.23 C
ATOM 4686 CZ PHE B 268 12.146 31.838 -36.966 1.00173.87 C
ATOM 4687 N GLY B 269 11.370 29.355 -43.905 1.00174.38 N
ATOM 4688 CA GLY B 269 10.918 29.230 -45.280 1.00173.67 C
ATOM 4689 C GLY B 269 11.375 30.380 -46.156 1.00173.39 C
ATOM 4690 O GLY B 269 11.905 31.370 -45.656 1.00173.80 O
ATOM 4691 N PRO B 270 11.176 30.251 -47.477 1.00173.03 N
ATOM 4692 CA PRO B 270 11.557 31.267 -48.462 1.00172.97 C
ATOM 4693 C PRO B 270 10.832 32.595 -48.271 1.00172.34 C
ATOM 4694 O PRO B 270 9.932 32.701 -47.443 1.00172.38 O
ATOM 4695 CB PRO B 270 11.153 30.624 -49.794 1.00173.71 C
ATOM 4696 CG PRO B 270 11.190 29.161 -49.524 1.00174.36 C
ATOM 4697 CD PRO B 270 10.659 29.037 -48.129 1.00173.55 C
ATOM 4698 N THR B 271 11.232 33.597 -49.044 1.00172.45 N
ATOM 4699 CA THR B 271 10.627 34.919 -48.972 1.00171.99 C
ATOM 4700 C THR B 271 9.905 35.197 -50.286 1.00172.59 C
ATOM 4701 O THR B 271 10.386 34.806 -51.348 1.00173.97 O
ATOM 4702 CB THR B 271 11.692 36.000 -48.691 1.00172.52 C
ATOM 4703 OG1 THR B 271 12.090 35.932 -47.317 1.00173.73 O
ATOM 4704 CG2 THR B 271 11.169 37.393 -48.992 1.00172.92 C
ATOM 4705 N ARG B 272 8.757 35.867 -50.220 1.00172.17 N
ATOM 4706 CA ARG B 272 7.956 36.132 -51.413 1.00173.30 C
ATOM 4707 C ARG B 272 8.711 36.973 -52.437 1.00172.95 C
ATOM 4708 O ARG B 272 8.447 36.890 -53.637 1.00172.63 O
ATOM 4709 CB ARG B 272 6.645 36.828 -51.038 1.00173.33 C
ATOM 4710 CG ARG B 272 6.798 38.272 -50.594 1.00173.81 C
ATOM 4711 CD ARG B 272 5.631 39.112 -51.084 1.00173.78 C
ATOM 4712 NE ARG B 272 5.627 39.223 -52.539 1.00173.41 N
ATOM 4713 CZ ARG B 272 4.643 39.767 -53.246 1.00173.62 C
ATOM 4714 NH1 ARG B 272 3.571 40.252 -52.633 1.00173.00 N
ATOM 4715 NH2 ARG B 272 4.727 39.824 -54.568 1.00174.52 N
ATOM 4716 N TYR B 273 9.656 37.774 -51.959 1.00172.65 N
ATOM 4717 CA TYR B 273 10.426 38.650 -52.829 1.00173.08 C
ATOM 4718 C TYR B 273 11.515 37.875 -53.556 1.00173.95 C
ATOM 4719 O TYR B 273 12.020 38.318 -54.586 1.00174.93 O
ATOM 4720 CB TYR B 273 11.027 39.801 -52.025 1.00173.61 C
ATOM 4721 CG TYR B 273 9.979 40.625 -51.318 1.00174.12 C
ATOM 4722 CD1 TYR B 273 9.244 41.583 -52.003 1.00174.12 C
ATOM 4723 CD2 TYR B 273 9.708 40.432 -49.970 1.00174.57 C
ATOM 4724 CE1 TYR B 273 8.278 42.333 -51.363 1.00174.48 C
ATOM 4725 CE2 TYR B 273 8.744 41.176 -49.321 1.00174.63 C
ATOM 4726 CZ TYR B 273 8.032 42.125 -50.021 1.00174.84 C
ATOM 4727 OH TYR B 273 7.071 42.867 -49.374 1.00174.76 O
ATOM 4728 N GLN B 274 11.871 36.714 -53.018 1.00173.55 N
ATOM 4729 CA GLN B 274 12.829 35.837 -53.680 1.00174.12 C
ATOM 4730 C GLN B 274 12.201 35.228 -54.929 1.00174.03 C
ATOM 4731 O GLN B 274 12.866 35.037 -55.947 1.00174.12 O
ATOM 4732 CB GLN B 274 13.307 34.740 -52.729 1.00173.13 C
ATOM 4733 CG GLN B 274 13.978 35.265 -51.473 1.00172.73 C
ATOM 4734 CD GLN B 274 14.471 34.153 -50.574 1.00173.37 C
ATOM 4735 OE1 GLN B 274 13.679 33.408 -49.997 1.00173.99 O
ATOM 4736 NE2 GLN B 274 15.788 34.032 -50.450 1.00173.62 N
ATOM 4737 N TRP B 275 10.911 34.926 -54.840 1.00173.04 N
ATOM 4738 CA TRP B 275 10.160 34.428 -55.983 1.00172.65 C
ATOM 4739 C TRP B 275 9.910 35.546 -56.991 1.00173.14 C
ATOM 4740 O TRP B 275 9.962 35.325 -58.201 1.00173.39 O
ATOM 4741 CB TRP B 275 8.836 33.813 -55.528 1.00171.89 C
ATOM 4742 CG TRP B 275 7.914 33.467 -56.654 1.00172.48 C
ATOM 4743 CD1 TRP B 275 6.867 34.210 -57.112 1.00173.03 C
ATOM 4744 CD2 TRP B 275 7.960 32.291 -57.471 1.00172.89 C
ATOM 4745 NE1 TRP B 275 6.254 33.568 -58.161 1.00173.10 N
ATOM 4746 CE2 TRP B 275 6.907 32.389 -58.401 1.00172.96 C
ATOM 4747 CE3 TRP B 275 8.789 31.165 -57.505 1.00173.36 C
ATOM 4748 CZ2 TRP B 275 6.661 31.404 -59.356 1.00173.34 C
ATOM 4749 CZ3 TRP B 275 8.542 30.189 -58.453 1.00173.29 C
ATOM 4750 CH2 TRP B 275 7.487 30.315 -59.365 1.00173.51 C
ATOM 4751 N ASP B 276 9.636 36.744 -56.481 1.00173.36 N
ATOM 4752 CA ASP B 276 9.394 37.913 -57.323 1.00173.66 C
ATOM 4753 C ASP B 276 10.574 38.217 -58.243 1.00173.45 C
ATOM 4754 O ASP B 276 10.400 38.414 -59.445 1.00173.15 O
ATOM 4755 CB ASP B 276 9.088 39.140 -56.460 1.00173.38 C
ATOM 4756 CG ASP B 276 7.801 38.995 -55.675 1.00172.85 C
ATOM 4757 OD1 ASP B 276 6.864 38.343 -56.180 1.00172.93 O
ATOM 4758 OD2 ASP B 276 7.726 39.535 -54.551 1.00172.75 O
ATOM 4759 N SER B 277 11.774 38.249 -57.672 1.00173.39 N
ATOM 4760 CA SER B 277 12.969 38.594 -58.432 1.00173.27 C
ATOM 4761 C SER B 277 13.629 37.364 -59.039 1.00173.41 C
ATOM 4762 O SER B 277 14.743 37.448 -59.558 1.00174.63 O
ATOM 4763 CB SER B 277 13.971 39.334 -57.545 1.00174.00 C
ATOM 4764 OG SER B 277 14.346 38.540 -56.433 1.00174.63 O
ATOM 4765 N SER B 278 12.932 36.231 -58.977 1.00173.08 N
ATOM 4766 CA SER B 278 13.451 34.960 -59.478 1.00173.87 C
ATOM 4767 C SER B 278 14.831 34.652 -58.901 1.00173.11 C
ATOM 4768 O SER B 278 15.704 34.138 -59.600 1.00173.61 O
ATOM 4769 CB SER B 278 13.508 34.972 -61.008 1.00175.38 C
ATOM 4770 OG SER B 278 12.214 35.125 -61.567 1.00175.28 O
ATOM 4771 N TYR B 279 15.006 34.983 -57.624 1.00172.53 N
ATOM 4772 CA TYR B 279 16.271 34.820 -56.909 1.00172.97 C
ATOM 4773 C TYR B 279 16.945 33.473 -57.145 1.00172.84 C
ATOM 4774 O TYR B 279 18.048 33.409 -57.684 1.00173.26 O
ATOM 4775 CB TYR B 279 16.047 35.021 -55.410 1.00174.26 C
ATOM 4776 CG TYR B 279 17.313 35.008 -54.587 1.00174.09 C
ATOM 4777 CD1 TYR B 279 18.371 35.853 -54.892 1.00173.30 C
ATOM 4778 CD2 TYR B 279 17.442 34.163 -53.492 1.00174.55 C
ATOM 4779 CE1 TYR B 279 19.530 35.845 -54.138 1.00174.08 C
ATOM 4780 CE2 TYR B 279 18.593 34.151 -52.731 1.00174.98 C
ATOM 4781 CZ TYR B 279 19.634 34.994 -53.057 1.00175.22 C
ATOM 4782 OH TYR B 279 20.784 34.980 -52.300 1.00175.35 O
ATOM 4783 N PHE B 280 16.277 32.401 -56.738 1.00172.51 N
ATOM 4784 CA PHE B 280 16.856 31.069 -56.846 1.00172.72 C
ATOM 4785 C PHE B 280 16.969 30.604 -58.294 1.00173.06 C
ATOM 4786 O PHE B 280 17.844 29.808 -58.623 1.00173.52 O
ATOM 4787 CB PHE B 280 16.038 30.068 -56.031 1.00172.80 C
ATOM 4788 CG PHE B 280 16.074 30.324 -54.553 1.00173.33 C
ATOM 4789 CD1 PHE B 280 17.121 29.848 -53.781 1.00174.05 C
ATOM 4790 CD2 PHE B 280 15.063 31.039 -53.934 1.00173.09 C
ATOM 4791 CE1 PHE B 280 17.160 30.081 -52.418 1.00173.95 C
ATOM 4792 CE2 PHE B 280 15.095 31.275 -52.571 1.00173.12 C
ATOM 4793 CZ PHE B 280 16.145 30.795 -51.813 1.00173.37 C
ATOM 4794 N GLN B 281 16.091 31.106 -59.156 1.00172.63 N
ATOM 4795 CA GLN B 281 16.122 30.735 -60.567 1.00173.02 C
ATOM 4796 C GLN B 281 17.427 31.174 -61.226 1.00173.05 C
ATOM 4797 O GLN B 281 18.007 30.439 -62.028 1.00173.21 O
ATOM 4798 CB GLN B 281 14.931 31.343 -61.312 1.00173.18 C
ATOM 4799 CG GLN B 281 15.123 31.424 -62.819 1.00173.54 C
ATOM 4800 CD GLN B 281 13.861 31.827 -63.554 1.00173.31 C
ATOM 4801 OE1 GLN B 281 12.956 31.017 -63.745 1.00172.99 O
ATOM 4802 NE2 GLN B 281 13.796 33.085 -63.973 1.00173.29 N
ATOM 4803 N GLN B 282 17.892 32.366 -60.870 1.00173.11 N
ATOM 4804 CA GLN B 282 19.121 32.909 -61.437 1.00173.07 C
ATOM 4805 C GLN B 282 20.343 32.121 -60.979 1.00173.13 C
ATOM 4806 O GLN B 282 21.263 31.884 -61.761 1.00173.43 O
ATOM 4807 CB GLN B 282 19.279 34.385 -61.067 1.00173.43 C
ATOM 4808 CG GLN B 282 18.184 35.284 -61.620 1.00174.04 C
ATOM 4809 CD GLN B 282 18.331 36.723 -61.168 1.00174.92 C
ATOM 4810 OE1 GLN B 282 19.357 37.360 -61.406 1.00174.39 O
ATOM 4811 NE2 GLN B 282 17.302 37.245 -60.511 1.00175.87 N
ATOM 4812 N GLU B 283 20.345 31.718 -59.713 1.00173.65 N
ATOM 4813 CA GLU B 283 21.437 30.922 -59.163 1.00174.07 C
ATOM 4814 C GLU B 283 21.525 29.560 -59.843 1.00174.38 C
ATOM 4815 O GLU B 283 22.617 29.034 -60.054 1.00174.82 O
ATOM 4816 CB GLU B 283 21.270 30.744 -57.652 1.00174.20 C
ATOM 4817 CG GLU B 283 22.398 29.964 -56.979 1.00173.39 C
ATOM 4818 CD GLU B 283 23.768 30.576 -57.218 1.00172.85 C
ATOM 4819 OE1 GLU B 283 23.858 31.813 -57.371 1.00172.75 O
ATOM 4820 OE2 GLU B 283 24.758 29.814 -57.260 1.00172.37 O
ATOM 4821 N ILE B 284 20.370 28.994 -60.181 1.00173.98 N
ATOM 4822 CA ILE B 284 20.323 27.706 -60.864 1.00173.34 C
ATOM 4823 C ILE B 284 20.962 27.800 -62.245 1.00173.30 C
ATOM 4824 O ILE B 284 21.908 27.073 -62.553 1.00173.21 O
ATOM 4825 CB ILE B 284 18.884 27.189 -61.014 1.00172.60 C
ATOM 4826 CG1 ILE B 284 18.261 26.925 -59.644 1.00172.30 C
ATOM 4827 CG2 ILE B 284 18.874 25.912 -61.815 1.00173.32 C
ATOM 4828 CD1 ILE B 284 16.821 26.464 -59.704 1.00172.48 C
ATOM 4829 N ASN B 285 20.423 28.691 -63.073 1.00172.93 N
ATOM 4830 CA ASN B 285 20.961 28.948 -64.404 1.00172.98 C
ATOM 4831 C ASN B 285 22.457 29.238 -64.380 1.00173.16 C
ATOM 4832 O ASN B 285 23.214 28.688 -65.179 1.00172.79 O
ATOM 4833 CB ASN B 285 20.215 30.111 -65.058 1.00172.72 C
ATOM 4834 CG ASN B 285 18.915 29.676 -65.704 1.00172.94 C
ATOM 4835 OD1 ASN B 285 18.919 28.968 -66.710 1.00172.38 O
ATOM 4836 ND2 ASN B 285 17.794 30.100 -65.130 1.00173.71 N
ATOM 4837 N ARG B 286 22.868 30.110 -63.462 1.00173.96 N
ATOM 4838 CA ARG B 286 24.281 30.420 -63.256 1.00174.49 C
ATOM 4839 C ARG B 286 25.121 29.160 -63.071 1.00174.30 C
ATOM 4840 O ARG B 286 26.190 29.023 -63.664 1.00174.68 O
ATOM 4841 CB ARG B 286 24.453 31.338 -62.043 1.00174.73 C
ATOM 4842 CG ARG B 286 25.778 32.083 -62.011 1.00174.12 C
ATOM 4843 CD ARG B 286 26.070 32.602 -60.612 1.00173.73 C
ATOM 4844 NE ARG B 286 26.199 31.519 -59.636 1.00173.73 N
ATOM 4845 CZ ARG B 286 27.179 30.619 -59.625 1.00174.01 C
ATOM 4846 NH1 ARG B 286 28.153 30.669 -60.522 1.00174.63 N
ATOM 4847 NH2 ARG B 286 27.192 29.674 -58.695 1.00173.32 N
ATOM 4848 N ARG B 287 24.630 28.243 -62.243 1.00174.02 N
ATOM 4849 CA ARG B 287 25.313 26.977 -62.006 1.00173.49 C
ATOM 4850 C ARG B 287 25.289 26.096 -63.248 1.00173.06 C
ATOM 4851 O ARG B 287 26.304 25.513 -63.628 1.00173.48 O
ATOM 4852 CB ARG B 287 24.678 26.231 -60.832 1.00173.02 C
ATOM 4853 CG ARG B 287 24.985 26.817 -59.464 1.00173.19 C
ATOM 4854 CD ARG B 287 24.565 25.851 -58.366 1.00173.62 C
ATOM 4855 NE ARG B 287 24.945 26.314 -57.035 1.00173.01 N
ATOM 4856 CZ ARG B 287 25.081 25.516 -55.981 1.00172.60 C
ATOM 4857 NH1 ARG B 287 24.868 24.213 -56.103 1.00172.75 N
ATOM 4858 NH2 ARG B 287 25.431 26.018 -54.805 1.00171.75 N
ATOM 4859 N VAL B 288 24.119 25.999 -63.871 1.00172.53 N
ATOM 4860 CA VAL B 288 23.939 25.147 -65.040 1.00172.74 C
ATOM 4861 C VAL B 288 24.820 25.605 -66.198 1.00173.32 C
ATOM 4862 O VAL B 288 25.503 24.795 -66.825 1.00173.80 O
ATOM 4863 CB VAL B 288 22.467 25.122 -65.493 1.00173.35 C
ATOM 4864 CG1 VAL B 288 22.333 24.424 -66.836 1.00174.11 C
ATOM 4865 CG2 VAL B 288 21.605 24.436 -64.446 1.00173.38 C
ATOM 4866 N GLN B 289 24.810 26.908 -66.467 1.00173.30 N
ATOM 4867 CA GLN B 289 25.612 27.473 -67.547 1.00173.51 C
ATOM 4868 C GLN B 289 27.105 27.320 -67.274 1.00173.43 C
ATOM 4869 O GLN B 289 27.903 27.186 -68.201 1.00174.02 O
ATOM 4870 CB GLN B 289 25.266 28.951 -67.758 1.00173.62 C
ATOM 4871 CG GLN B 289 23.852 29.224 -68.275 1.00173.80 C
ATOM 4872 CD GLN B 289 23.588 28.648 -69.658 1.00174.27 C
ATOM 4873 OE1 GLN B 289 23.559 27.432 -69.848 1.00174.79 O
ATOM 4874 NE2 GLN B 289 23.396 29.527 -70.634 1.00174.16 N
ATOM 4875 N ALA B 290 27.475 27.339 -65.998 1.00173.45 N
ATOM 4876 CA ALA B 290 28.865 27.153 -65.596 1.00173.94 C
ATOM 4877 C ALA B 290 29.324 25.733 -65.900 1.00173.84 C
ATOM 4878 O ALA B 290 30.436 25.517 -66.381 1.00174.20 O
ATOM 4879 CB ALA B 290 29.041 27.464 -64.117 1.00174.81 C
ATOM 4880 N SER B 291 28.460 24.768 -65.600 1.00173.63 N
ATOM 4881 CA SER B 291 28.743 23.365 -65.874 1.00174.44 C
ATOM 4882 C SER B 291 28.911 23.104 -67.370 1.00175.10 C
ATOM 4883 O SER B 291 29.790 22.345 -67.779 1.00175.36 O
ATOM 4884 CB SER B 291 27.630 22.481 -65.307 1.00174.42 C
ATOM 4885 OG SER B 291 27.624 22.521 -63.891 1.00173.21 O
ATOM 4886 N LEU B 292 28.070 23.741 -68.180 1.00174.60 N
ATOM 4887 CA LEU B 292 28.130 23.588 -69.631 1.00173.48 C
ATOM 4888 C LEU B 292 29.432 24.152 -70.190 1.00173.76 C
ATOM 4889 O LEU B 292 29.957 23.659 -71.188 1.00173.11 O
ATOM 4890 CB LEU B 292 26.931 24.270 -70.292 1.00173.05 C
ATOM 4891 CG LEU B 292 25.557 23.650 -70.022 1.00172.66 C
ATOM 4892 CD1 LEU B 292 24.482 24.355 -70.837 1.00172.78 C
ATOM 4893 CD2 LEU B 292 25.564 22.156 -70.311 1.00172.01 C
ATOM 4894 N ALA B 293 29.946 25.191 -69.539 1.00174.17 N
ATOM 4895 CA ALA B 293 31.220 25.787 -69.921 1.00174.00 C
ATOM 4896 C ALA B 293 32.361 24.801 -69.687 1.00175.20 C
ATOM 4897 O ALA B 293 33.298 24.722 -70.482 1.00175.68 O
ATOM 4898 CB ALA B 293 31.460 27.077 -69.149 1.00173.33 C
ATOM 4899 N SER B 294 32.273 24.051 -68.591 1.00175.56 N
ATOM 4900 CA SER B 294 33.271 23.033 -68.266 1.00175.39 C
ATOM 4901 C SER B 294 33.057 21.735 -69.052 1.00175.25 C
ATOM 4902 O SER B 294 33.424 20.654 -68.591 1.00175.63 O
ATOM 4903 CB SER B 294 33.261 22.738 -66.761 1.00174.50 C
ATOM 4904 OG SER B 294 31.995 22.261 -66.336 1.00174.26 O
ATOM 4905 N GLY B 295 32.463 21.852 -70.236 1.00174.81 N
ATOM 4906 CA GLY B 295 32.273 20.719 -71.123 1.00174.33 C
ATOM 4907 C GLY B 295 31.400 19.602 -70.579 1.00173.76 C
ATOM 4908 O GLY B 295 31.678 18.425 -70.808 1.00174.80 O
ATOM 4909 N ALA B 296 30.343 19.964 -69.860 1.00172.91 N
ATOM 4910 CA ALA B 296 29.378 18.976 -69.392 1.00173.23 C
ATOM 4911 C ALA B 296 28.142 18.989 -70.280 1.00172.72 C
ATOM 4912 O ALA B 296 27.877 19.974 -70.969 1.00172.54 O
ATOM 4913 CB ALA B 296 28.997 19.238 -67.945 1.00174.14 C
ATOM 4914 N THR B 297 27.386 17.897 -70.261 1.00172.92 N
ATOM 4915 CA THR B 297 26.166 17.807 -71.054 1.00173.03 C
ATOM 4916 C THR B 297 25.002 18.444 -70.310 1.00172.80 C
ATOM 4917 O THR B 297 25.116 18.776 -69.131 1.00173.20 O
ATOM 4918 CB THR B 297 25.811 16.348 -71.396 1.00173.22 C
ATOM 4919 OG1 THR B 297 25.534 15.625 -70.190 1.00172.87 O
ATOM 4920 CG2 THR B 297 26.958 15.678 -72.138 1.00173.95 C
ATOM 4921 N LEU B 298 23.886 18.622 -71.010 1.00172.50 N
ATOM 4922 CA LEU B 298 22.685 19.187 -70.408 1.00172.44 C
ATOM 4923 C LEU B 298 22.190 18.300 -69.270 1.00172.92 C
ATOM 4924 O LEU B 298 21.671 18.789 -68.267 1.00173.32 O
ATOM 4925 CB LEU B 298 21.593 19.372 -71.462 1.00172.07 C
ATOM 4926 CG LEU B 298 20.506 20.389 -71.114 1.00172.57 C
ATOM 4927 CD1 LEU B 298 21.130 21.696 -70.646 1.00173.00 C
ATOM 4928 CD2 LEU B 298 19.604 20.631 -72.311 1.00173.66 C
ATOM 4929 N GLU B 299 22.354 16.992 -69.440 1.00172.86 N
ATOM 4930 CA GLU B 299 22.035 16.027 -68.394 1.00173.26 C
ATOM 4931 C GLU B 299 22.874 16.267 -67.145 1.00172.74 C
ATOM 4932 O GLU B 299 22.341 16.493 -66.060 1.00172.66 O
ATOM 4933 CB GLU B 299 22.258 14.600 -68.897 1.00173.82 C
ATOM 4934 CG GLU B 299 21.291 14.152 -69.978 1.00174.67 C
ATOM 4935 CD GLU B 299 21.055 12.655 -69.947 1.00175.32 C
ATOM 4936 OE1 GLU B 299 22.025 11.906 -69.703 1.00175.12 O
ATOM 4937 OE2 GLU B 299 19.902 12.228 -70.165 1.00176.14 O
ATOM 4938 N GLU B 300 24.191 16.227 -67.321 1.00172.69 N
ATOM 4939 CA GLU B 300 25.137 16.372 -66.221 1.00173.03 C
ATOM 4940 C GLU B 300 24.972 17.704 -65.496 1.00173.77 C
ATOM 4941 O GLU B 300 25.004 17.757 -64.266 1.00174.38 O
ATOM 4942 CB GLU B 300 26.569 16.235 -66.739 1.00173.15 C
ATOM 4943 CG GLU B 300 26.862 14.893 -67.387 1.00173.24 C
ATOM 4944 CD GLU B 300 28.218 14.861 -68.058 1.00174.06 C
ATOM 4945 OE1 GLU B 300 28.496 15.760 -68.879 1.00173.70 O
ATOM 4946 OE2 GLU B 300 29.005 13.937 -67.768 1.00175.52 O
ATOM 4947 N ALA B 301 24.794 18.772 -66.267 1.00174.30 N
ATOM 4948 CA ALA B 301 24.621 20.114 -65.718 1.00174.43 C
ATOM 4949 C ALA B 301 23.455 20.185 -64.735 1.00173.25 C
ATOM 4950 O ALA B 301 23.635 20.532 -63.570 1.00173.68 O
ATOM 4951 CB ALA B 301 24.419 21.120 -66.844 1.00174.66 C
ATOM 4952 N TRP B 302 22.261 19.861 -65.217 1.00172.14 N
ATOM 4953 CA TRP B 302 21.062 19.900 -64.390 1.00172.05 C
ATOM 4954 C TRP B 302 21.097 18.876 -63.260 1.00172.42 C
ATOM 4955 O TRP B 302 20.534 19.107 -62.191 1.00172.73 O
ATOM 4956 CB TRP B 302 19.822 19.690 -65.257 1.00171.98 C
ATOM 4957 CG TRP B 302 19.480 20.906 -66.044 1.00172.66 C
ATOM 4958 CD1 TRP B 302 19.724 21.122 -67.367 1.00174.07 C
ATOM 4959 CD2 TRP B 302 18.847 22.092 -65.553 1.00172.66 C
ATOM 4960 NE1 TRP B 302 19.275 22.367 -67.734 1.00175.16 N
ATOM 4961 CE2 TRP B 302 18.732 22.983 -66.638 1.00174.13 C
ATOM 4962 CE3 TRP B 302 18.364 22.485 -64.303 1.00172.82 C
ATOM 4963 CZ2 TRP B 302 18.153 24.244 -66.509 1.00173.93 C
ATOM 4964 CZ3 TRP B 302 17.785 23.732 -64.180 1.00173.37 C
ATOM 4965 CH2 TRP B 302 17.687 24.598 -65.274 1.00173.15 C
ATOM 4966 N SER B 303 21.753 17.746 -63.500 1.00172.17 N
ATOM 4967 CA SER B 303 21.883 16.713 -62.479 1.00172.40 C
ATOM 4968 C SER B 303 22.732 17.194 -61.308 1.00172.84 C
ATOM 4969 O SER B 303 22.584 16.714 -60.184 1.00173.38 O
ATOM 4970 CB SER B 303 22.491 15.442 -63.073 1.00173.60 C
ATOM 4971 OG SER B 303 21.645 14.895 -64.070 1.00174.87 O
ATOM 4972 N ALA B 304 23.617 18.148 -61.577 1.00173.41 N
ATOM 4973 CA ALA B 304 24.501 18.688 -60.550 1.00174.15 C
ATOM 4974 C ALA B 304 23.751 19.601 -59.584 1.00174.37 C
ATOM 4975 O ALA B 304 24.175 19.793 -58.444 1.00174.44 O
ATOM 4976 CB ALA B 304 25.657 19.438 -61.193 1.00174.23 C
ATOM 4977 N ILE B 305 22.638 20.161 -60.047 1.00174.08 N
ATOM 4978 CA ILE B 305 21.817 21.040 -59.222 1.00173.03 C
ATOM 4979 C ILE B 305 21.221 20.284 -58.039 1.00173.00 C
ATOM 4980 O ILE B 305 20.409 19.378 -58.223 1.00173.58 O
ATOM 4981 CB ILE B 305 20.679 21.678 -60.039 1.00172.74 C
ATOM 4982 CG1 ILE B 305 21.252 22.549 -61.158 1.00173.54 C
ATOM 4983 CG2 ILE B 305 19.771 22.503 -59.140 1.00172.97 C
ATOM 4984 CD1 ILE B 305 21.926 23.811 -60.669 1.00173.14 C
ATOM 4985 N PRO B 306 21.636 20.647 -56.817 1.00172.47 N
ATOM 4986 CA PRO B 306 21.127 20.023 -55.592 1.00172.34 C
ATOM 4987 C PRO B 306 19.621 20.213 -55.435 1.00172.10 C
ATOM 4988 O PRO B 306 19.118 21.312 -55.666 1.00172.35 O
ATOM 4989 CB PRO B 306 21.892 20.756 -54.486 1.00174.21 C
ATOM 4990 CG PRO B 306 22.244 22.075 -55.095 1.00174.26 C
ATOM 4991 CD PRO B 306 22.565 21.750 -56.518 1.00172.98 C
ATOM 4992 N GLU B 307 18.923 19.145 -55.058 1.00171.67 N
ATOM 4993 CA GLU B 307 17.468 19.159 -54.917 1.00172.37 C
ATOM 4994 C GLU B 307 16.952 20.301 -54.046 1.00171.85 C
ATOM 4995 O GLU B 307 15.995 20.983 -54.414 1.00171.73 O
ATOM 4996 CB GLU B 307 16.982 17.824 -54.349 1.00173.15 C
ATOM 4997 CG GLU B 307 17.109 16.656 -55.313 1.00173.35 C
ATOM 4998 CD GLU B 307 16.189 15.507 -54.951 1.00173.14 C
ATOM 4999 OE1 GLU B 307 16.327 14.962 -53.836 1.00173.89 O
ATOM 5000 OE2 GLU B 307 15.325 15.150 -55.780 1.00172.09 O
ATOM 5001 N LYS B 308 17.582 20.494 -52.891 1.00171.75 N
ATOM 5002 CA LYS B 308 17.199 21.554 -51.964 1.00172.87 C
ATOM 5003 C LYS B 308 17.150 22.917 -52.649 1.00172.93 C
ATOM 5004 O LYS B 308 16.208 23.684 -52.456 1.00173.49 O
ATOM 5005 CB LYS B 308 18.168 21.602 -50.782 1.00173.84 C
ATOM 5006 CG LYS B 308 17.854 22.686 -49.766 1.00173.44 C
ATOM 5007 CD LYS B 308 17.737 22.108 -48.366 1.00173.71 C
ATOM 5008 CE LYS B 308 18.804 22.678 -47.445 1.00173.48 C
ATOM 5009 NZ LYS B 308 18.638 22.211 -46.040 1.00173.15 N
ATOM 5010 N LEU B 309 18.165 23.199 -53.458 1.00172.66 N
ATOM 5011 CA LEU B 309 18.266 24.471 -54.165 1.00173.02 C
ATOM 5012 C LEU B 309 17.107 24.635 -55.146 1.00172.67 C
ATOM 5013 O LEU B 309 16.527 25.714 -55.265 1.00172.82 O
ATOM 5014 CB LEU B 309 19.610 24.568 -54.895 1.00173.57 C
ATOM 5015 CG LEU B 309 20.193 25.945 -55.235 1.00173.90 C
ATOM 5016 CD1 LEU B 309 20.209 26.172 -56.738 1.00174.04 C
ATOM 5017 CD2 LEU B 309 19.450 27.074 -54.527 1.00174.70 C
ATOM 5018 N ALA B 310 16.777 23.554 -55.844 1.00172.26 N
ATOM 5019 CA ALA B 310 15.662 23.551 -56.782 1.00172.83 C
ATOM 5020 C ALA B 310 14.327 23.755 -56.072 1.00172.05 C
ATOM 5021 O ALA B 310 13.424 24.402 -56.602 1.00172.32 O
ATOM 5022 CB ALA B 310 15.645 22.252 -57.575 1.00173.89 C
ATOM 5023 N PHE B 311 14.210 23.198 -54.870 1.00171.73 N
ATOM 5024 CA PHE B 311 12.969 23.272 -54.105 1.00172.29 C
ATOM 5025 C PHE B 311 12.570 24.709 -53.778 1.00172.62 C
ATOM 5026 O PHE B 311 11.384 25.031 -53.727 1.00172.68 O
ATOM 5027 CB PHE B 311 13.091 22.460 -52.815 1.00173.39 C
ATOM 5028 CG PHE B 311 11.770 22.079 -52.213 1.00173.40 C
ATOM 5029 CD1 PHE B 311 10.723 21.661 -53.017 1.00172.94 C
ATOM 5030 CD2 PHE B 311 11.574 22.136 -50.843 1.00173.81 C
ATOM 5031 CE1 PHE B 311 9.505 21.310 -52.466 1.00172.90 C
ATOM 5032 CE2 PHE B 311 10.359 21.786 -50.287 1.00173.10 C
ATOM 5033 CZ PHE B 311 9.323 21.372 -51.099 1.00172.40 C
ATOM 5034 N TYR B 312 13.560 25.568 -53.559 1.00172.71 N
ATOM 5035 CA TYR B 312 13.294 26.972 -53.261 1.00172.69 C
ATOM 5036 C TYR B 312 12.697 27.698 -54.463 1.00173.16 C
ATOM 5037 O TYR B 312 12.056 28.737 -54.312 1.00173.63 O
ATOM 5038 CB TYR B 312 14.570 27.687 -52.816 1.00172.95 C
ATOM 5039 CG TYR B 312 15.094 27.266 -51.461 1.00173.57 C
ATOM 5040 CD1 TYR B 312 16.267 26.534 -51.348 1.00173.99 C
ATOM 5041 CD2 TYR B 312 14.422 27.610 -50.296 1.00174.03 C
ATOM 5042 CE1 TYR B 312 16.756 26.150 -50.113 1.00173.46 C
ATOM 5043 CE2 TYR B 312 14.902 27.230 -49.055 1.00174.19 C
ATOM 5044 CZ TYR B 312 16.070 26.500 -48.971 1.00173.66 C
ATOM 5045 OH TYR B 312 16.553 26.120 -47.740 1.00173.93 O
ATOM 5046 N ASP B 313 12.914 27.149 -55.654 1.00173.28 N
ATOM 5047 CA ASP B 313 12.414 27.759 -56.880 1.00173.41 C
ATOM 5048 C ASP B 313 11.034 27.205 -57.226 1.00173.03 C
ATOM 5049 O ASP B 313 10.737 26.917 -58.384 1.00173.32 O
ATOM 5050 CB ASP B 313 13.394 27.526 -58.034 1.00173.87 C
ATOM 5051 CG ASP B 313 13.155 28.463 -59.205 1.00173.71 C
ATOM 5052 OD1 ASP B 313 12.778 29.630 -58.970 1.00173.58 O
ATOM 5053 OD2 ASP B 313 13.345 28.031 -60.361 1.00173.64 O
ATOM 5054 N TYR B 314 10.198 27.057 -56.204 1.00173.29 N
ATOM 5055 CA TYR B 314 8.848 26.533 -56.371 1.00173.82 C
ATOM 5056 C TYR B 314 7.847 27.416 -55.628 1.00174.01 C
ATOM 5057 O TYR B 314 7.982 27.640 -54.425 1.00174.42 O
ATOM 5058 CB TYR B 314 8.774 25.084 -55.878 1.00173.86 C
ATOM 5059 CG TYR B 314 7.373 24.529 -55.742 1.00173.52 C
ATOM 5060 CD1 TYR B 314 6.462 24.616 -56.787 1.00173.56 C
ATOM 5061 CD2 TYR B 314 6.969 23.894 -54.575 1.00173.46 C
ATOM 5062 CE1 TYR B 314 5.183 24.104 -56.666 1.00173.33 C
ATOM 5063 CE2 TYR B 314 5.696 23.375 -54.446 1.00173.46 C
ATOM 5064 CZ TYR B 314 4.806 23.484 -55.493 1.00173.16 C
ATOM 5065 OH TYR B 314 3.537 22.969 -55.365 1.00173.37 O
ATOM 5066 N ILE B 315 6.847 27.914 -56.352 1.00173.89 N
ATOM 5067 CA ILE B 315 5.873 28.854 -55.798 1.00174.01 C
ATOM 5068 C ILE B 315 5.083 28.282 -54.619 1.00174.08 C
ATOM 5069 O ILE B 315 4.442 29.026 -53.877 1.00174.51 O
ATOM 5070 CB ILE B 315 4.873 29.329 -56.878 1.00173.65 C
ATOM 5071 CG1 ILE B 315 4.346 30.727 -56.546 1.00173.51 C
ATOM 5072 CG2 ILE B 315 3.722 28.347 -57.019 1.00173.78 C
ATOM 5073 CD1 ILE B 315 3.533 31.346 -57.654 1.00173.34 C
ATOM 5074 N GLY B 316 5.134 26.966 -54.438 1.00173.67 N
ATOM 5075 CA GLY B 316 4.429 26.330 -53.339 1.00173.43 C
ATOM 5076 C GLY B 316 5.143 26.517 -52.015 1.00172.75 C
ATOM 5077 O GLY B 316 4.728 25.981 -50.988 1.00172.51 O
ATOM 5078 N ASN B 317 6.227 27.283 -52.046 1.00172.21 N
ATOM 5079 CA ASN B 317 6.976 27.613 -50.847 1.00172.17 C
ATOM 5080 C ASN B 317 6.972 29.121 -50.649 1.00171.96 C
ATOM 5081 O ASN B 317 7.617 29.648 -49.744 1.00172.25 O
ATOM 5082 CB ASN B 317 8.406 27.082 -50.938 1.00173.22 C
ATOM 5083 CG ASN B 317 8.459 25.573 -51.088 1.00173.72 C
ATOM 5084 OD1 ASN B 317 8.074 24.835 -50.181 1.00173.30 O
ATOM 5085 ND2 ASN B 317 8.940 25.108 -52.234 1.00174.02 N
ATOM 5086 N ASN B 318 6.240 29.806 -51.521 1.00171.90 N
ATOM 5087 CA ASN B 318 6.060 31.248 -51.432 1.00173.27 C
ATOM 5088 C ASN B 318 4.997 31.586 -50.392 1.00172.95 C
ATOM 5089 O ASN B 318 3.847 31.168 -50.517 1.00173.19 O
ATOM 5090 CB ASN B 318 5.681 31.820 -52.805 1.00174.88 C
ATOM 5091 CG ASN B 318 5.682 33.341 -52.838 1.00175.31 C
ATOM 5092 OD1 ASN B 318 5.509 34.001 -51.815 1.00174.88 O
ATOM 5093 ND2 ASN B 318 5.870 33.903 -54.026 1.00175.01 N
ATOM 5094 N PRO B 319 5.383 32.345 -49.356 1.00172.80 N
ATOM 5095 CA PRO B 319 4.472 32.745 -48.277 1.00173.10 C
ATOM 5096 C PRO B 319 3.311 33.610 -48.758 1.00172.99 C
ATOM 5097 O PRO B 319 2.307 33.731 -48.056 1.00172.95 O
ATOM 5098 CB PRO B 319 5.382 33.543 -47.336 1.00174.06 C
ATOM 5099 CG PRO B 319 6.751 33.024 -47.615 1.00173.99 C
ATOM 5100 CD PRO B 319 6.762 32.789 -49.091 1.00173.07 C
ATOM 5101 N ALA B 320 3.446 34.196 -49.942 1.00173.08 N
ATOM 5102 CA ALA B 320 2.406 35.057 -50.490 1.00173.63 C
ATOM 5103 C ALA B 320 1.274 34.240 -51.107 1.00173.68 C
ATOM 5104 O ALA B 320 0.279 34.795 -51.570 1.00173.65 O
ATOM 5105 CB ALA B 320 2.996 36.010 -51.521 1.00173.85 C
ATOM 5106 N LYS B 321 1.432 32.921 -51.117 1.00173.87 N
ATOM 5107 CA LYS B 321 0.368 32.030 -51.561 1.00173.99 C
ATOM 5108 C LYS B 321 -0.357 31.438 -50.356 1.00173.68 C
ATOM 5109 O LYS B 321 0.247 31.219 -49.306 1.00173.71 O
ATOM 5110 CB LYS B 321 0.929 30.918 -52.451 1.00174.61 C
ATOM 5111 CG LYS B 321 1.641 31.420 -53.698 1.00173.92 C
ATOM 5112 CD LYS B 321 0.675 32.106 -54.652 1.00172.84 C
ATOM 5113 CE LYS B 321 -0.319 31.116 -55.236 1.00172.81 C
ATOM 5114 NZ LYS B 321 -1.345 31.786 -56.081 1.00173.22 N
ATOM 5115 N GLY B 322 -1.652 31.185 -50.506 1.00173.26 N
ATOM 5116 CA GLY B 322 -2.436 30.630 -49.420 1.00173.76 C
ATOM 5117 C GLY B 322 -3.655 31.463 -49.078 1.00174.58 C
ATOM 5118 O GLY B 322 -4.004 32.399 -49.798 1.00174.93 O
ATOM 5119 N GLY B 323 -4.303 31.118 -47.970 1.00174.77 N
ATOM 5120 CA GLY B 323 -5.507 31.805 -47.541 1.00174.23 C
ATOM 5121 C GLY B 323 -5.632 31.874 -46.032 1.00173.56 C
ATOM 5122 O GLY B 323 -4.977 31.121 -45.310 1.00173.85 O
ATOM 5123 N LEU B 324 -6.481 32.778 -45.555 1.00173.21 N
ATOM 5124 CA LEU B 324 -6.631 33.019 -44.124 1.00173.39 C
ATOM 5125 C LEU B 324 -7.168 31.802 -43.376 1.00173.13 C
ATOM 5126 O LEU B 324 -6.762 31.530 -42.247 1.00172.95 O
ATOM 5127 CB LEU B 324 -7.551 34.217 -43.881 1.00173.77 C
ATOM 5128 CG LEU B 324 -7.770 34.613 -42.419 1.00173.29 C
ATOM 5129 CD1 LEU B 324 -6.459 35.016 -41.762 1.00173.85 C
ATOM 5130 CD2 LEU B 324 -8.793 35.735 -42.312 1.00173.48 C
ATOM 5131 N PHE B 325 -8.077 31.070 -44.010 1.00172.80 N
ATOM 5132 CA PHE B 325 -8.689 29.912 -43.372 1.00172.49 C
ATOM 5133 C PHE B 325 -8.223 28.612 -44.008 1.00172.10 C
ATOM 5134 O PHE B 325 -8.867 27.573 -43.872 1.00171.67 O
ATOM 5135 CB PHE B 325 -10.210 30.015 -43.435 1.00172.89 C
ATOM 5136 CG PHE B 325 -10.766 31.177 -42.666 1.00173.12 C
ATOM 5137 CD1 PHE B 325 -10.888 31.113 -41.289 1.00173.66 C
ATOM 5138 CD2 PHE B 325 -11.163 32.332 -43.318 1.00173.37 C
ATOM 5139 CE1 PHE B 325 -11.398 32.179 -40.576 1.00173.98 C
ATOM 5140 CE2 PHE B 325 -11.674 33.402 -42.610 1.00172.79 C
ATOM 5141 CZ PHE B 325 -11.792 33.325 -41.237 1.00173.68 C
ATOM 5142 N ARG B 326 -7.094 28.682 -44.703 1.00172.44 N
ATOM 5143 CA ARG B 326 -6.459 27.494 -45.251 1.00172.94 C
ATOM 5144 C ARG B 326 -5.507 26.938 -44.201 1.00173.02 C
ATOM 5145 O ARG B 326 -4.287 27.065 -44.313 1.00173.84 O
ATOM 5146 CB ARG B 326 -5.724 27.819 -46.550 1.00173.42 C
ATOM 5147 CG ARG B 326 -6.653 28.054 -47.736 1.00174.26 C
ATOM 5148 CD ARG B 326 -5.875 28.326 -49.016 1.00174.31 C
ATOM 5149 NE ARG B 326 -6.734 28.835 -50.083 1.00173.09 N
ATOM 5150 CZ ARG B 326 -6.282 29.369 -51.213 1.00172.44 C
ATOM 5151 NH1 ARG B 326 -4.977 29.463 -51.429 1.00173.14 N
ATOM 5152 NH2 ARG B 326 -7.133 29.811 -52.128 1.00171.82 N
ATOM 5153 N THR B 327 -6.083 26.316 -43.180 1.00172.36 N
ATOM 5154 CA THR B 327 -5.341 25.920 -41.991 1.00172.82 C
ATOM 5155 C THR B 327 -4.399 24.746 -42.232 1.00173.84 C
ATOM 5156 O THR B 327 -4.459 24.085 -43.268 1.00174.35 O
ATOM 5157 CB THR B 327 -6.300 25.553 -40.850 1.00172.79 C
ATOM 5158 OG1 THR B 327 -7.179 24.504 -41.278 1.00172.04 O
ATOM 5159 CG2 THR B 327 -7.124 26.763 -40.451 1.00173.04 C
ATOM 5160 N GLY B 328 -3.533 24.494 -41.254 1.00174.10 N
ATOM 5161 CA GLY B 328 -2.598 23.383 -41.304 1.00174.16 C
ATOM 5162 C GLY B 328 -1.271 23.731 -41.953 1.00174.39 C
ATOM 5163 O GLY B 328 -1.039 24.882 -42.324 1.00174.50 O
ATOM 5164 N PRO B 329 -0.386 22.731 -42.094 1.00174.10 N
ATOM 5165 CA PRO B 329 0.940 22.907 -42.690 1.00173.93 C
ATOM 5166 C PRO B 329 0.868 23.063 -44.203 1.00173.49 C
ATOM 5167 O PRO B 329 -0.204 22.914 -44.784 1.00173.59 O
ATOM 5168 CB PRO B 329 1.657 21.612 -42.313 1.00174.14 C
ATOM 5169 CG PRO B 329 0.565 20.604 -42.308 1.00174.10 C
ATOM 5170 CD PRO B 329 -0.625 21.325 -41.719 1.00173.74 C
ATOM 5171 N MET B 330 1.999 23.355 -44.831 1.00173.32 N
ATOM 5172 CA MET B 330 2.044 23.494 -46.279 1.00173.90 C
ATOM 5173 C MET B 330 1.844 22.145 -46.962 1.00173.88 C
ATOM 5174 O MET B 330 1.488 22.081 -48.139 1.00174.20 O
ATOM 5175 CB MET B 330 3.370 24.118 -46.712 1.00174.90 C
ATOM 5176 CG MET B 330 3.568 25.538 -46.217 1.00175.04 C
ATOM 5177 SD MET B 330 5.155 26.228 -46.719 1.00179.58 S
ATOM 5178 CE MET B 330 4.640 27.368 -48.001 1.00175.08 C
ATOM 5179 N ASN B 331 2.072 21.071 -46.214 1.00173.54 N
ATOM 5180 CA ASN B 331 1.939 19.718 -46.743 1.00173.55 C
ATOM 5181 C ASN B 331 0.485 19.289 -46.914 1.00173.22 C
ATOM 5182 O ASN B 331 0.194 18.334 -47.632 1.00173.43 O
ATOM 5183 CB ASN B 331 2.670 18.725 -45.840 1.00173.61 C
ATOM 5184 CG ASN B 331 4.175 18.862 -45.924 1.00173.81 C
ATOM 5185 OD1 ASN B 331 4.720 19.207 -46.973 1.00173.96 O
ATOM 5186 ND2 ASN B 331 4.857 18.594 -44.818 1.00174.11 N
ATOM 5187 N LYS B 332 -0.428 19.989 -46.250 1.00172.66 N
ATOM 5188 CA LYS B 332 -1.850 19.717 -46.421 1.00172.44 C
ATOM 5189 C LYS B 332 -2.308 20.278 -47.763 1.00172.95 C
ATOM 5190 O LYS B 332 -3.391 19.958 -48.254 1.00173.40 O
ATOM 5191 CB LYS B 332 -2.661 20.320 -45.270 1.00173.47 C
ATOM 5192 CG LYS B 332 -4.141 19.961 -45.273 1.00173.84 C
ATOM 5193 CD LYS B 332 -4.351 18.465 -45.119 1.00174.03 C
ATOM 5194 CE LYS B 332 -5.801 18.139 -44.783 1.00173.59 C
ATOM 5195 NZ LYS B 332 -6.740 18.565 -45.860 1.00173.19 N
ATOM 5196 N GLY B 333 -1.458 21.107 -48.359 1.00173.00 N
ATOM 5197 CA GLY B 333 -1.741 21.691 -49.654 1.00173.35 C
ATOM 5198 C GLY B 333 -1.291 20.808 -50.799 1.00173.32 C
ATOM 5199 O GLY B 333 -1.984 19.864 -51.171 1.00173.35 O
ATOM 5200 N ASP B 334 -0.119 21.108 -51.350 1.00172.92 N
ATOM 5201 CA ASP B 334 0.396 20.373 -52.498 1.00172.93 C
ATOM 5202 C ASP B 334 0.850 18.964 -52.129 1.00173.18 C
ATOM 5203 O ASP B 334 1.036 18.118 -53.001 1.00173.63 O
ATOM 5204 CB ASP B 334 1.552 21.141 -53.141 1.00173.01 C
ATOM 5205 CG ASP B 334 2.493 21.742 -52.117 1.00172.87 C
ATOM 5206 OD1 ASP B 334 2.485 21.281 -50.957 1.00172.68 O
ATOM 5207 OD2 ASP B 334 3.235 22.681 -52.472 1.00173.03 O
ATOM 5208 N GLY B 335 1.024 18.715 -50.835 1.00173.04 N
ATOM 5209 CA GLY B 335 1.445 17.408 -50.368 1.00173.06 C
ATOM 5210 C GLY B 335 2.898 17.376 -49.942 1.00172.37 C
ATOM 5211 O GLY B 335 3.639 18.333 -50.161 1.00172.34 O
ATOM 5212 N ILE B 336 3.304 16.270 -49.327 1.00172.36 N
ATOM 5213 CA ILE B 336 4.684 16.099 -48.893 1.00172.89 C
ATOM 5214 C ILE B 336 5.601 15.870 -50.089 1.00172.88 C
ATOM 5215 O ILE B 336 5.426 14.912 -50.841 1.00172.93 O
ATOM 5216 CB ILE B 336 4.830 14.919 -47.911 1.00173.66 C
ATOM 5217 CG1 ILE B 336 3.852 15.065 -46.745 1.00173.78 C
ATOM 5218 CG2 ILE B 336 6.258 14.832 -47.397 1.00174.01 C
ATOM 5219 CD1 ILE B 336 3.781 13.841 -45.854 1.00173.87 C
ATOM 5220 N ALA B 337 6.568 16.765 -50.265 1.00172.74 N
ATOM 5221 CA ALA B 337 7.525 16.658 -51.360 1.00172.73 C
ATOM 5222 C ALA B 337 8.375 15.398 -51.229 1.00173.65 C
ATOM 5223 O ALA B 337 8.982 15.155 -50.186 1.00174.53 O
ATOM 5224 CB ALA B 337 8.411 17.890 -51.409 1.00172.98 C
ATOM 5225 N GLN B 338 8.417 14.600 -52.291 1.00173.81 N
ATOM 5226 CA GLN B 338 9.159 13.346 -52.269 1.00173.96 C
ATOM 5227 C GLN B 338 10.469 13.443 -53.045 1.00173.61 C
ATOM 5228 O GLN B 338 11.521 13.040 -52.549 1.00173.89 O
ATOM 5229 CB GLN B 338 8.304 12.208 -52.833 1.00174.22 C
ATOM 5230 CG GLN B 338 7.032 11.937 -52.048 1.00173.96 C
ATOM 5231 CD GLN B 338 7.312 11.480 -50.629 1.00173.92 C
ATOM 5232 OE1 GLN B 338 7.879 10.410 -50.409 1.00173.41 O
ATOM 5233 NE2 GLN B 338 6.910 12.291 -49.657 1.00174.35 N
ATOM 5234 N ALA B 339 10.404 13.987 -54.256 1.00172.36 N
ATOM 5235 CA ALA B 339 11.581 14.069 -55.112 1.00172.24 C
ATOM 5236 C ALA B 339 11.418 15.118 -56.205 1.00172.34 C
ATOM 5237 O ALA B 339 10.307 15.549 -56.509 1.00172.18 O
ATOM 5238 CB ALA B 339 11.879 12.711 -55.729 1.00173.31 C
ATOM 5239 N TRP B 340 12.542 15.523 -56.787 1.00172.76 N
ATOM 5240 CA TRP B 340 12.543 16.477 -57.888 1.00173.59 C
ATOM 5241 C TRP B 340 12.400 15.749 -59.220 1.00173.74 C
ATOM 5242 O TRP B 340 13.291 15.002 -59.626 1.00173.54 O
ATOM 5243 CB TRP B 340 13.826 17.314 -57.870 1.00173.66 C
ATOM 5244 CG TRP B 340 13.918 18.327 -58.975 1.00174.06 C
ATOM 5245 CD1 TRP B 340 12.889 19.029 -59.535 1.00174.00 C
ATOM 5246 CD2 TRP B 340 15.108 18.757 -59.647 1.00174.03 C
ATOM 5247 NE1 TRP B 340 13.365 19.865 -60.516 1.00173.36 N
ATOM 5248 CE2 TRP B 340 14.724 19.718 -60.603 1.00173.67 C
ATOM 5249 CE3 TRP B 340 16.461 18.422 -59.534 1.00174.44 C
ATOM 5250 CZ2 TRP B 340 15.643 20.345 -61.443 1.00174.15 C
ATOM 5251 CZ3 TRP B 340 17.372 19.046 -60.367 1.00174.56 C
ATOM 5252 CH2 TRP B 340 16.959 19.997 -61.309 1.00174.52 C
ATOM 5253 N LYS B 341 11.271 15.962 -59.891 1.00173.58 N
ATOM 5254 CA LYS B 341 11.023 15.339 -61.187 1.00173.29 C
ATOM 5255 C LYS B 341 12.061 15.779 -62.211 1.00173.65 C
ATOM 5256 O LYS B 341 12.385 15.037 -63.139 1.00174.20 O
ATOM 5257 CB LYS B 341 9.617 15.671 -61.693 1.00173.47 C
ATOM 5258 CG LYS B 341 8.518 14.820 -61.083 1.00173.65 C
ATOM 5259 CD LYS B 341 7.139 15.348 -61.448 1.00173.46 C
ATOM 5260 CE LYS B 341 6.043 14.404 -60.976 1.00173.22 C
ATOM 5261 NZ LYS B 341 6.009 13.148 -61.775 1.00172.79 N
ATOM 5262 N GLY B 342 12.581 16.989 -62.035 1.00173.32 N
ATOM 5263 CA GLY B 342 13.617 17.503 -62.909 1.00173.43 C
ATOM 5264 C GLY B 342 13.218 18.750 -63.668 1.00173.42 C
ATOM 5265 O GLY B 342 12.044 19.119 -63.707 1.00173.34 O
ATOM 5266 N HIS B 343 14.206 19.403 -64.270 1.00173.73 N
ATOM 5267 CA HIS B 343 13.962 20.607 -65.053 1.00173.97 C
ATOM 5268 C HIS B 343 13.269 20.260 -66.362 1.00174.31 C
ATOM 5269 O HIS B 343 13.715 19.375 -67.092 1.00174.33 O
ATOM 5270 CB HIS B 343 15.267 21.346 -65.337 1.00173.45 C
ATOM 5271 CG HIS B 343 15.082 22.610 -66.116 1.00173.55 C
ATOM 5272 ND1 HIS B 343 14.551 23.754 -65.560 1.00172.90 N
ATOM 5273 CD2 HIS B 343 15.332 22.904 -67.413 1.00174.35 C
ATOM 5274 CE1 HIS B 343 14.497 24.703 -66.478 1.00172.91 C
ATOM 5275 NE2 HIS B 343 14.965 24.213 -67.611 1.00174.03 N
ATOM 5276 N ALA B 344 12.181 20.962 -66.658 1.00174.03 N
ATOM 5277 CA ALA B 344 11.418 20.705 -67.872 1.00174.14 C
ATOM 5278 C ALA B 344 11.784 21.687 -68.979 1.00173.93 C
ATOM 5279 O ALA B 344 11.663 22.900 -68.811 1.00173.33 O
ATOM 5280 CB ALA B 344 9.927 20.768 -67.580 1.00173.79 C
ATOM 5281 N VAL B 345 12.233 21.153 -70.110 1.00173.69 N
ATOM 5282 CA VAL B 345 12.550 21.974 -71.271 1.00173.05 C
ATOM 5283 C VAL B 345 11.518 21.741 -72.363 1.00172.56 C
ATOM 5284 O VAL B 345 11.350 20.621 -72.843 1.00172.89 O
ATOM 5285 CB VAL B 345 13.956 21.672 -71.819 1.00174.08 C
ATOM 5286 CG1 VAL B 345 14.181 22.406 -73.133 1.00174.70 C
ATOM 5287 CG2 VAL B 345 15.017 22.054 -70.798 1.00174.34 C
ATOM 5288 N PHE B 346 10.821 22.802 -72.748 1.00171.56 N
ATOM 5289 CA PHE B 346 9.765 22.690 -73.742 1.00172.52 C
ATOM 5290 C PHE B 346 10.246 23.124 -75.119 1.00173.74 C
ATOM 5291 O PHE B 346 10.895 24.159 -75.263 1.00173.76 O
ATOM 5292 CB PHE B 346 8.552 23.515 -73.318 1.00172.44 C
ATOM 5293 CG PHE B 346 7.947 23.069 -72.021 1.00172.70 C
ATOM 5294 CD1 PHE B 346 6.877 22.191 -72.009 1.00173.11 C
ATOM 5295 CD2 PHE B 346 8.456 23.515 -70.812 1.00173.72 C
ATOM 5296 CE1 PHE B 346 6.320 21.774 -70.818 1.00173.56 C
ATOM 5297 CE2 PHE B 346 7.904 23.100 -69.617 1.00174.62 C
ATOM 5298 CZ PHE B 346 6.834 22.228 -69.621 1.00174.43 C
ATOM 5299 N ARG B 347 9.919 22.323 -76.128 1.00174.25 N
ATOM 5300 CA ARG B 347 10.311 22.611 -77.500 1.00174.54 C
ATOM 5301 C ARG B 347 9.150 22.386 -78.461 1.00173.94 C
ATOM 5302 O ARG B 347 8.226 21.631 -78.162 1.00173.46 O
ATOM 5303 CB ARG B 347 11.504 21.746 -77.921 1.00174.70 C
ATOM 5304 CG ARG B 347 12.772 21.944 -77.097 1.00174.18 C
ATOM 5305 CD ARG B 347 13.960 21.248 -77.751 1.00173.39 C
ATOM 5306 NE ARG B 347 15.213 21.488 -77.040 1.00171.63 N
ATOM 5307 CZ ARG B 347 15.698 20.695 -76.090 1.00171.14 C
ATOM 5308 NH1 ARG B 347 15.037 19.602 -75.737 1.00170.96 N
ATOM 5309 NH2 ARG B 347 16.847 20.990 -75.499 1.00170.92 N
ATOM 5310 N ASN B 348 9.212 23.038 -79.619 1.00174.14 N
ATOM 5311 CA ASN B 348 8.207 22.857 -80.659 1.00173.94 C
ATOM 5312 C ASN B 348 8.827 22.221 -81.898 1.00173.88 C
ATOM 5313 O ASN B 348 10.048 22.091 -81.980 1.00174.11 O
ATOM 5314 CB ASN B 348 7.545 24.190 -81.018 1.00173.79 C
ATOM 5315 CG ASN B 348 8.404 25.046 -81.930 1.00173.77 C
ATOM 5316 OD1 ASN B 348 9.623 25.123 -81.768 1.00173.37 O
ATOM 5317 ND2 ASN B 348 7.768 25.697 -82.897 1.00173.34 N
ATOM 5318 N LYS B 349 7.976 21.806 -82.836 1.00173.47 N
ATOM 5319 CA LYS B 349 8.395 21.144 -84.077 1.00174.09 C
ATOM 5320 C LYS B 349 9.679 21.695 -84.711 1.00174.24 C
ATOM 5321 O LYS B 349 10.510 20.930 -85.200 1.00174.43 O
ATOM 5322 CB LYS B 349 7.260 21.202 -85.107 1.00174.64 C
ATOM 5323 CG LYS B 349 6.562 22.548 -85.213 1.00174.43 C
ATOM 5324 CD LYS B 349 5.689 22.618 -86.459 1.00173.98 C
ATOM 5325 CE LYS B 349 4.702 21.462 -86.522 1.00173.27 C
ATOM 5326 NZ LYS B 349 3.746 21.473 -85.380 1.00173.74 N
ATOM 5327 N GLU B 350 9.841 23.015 -84.698 1.00174.29 N
ATOM 5328 CA GLU B 350 11.037 23.636 -85.266 1.00174.95 C
ATOM 5329 C GLU B 350 12.278 23.443 -84.391 1.00175.11 C
ATOM 5330 O GLU B 350 13.384 23.808 -84.790 1.00176.67 O
ATOM 5331 CB GLU B 350 10.809 25.134 -85.506 1.00174.70 C
ATOM 5332 CG GLU B 350 10.152 25.474 -86.838 1.00173.87 C
ATOM 5333 CD GLU B 350 8.764 24.888 -86.973 1.00173.90 C
ATOM 5334 OE1 GLU B 350 7.873 25.286 -86.194 1.00173.96 O
ATOM 5335 OE2 GLU B 350 8.566 24.029 -87.858 1.00173.91 O
ATOM 5336 N GLY B 351 12.100 22.875 -83.203 1.00173.95 N
ATOM 5337 CA GLY B 351 13.216 22.656 -82.301 1.00173.54 C
ATOM 5338 C GLY B 351 13.446 23.811 -81.345 1.00172.87 C
ATOM 5339 O GLY B 351 14.198 23.680 -80.378 1.00173.40 O
ATOM 5340 N GLU B 352 12.810 24.946 -81.625 1.00172.11 N
ATOM 5341 CA GLU B 352 12.914 26.127 -80.774 1.00172.03 C
ATOM 5342 C GLU B 352 12.554 25.802 -79.331 1.00173.28 C
ATOM 5343 O GLU B 352 11.590 25.082 -79.076 1.00173.72 O
ATOM 5344 CB GLU B 352 12.004 27.243 -81.286 1.00171.73 C
ATOM 5345 CG GLU B 352 12.284 27.679 -82.708 1.00173.09 C
ATOM 5346 CD GLU B 352 11.284 28.706 -83.197 1.00174.36 C
ATOM 5347 OE1 GLU B 352 11.125 29.747 -82.525 1.00174.19 O
ATOM 5348 OE2 GLU B 352 10.655 28.471 -84.250 1.00175.44 O
ATOM 5349 N GLU B 353 13.325 26.335 -78.391 1.00173.86 N
ATOM 5350 CA GLU B 353 13.040 26.134 -76.976 1.00173.75 C
ATOM 5351 C GLU B 353 12.065 27.191 -76.471 1.00174.00 C
ATOM 5352 O GLU B 353 12.303 28.389 -76.628 1.00174.10 O
ATOM 5353 CB GLU B 353 14.327 26.173 -76.153 1.00173.00 C
ATOM 5354 CG GLU B 353 14.109 26.471 -74.677 1.00173.84 C
ATOM 5355 CD GLU B 353 15.337 26.185 -73.837 1.00174.03 C
ATOM 5356 OE1 GLU B 353 16.462 26.353 -74.350 1.00173.59 O
ATOM 5357 OE2 GLU B 353 15.176 25.792 -72.662 1.00174.08 O
ATOM 5358 N LEU B 354 10.968 26.745 -75.867 1.00173.51 N
ATOM 5359 CA LEU B 354 9.974 27.663 -75.322 1.00173.23 C
ATOM 5360 C LEU B 354 10.129 27.806 -73.815 1.00173.13 C
ATOM 5361 O LEU B 354 10.817 27.013 -73.172 1.00173.04 O
ATOM 5362 CB LEU B 354 8.554 27.195 -75.657 1.00173.53 C
ATOM 5363 CG LEU B 354 8.144 27.123 -77.131 1.00173.76 C
ATOM 5364 CD1 LEU B 354 8.816 28.226 -77.935 1.00174.32 C
ATOM 5365 CD2 LEU B 354 8.445 25.757 -77.726 1.00174.03 C
ATOM 5366 N PHE B 355 9.477 28.821 -73.259 1.00173.40 N
ATOM 5367 CA PHE B 355 9.554 29.090 -71.830 1.00173.54 C
ATOM 5368 C PHE B 355 8.175 29.371 -71.248 1.00173.50 C
ATOM 5369 O PHE B 355 7.389 30.128 -71.819 1.00173.29 O
ATOM 5370 CB PHE B 355 10.490 30.269 -71.558 1.00173.88 C
ATOM 5371 CG PHE B 355 11.909 30.025 -71.985 1.00173.96 C
ATOM 5372 CD1 PHE B 355 12.790 29.353 -71.154 1.00173.97 C
ATOM 5373 CD2 PHE B 355 12.360 30.464 -73.219 1.00174.26 C
ATOM 5374 CE1 PHE B 355 14.096 29.125 -71.544 1.00174.20 C
ATOM 5375 CE2 PHE B 355 13.665 30.239 -73.615 1.00174.98 C
ATOM 5376 CZ PHE B 355 14.534 29.569 -72.776 1.00175.21 C
ATOM 5377 N VAL B 356 7.888 28.754 -70.109 1.00173.39 N
ATOM 5378 CA VAL B 356 6.592 28.899 -69.464 1.00173.28 C
ATOM 5379 C VAL B 356 6.540 30.159 -68.610 1.00173.38 C
ATOM 5380 O VAL B 356 7.364 30.346 -67.714 1.00173.27 O
ATOM 5381 CB VAL B 356 6.266 27.684 -68.582 1.00173.67 C
ATOM 5382 CG1 VAL B 356 4.796 27.694 -68.194 1.00174.53 C
ATOM 5383 CG2 VAL B 356 6.623 26.398 -69.304 1.00173.67 C
ATOM 5384 N ARG B 357 5.572 31.025 -68.894 1.00173.30 N
ATOM 5385 CA ARG B 357 5.378 32.233 -68.103 1.00173.04 C
ATOM 5386 C ARG B 357 4.932 31.860 -66.693 1.00173.00 C
ATOM 5387 O ARG B 357 3.859 31.286 -66.506 1.00173.39 O
ATOM 5388 CB ARG B 357 4.351 33.152 -68.764 1.00173.41 C
ATOM 5389 CG ARG B 357 4.158 34.487 -68.062 1.00172.99 C
ATOM 5390 CD ARG B 357 5.442 35.300 -68.060 1.00171.82 C
ATOM 5391 NE ARG B 357 5.215 36.686 -67.660 1.00171.75 N
ATOM 5392 CZ ARG B 357 5.180 37.104 -66.399 1.00172.99 C
ATOM 5393 NH1 ARG B 357 5.357 36.242 -65.408 1.00174.09 N
ATOM 5394 NH2 ARG B 357 4.969 38.385 -66.128 1.00173.30 N
ATOM 5395 N ARG B 358 5.760 32.187 -65.707 1.00172.76 N
ATOM 5396 CA ARG B 358 5.499 31.797 -64.325 1.00173.37 C
ATOM 5397 C ARG B 358 4.322 32.558 -63.720 1.00173.42 C
ATOM 5398 O ARG B 358 3.913 33.602 -64.227 1.00173.80 O
ATOM 5399 CB ARG B 358 6.752 32.006 -63.469 1.00174.27 C
ATOM 5400 CG ARG B 358 7.877 31.024 -63.767 1.00174.98 C
ATOM 5401 CD ARG B 358 8.914 31.013 -62.652 1.00175.32 C
ATOM 5402 NE ARG B 358 9.922 29.974 -62.849 1.00175.02 N
ATOM 5403 CZ ARG B 358 10.912 29.719 -61.999 1.00174.39 C
ATOM 5404 NH1 ARG B 358 11.033 30.429 -60.885 1.00174.35 N
ATOM 5405 NH2 ARG B 358 11.783 28.755 -62.263 1.00173.92 N
ATOM 5406 N MET B 359 3.782 32.019 -62.632 1.00173.21 N
ATOM 5407 CA MET B 359 2.637 32.618 -61.958 1.00172.88 C
ATOM 5408 C MET B 359 3.065 33.671 -60.949 1.00173.02 C
ATOM 5409 O MET B 359 3.865 33.393 -60.057 1.00173.08 O
ATOM 5410 CB MET B 359 1.810 31.545 -61.250 1.00172.93 C
ATOM 5411 CG MET B 359 0.829 32.089 -60.226 1.00172.39 C
ATOM 5412 SD MET B 359 0.015 30.783 -59.288 1.00170.21 S
ATOM 5413 CE MET B 359 -1.323 30.344 -60.393 1.00172.89 C
ATOM 5414 N PRO B 360 2.539 34.893 -61.091 1.00173.47 N
ATOM 5415 CA PRO B 360 2.724 35.912 -60.058 1.00174.10 C
ATOM 5416 C PRO B 360 1.929 35.560 -58.805 1.00173.97 C
ATOM 5417 O PRO B 360 0.816 35.046 -58.926 1.00173.62 O
ATOM 5418 CB PRO B 360 2.184 37.185 -60.720 1.00174.25 C
ATOM 5419 CG PRO B 360 2.262 36.906 -62.194 1.00174.02 C
ATOM 5420 CD PRO B 360 1.925 35.454 -62.305 1.00173.84 C
ATOM 5421 N ALA B 361 2.499 35.820 -57.631 1.00174.38 N
ATOM 5422 CA ALA B 361 1.859 35.508 -56.352 1.00173.69 C
ATOM 5423 C ALA B 361 0.427 36.030 -56.260 1.00172.89 C
ATOM 5424 O ALA B 361 -0.421 35.428 -55.601 1.00172.97 O
ATOM 5425 CB ALA B 361 2.690 36.066 -55.206 1.00173.55 C
ATOM 5426 N PHE B 362 0.171 37.154 -56.921 1.00172.02 N
ATOM 5427 CA PHE B 362 -1.150 37.774 -56.937 1.00172.30 C
ATOM 5428 C PHE B 362 -2.251 36.852 -57.451 1.00172.78 C
ATOM 5429 O PHE B 362 -3.381 36.893 -56.964 1.00172.68 O
ATOM 5430 CB PHE B 362 -1.117 39.043 -57.790 1.00172.68 C
ATOM 5431 CG PHE B 362 -1.114 40.309 -56.990 1.00172.62 C
ATOM 5432 CD1 PHE B 362 -1.741 40.366 -55.758 1.00173.12 C
ATOM 5433 CD2 PHE B 362 -0.483 41.444 -57.469 1.00173.29 C
ATOM 5434 CE1 PHE B 362 -1.741 41.532 -55.019 1.00173.62 C
ATOM 5435 CE2 PHE B 362 -0.479 42.611 -56.734 1.00173.94 C
ATOM 5436 CZ PHE B 362 -1.109 42.656 -55.508 1.00173.91 C
ATOM 5437 N PHE B 363 -1.917 36.021 -58.433 1.00173.31 N
ATOM 5438 CA PHE B 363 -2.921 35.226 -59.134 1.00174.03 C
ATOM 5439 C PHE B 363 -3.184 33.875 -58.478 1.00173.91 C
ATOM 5440 O PHE B 363 -2.262 33.090 -58.250 1.00174.03 O
ATOM 5441 CB PHE B 363 -2.503 35.008 -60.590 1.00174.39 C
ATOM 5442 CG PHE B 363 -2.411 36.274 -61.392 1.00174.16 C
ATOM 5443 CD1 PHE B 363 -3.478 36.701 -62.165 1.00173.66 C
ATOM 5444 CD2 PHE B 363 -1.258 37.040 -61.370 1.00173.95 C
ATOM 5445 CE1 PHE B 363 -3.394 37.867 -62.903 1.00173.24 C
ATOM 5446 CE2 PHE B 363 -1.167 38.205 -62.105 1.00173.90 C
ATOM 5447 CZ PHE B 363 -2.237 38.619 -62.872 1.00173.57 C
ATOM 5448 N GLU B 364 -4.452 33.616 -58.175 1.00173.77 N
ATOM 5449 CA GLU B 364 -4.877 32.304 -57.706 1.00173.78 C
ATOM 5450 C GLU B 364 -4.752 31.292 -58.839 1.00173.17 C
ATOM 5451 O GLU B 364 -4.289 30.170 -58.639 1.00173.28 O
ATOM 5452 CB GLU B 364 -6.317 32.347 -57.188 1.00174.43 C
ATOM 5453 CG GLU B 364 -6.487 33.033 -55.839 1.00174.61 C
ATOM 5454 CD GLU B 364 -5.798 32.289 -54.710 1.00173.85 C
ATOM 5455 OE1 GLU B 364 -5.821 31.040 -54.715 1.00173.76 O
ATOM 5456 OE2 GLU B 364 -5.241 32.954 -53.811 1.00173.78 O
ATOM 5457 N SER B 365 -5.166 31.707 -60.032 1.00172.78 N
ATOM 5458 CA SER B 365 -5.057 30.877 -61.226 1.00173.02 C
ATOM 5459 C SER B 365 -4.388 31.658 -62.350 1.00172.90 C
ATOM 5460 O SER B 365 -4.568 32.870 -62.466 1.00172.97 O
ATOM 5461 CB SER B 365 -6.435 30.384 -61.670 1.00173.44 C
ATOM 5462 OG SER B 365 -7.239 31.462 -62.117 1.00173.97 O
ATOM 5463 N PHE B 366 -3.618 30.959 -63.177 1.00172.88 N
ATOM 5464 CA PHE B 366 -2.853 31.610 -64.234 1.00173.14 C
ATOM 5465 C PHE B 366 -2.859 30.757 -65.498 1.00173.18 C
ATOM 5466 O PHE B 366 -2.781 29.533 -65.420 1.00173.46 O
ATOM 5467 CB PHE B 366 -1.419 31.865 -63.761 1.00174.06 C
ATOM 5468 CG PHE B 366 -0.673 32.879 -64.582 1.00173.81 C
ATOM 5469 CD1 PHE B 366 -0.941 34.231 -64.445 1.00173.44 C
ATOM 5470 CD2 PHE B 366 0.304 32.482 -65.479 1.00174.12 C
ATOM 5471 CE1 PHE B 366 -0.255 35.168 -65.193 1.00172.25 C
ATOM 5472 CE2 PHE B 366 0.993 33.416 -66.230 1.00174.17 C
ATOM 5473 CZ PHE B 366 0.713 34.760 -66.086 1.00172.93 C
ATOM 5474 N PRO B 367 -2.954 31.403 -66.670 1.00173.16 N
ATOM 5475 CA PRO B 367 -2.993 30.687 -67.949 1.00173.28 C
ATOM 5476 C PRO B 367 -1.625 30.163 -68.380 1.00173.23 C
ATOM 5477 O PRO B 367 -0.596 30.711 -67.984 1.00173.60 O
ATOM 5478 CB PRO B 367 -3.497 31.755 -68.919 1.00173.20 C
ATOM 5479 CG PRO B 367 -2.990 33.029 -68.338 1.00173.42 C
ATOM 5480 CD PRO B 367 -3.157 32.851 -66.855 1.00172.81 C
ATOM 5481 N VAL B 368 -1.623 29.111 -69.192 1.00172.76 N
ATOM 5482 CA VAL B 368 -0.383 28.515 -69.673 1.00173.00 C
ATOM 5483 C VAL B 368 0.048 29.154 -70.988 1.00173.72 C
ATOM 5484 O VAL B 368 -0.615 28.993 -72.012 1.00174.66 O
ATOM 5485 CB VAL B 368 -0.528 26.994 -69.874 1.00173.76 C
ATOM 5486 CG1 VAL B 368 0.764 26.408 -70.412 1.00174.74 C
ATOM 5487 CG2 VAL B 368 -0.915 26.320 -68.569 1.00173.48 C
ATOM 5488 N ILE B 369 1.155 29.890 -70.954 1.00172.88 N
ATOM 5489 CA ILE B 369 1.655 30.566 -72.147 1.00173.50 C
ATOM 5490 C ILE B 369 3.140 30.284 -72.366 1.00173.79 C
ATOM 5491 O ILE B 369 3.938 30.341 -71.429 1.00172.95 O
ATOM 5492 CB ILE B 369 1.428 32.090 -72.060 1.00172.90 C
ATOM 5493 CG1 ILE B 369 -0.067 32.396 -71.950 1.00173.19 C
ATOM 5494 CG2 ILE B 369 2.021 32.798 -73.268 1.00173.35 C
ATOM 5495 CD1 ILE B 369 -0.387 33.866 -71.929 1.00173.50 C
ATOM 5496 N LEU B 370 3.501 29.976 -73.608 1.00174.68 N
ATOM 5497 CA LEU B 370 4.881 29.655 -73.954 1.00174.74 C
ATOM 5498 C LEU B 370 5.474 30.689 -74.907 1.00174.70 C
ATOM 5499 O LEU B 370 4.883 31.007 -75.940 1.00174.89 O
ATOM 5500 CB LEU B 370 4.966 28.264 -74.586 1.00174.63 C
ATOM 5501 CG LEU B 370 4.434 27.087 -73.768 1.00173.42 C
ATOM 5502 CD1 LEU B 370 4.847 25.768 -74.402 1.00173.80 C
ATOM 5503 CD2 LEU B 370 4.917 27.170 -72.334 1.00172.97 C
ATOM 5504 N THR B 371 6.644 31.212 -74.553 1.00173.86 N
ATOM 5505 CA THR B 371 7.344 32.168 -75.402 1.00173.21 C
ATOM 5506 C THR B 371 8.794 31.749 -75.615 1.00173.34 C
ATOM 5507 O THR B 371 9.332 30.937 -74.861 1.00173.33 O
ATOM 5508 CB THR B 371 7.316 33.588 -74.805 1.00172.86 C
ATOM 5509 OG1 THR B 371 7.984 33.589 -73.537 1.00173.00 O
ATOM 5510 CG2 THR B 371 5.884 34.067 -74.618 1.00173.07 C
ATOM 5511 N ASP B 372 9.425 32.306 -76.643 1.00173.47 N
ATOM 5512 CA ASP B 372 10.835 32.043 -76.901 1.00173.62 C
ATOM 5513 C ASP B 372 11.714 32.981 -76.079 1.00173.45 C
ATOM 5514 O ASP B 372 11.242 33.613 -75.134 1.00173.24 O
ATOM 5515 CB ASP B 372 11.151 32.177 -78.396 1.00174.12 C
ATOM 5516 CG ASP B 372 10.672 33.494 -78.986 1.00174.15 C
ATOM 5517 OD1 ASP B 372 10.346 34.422 -78.217 1.00174.18 O
ATOM 5518 OD2 ASP B 372 10.632 33.602 -80.231 1.00173.64 O
ATOM 5519 N LYS B 373 12.992 33.063 -76.439 1.00173.70 N
ATOM 5520 CA LYS B 373 13.926 33.949 -75.752 1.00173.84 C
ATOM 5521 C LYS B 373 13.496 35.412 -75.865 1.00173.96 C
ATOM 5522 O LYS B 373 13.591 36.172 -74.901 1.00174.49 O
ATOM 5523 CB LYS B 373 15.344 33.769 -76.304 1.00173.89 C
ATOM 5524 CG LYS B 373 15.443 33.812 -77.822 1.00174.08 C
ATOM 5525 CD LYS B 373 16.878 34.028 -78.277 1.00173.67 C
ATOM 5526 CE LYS B 373 17.786 32.912 -77.787 1.00173.20 C
ATOM 5527 NZ LYS B 373 19.223 33.216 -78.029 1.00172.67 N
ATOM 5528 N ASN B 374 13.017 35.800 -77.042 1.00173.74 N
ATOM 5529 CA ASN B 374 12.608 37.180 -77.283 1.00173.13 C
ATOM 5530 C ASN B 374 11.237 37.511 -76.692 1.00172.76 C
ATOM 5531 O ASN B 374 10.758 38.636 -76.816 1.00172.53 O
ATOM 5532 CB ASN B 374 12.609 37.470 -78.785 1.00173.72 C
ATOM 5533 CG ASN B 374 13.885 37.015 -79.465 1.00173.63 C
ATOM 5534 OD1 ASN B 374 14.987 37.292 -78.991 1.00173.29 O
ATOM 5535 ND2 ASN B 374 13.742 36.310 -80.582 1.00173.12 N
ATOM 5536 N GLY B 375 10.613 36.530 -76.049 1.00172.89 N
ATOM 5537 CA GLY B 375 9.325 36.739 -75.414 1.00173.32 C
ATOM 5538 C GLY B 375 8.152 36.696 -76.376 1.00173.75 C
ATOM 5539 O GLY B 375 7.045 37.113 -76.036 1.00174.35 O
ATOM 5540 N VAL B 376 8.392 36.192 -77.581 1.00173.61 N
ATOM 5541 CA VAL B 376 7.335 36.061 -78.578 1.00173.37 C
ATOM 5542 C VAL B 376 6.491 34.820 -78.313 1.00173.18 C
ATOM 5543 O VAL B 376 7.022 33.718 -78.187 1.00173.67 O
ATOM 5544 CB VAL B 376 7.908 35.985 -80.006 1.00173.82 C
ATOM 5545 CG1 VAL B 376 6.782 35.938 -81.028 1.00173.96 C
ATOM 5546 CG2 VAL B 376 8.828 37.166 -80.272 1.00174.36 C
ATOM 5547 N VAL B 377 5.178 35.006 -78.224 1.00172.31 N
ATOM 5548 CA VAL B 377 4.262 33.900 -77.963 1.00172.73 C
ATOM 5549 C VAL B 377 4.278 32.875 -79.091 1.00173.54 C
ATOM 5550 O VAL B 377 3.929 33.186 -80.230 1.00173.75 O
ATOM 5551 CB VAL B 377 2.823 34.397 -77.766 1.00172.75 C
ATOM 5552 CG1 VAL B 377 1.876 33.220 -77.594 1.00173.43 C
ATOM 5553 CG2 VAL B 377 2.749 35.327 -76.568 1.00173.73 C
ATOM 5554 N LYS B 378 4.681 31.650 -78.764 1.00173.84 N
ATOM 5555 CA LYS B 378 4.775 30.584 -79.754 1.00174.09 C
ATOM 5556 C LYS B 378 3.725 29.501 -79.525 1.00173.52 C
ATOM 5557 O LYS B 378 3.237 28.889 -80.475 1.00174.39 O
ATOM 5558 CB LYS B 378 6.176 29.964 -79.739 1.00174.51 C
ATOM 5559 CG LYS B 378 7.317 30.953 -79.969 1.00174.66 C
ATOM 5560 CD LYS B 378 7.835 30.924 -81.408 1.00173.42 C
ATOM 5561 CE LYS B 378 6.886 31.602 -82.384 1.00172.10 C
ATOM 5562 NZ LYS B 378 7.449 31.639 -83.762 1.00171.68 N
ATOM 5563 N ALA B 379 3.380 29.267 -78.262 1.00172.61 N
ATOM 5564 CA ALA B 379 2.399 28.241 -77.923 1.00173.12 C
ATOM 5565 C ALA B 379 1.661 28.560 -76.627 1.00173.69 C
ATOM 5566 O ALA B 379 2.142 29.338 -75.803 1.00174.06 O
ATOM 5567 CB ALA B 379 3.073 26.884 -77.821 1.00173.69 C
ATOM 5568 N ASP B 380 0.492 27.947 -76.459 1.00173.93 N
ATOM 5569 CA ASP B 380 -0.318 28.127 -75.259 1.00173.89 C
ATOM 5570 C ASP B 380 -1.433 27.085 -75.164 1.00173.81 C
ATOM 5571 O ASP B 380 -1.594 26.247 -76.053 1.00174.17 O
ATOM 5572 CB ASP B 380 -0.912 29.545 -75.214 1.00173.94 C
ATOM 5573 CG ASP B 380 -1.807 29.860 -76.409 1.00174.49 C
ATOM 5574 OD1 ASP B 380 -2.677 29.037 -76.764 1.00174.27 O
ATOM 5575 OD2 ASP B 380 -1.644 30.951 -76.994 1.00175.44 O
ATOM 5576 N ILE B 381 -2.201 27.148 -74.081 1.00173.26 N
ATOM 5577 CA ILE B 381 -3.384 26.310 -73.931 1.00172.86 C
ATOM 5578 C ILE B 381 -4.630 27.182 -74.040 1.00172.61 C
ATOM 5579 O ILE B 381 -4.979 27.895 -73.100 1.00173.17 O
ATOM 5580 CB ILE B 381 -3.385 25.554 -72.592 1.00173.16 C
ATOM 5581 CG1 ILE B 381 -2.127 24.692 -72.469 1.00173.58 C
ATOM 5582 CG2 ILE B 381 -4.629 24.688 -72.474 1.00173.77 C
ATOM 5583 CD1 ILE B 381 -2.090 23.841 -71.220 1.00173.65 C
ATOM 5584 N PRO B 382 -5.301 27.128 -75.199 1.00172.97 N
ATOM 5585 CA PRO B 382 -6.421 28.009 -75.544 1.00173.07 C
ATOM 5586 C PRO B 382 -7.671 27.783 -74.702 1.00172.50 C
ATOM 5587 O PRO B 382 -7.922 26.668 -74.245 1.00172.20 O
ATOM 5588 CB PRO B 382 -6.694 27.654 -77.006 1.00174.46 C
ATOM 5589 CG PRO B 382 -6.275 26.229 -77.110 1.00175.27 C
ATOM 5590 CD PRO B 382 -5.034 26.152 -76.269 1.00174.65 C
ATOM 5591 N PHE B 383 -8.446 28.846 -74.513 1.00172.64 N
ATOM 5592 CA PHE B 383 -9.747 28.753 -73.866 1.00173.33 C
ATOM 5593 C PHE B 383 -10.773 28.382 -74.930 1.00173.64 C
ATOM 5594 O PHE B 383 -11.342 27.294 -74.904 1.00174.26 O
ATOM 5595 CB PHE B 383 -10.113 30.074 -73.183 1.00173.38 C
ATOM 5596 CG PHE B 383 -11.181 29.945 -72.130 1.00173.48 C
ATOM 5597 CD1 PHE B 383 -10.850 29.594 -70.831 1.00173.46 C
ATOM 5598 CD2 PHE B 383 -12.510 30.193 -72.433 1.00173.28 C
ATOM 5599 CE1 PHE B 383 -11.824 29.482 -69.857 1.00172.89 C
ATOM 5600 CE2 PHE B 383 -13.489 30.083 -71.462 1.00172.64 C
ATOM 5601 CZ PHE B 383 -13.145 29.729 -70.172 1.00172.76 C
ATOM 5602 N ARG B 384 -10.989 29.292 -75.876 1.00173.49 N
ATOM 5603 CA ARG B 384 -11.817 29.008 -77.042 1.00173.75 C
ATOM 5604 C ARG B 384 -10.996 28.314 -78.125 1.00174.13 C
ATOM 5605 O ARG B 384 -10.069 28.903 -78.682 1.00174.79 O
ATOM 5606 CB ARG B 384 -12.429 30.295 -77.601 1.00173.00 C
ATOM 5607 CG ARG B 384 -13.543 30.891 -76.761 1.00172.19 C
ATOM 5608 CD ARG B 384 -14.155 32.091 -77.465 1.00171.87 C
ATOM 5609 NE ARG B 384 -15.257 32.677 -76.709 1.00172.79 N
ATOM 5610 CZ ARG B 384 -15.972 33.719 -77.120 1.00173.41 C
ATOM 5611 NH1 ARG B 384 -15.700 34.293 -78.284 1.00172.54 N
ATOM 5612 NH2 ARG B 384 -16.958 34.189 -76.368 1.00173.82 N
ATOM 5613 N ARG B 385 -11.335 27.064 -78.423 1.00173.51 N
ATOM 5614 CA ARG B 385 -10.607 26.295 -79.431 1.00173.69 C
ATOM 5615 C ARG B 385 -10.976 26.716 -80.851 1.00173.30 C
ATOM 5616 O ARG B 385 -10.211 26.485 -81.788 1.00173.78 O
ATOM 5617 CB ARG B 385 -10.858 24.793 -79.263 1.00173.76 C
ATOM 5618 CG ARG B 385 -10.074 24.123 -78.142 1.00174.10 C
ATOM 5619 CD ARG B 385 -10.648 24.429 -76.770 1.00173.54 C
ATOM 5620 NE ARG B 385 -10.311 23.384 -75.808 1.00174.35 N
ATOM 5621 CZ ARG B 385 -10.531 23.470 -74.501 1.00174.95 C
ATOM 5622 NH1 ARG B 385 -11.088 24.559 -73.992 1.00175.37 N
ATOM 5623 NH2 ARG B 385 -10.193 22.467 -73.703 1.00175.19 N
ATOM 5624 N ALA B 386 -12.159 27.309 -80.993 1.00172.66 N
ATOM 5625 CA ALA B 386 -12.710 27.720 -82.286 1.00173.52 C
ATOM 5626 C ALA B 386 -11.697 28.374 -83.231 1.00173.34 C
ATOM 5627 O ALA B 386 -11.686 28.091 -84.429 1.00173.24 O
ATOM 5628 CB ALA B 386 -13.885 28.662 -82.061 1.00173.94 C
ATOM 5629 N GLU B 387 -10.849 29.244 -82.692 1.00172.79 N
ATOM 5630 CA GLU B 387 -9.864 29.949 -83.510 1.00172.42 C
ATOM 5631 C GLU B 387 -8.481 29.939 -82.864 1.00172.75 C
ATOM 5632 O GLU B 387 -7.753 30.929 -82.928 1.00173.11 O
ATOM 5633 CB GLU B 387 -10.306 31.396 -83.761 1.00172.34 C
ATOM 5634 CG GLU B 387 -11.722 31.547 -84.308 1.00172.59 C
ATOM 5635 CD GLU B 387 -12.161 32.999 -84.412 1.00172.54 C
ATOM 5636 OE1 GLU B 387 -11.723 33.820 -83.578 1.00171.19 O
ATOM 5637 OE2 GLU B 387 -12.949 33.318 -85.327 1.00173.06 O
ATOM 5638 N SER B 388 -8.125 28.821 -82.239 1.00172.69 N
ATOM 5639 CA SER B 388 -6.834 28.695 -81.570 1.00172.40 C
ATOM 5640 C SER B 388 -5.697 28.610 -82.580 1.00172.42 C
ATOM 5641 O SER B 388 -5.763 27.841 -83.537 1.00173.33 O
ATOM 5642 CB SER B 388 -6.814 27.465 -80.663 1.00172.70 C
ATOM 5643 OG SER B 388 -6.980 26.277 -81.417 1.00172.00 O
ATOM 5644 N LYS B 389 -4.654 29.403 -82.362 1.00172.17 N
ATOM 5645 CA LYS B 389 -3.512 29.423 -83.267 1.00172.61 C
ATOM 5646 C LYS B 389 -2.260 28.838 -82.627 1.00173.07 C
ATOM 5647 O LYS B 389 -1.330 28.436 -83.325 1.00173.43 O
ATOM 5648 CB LYS B 389 -3.227 30.851 -83.737 1.00173.10 C
ATOM 5649 CG LYS B 389 -4.349 31.479 -84.543 1.00173.55 C
ATOM 5650 CD LYS B 389 -4.058 32.943 -84.839 1.00174.16 C
ATOM 5651 CE LYS B 389 -5.238 33.617 -85.521 1.00174.51 C
ATOM 5652 NZ LYS B 389 -5.049 35.090 -85.635 1.00174.42 N
ATOM 5653 N TYR B 390 -2.239 28.790 -81.298 1.00173.03 N
ATOM 5654 CA TYR B 390 -1.040 28.381 -80.574 1.00173.37 C
ATOM 5655 C TYR B 390 -1.238 27.145 -79.697 1.00173.68 C
ATOM 5656 O TYR B 390 -0.470 26.925 -78.760 1.00173.94 O
ATOM 5657 CB TYR B 390 -0.533 29.535 -79.705 1.00173.36 C
ATOM 5658 CG TYR B 390 -0.359 30.844 -80.443 1.00173.43 C
ATOM 5659 CD1 TYR B 390 0.801 31.112 -81.157 1.00173.74 C
ATOM 5660 CD2 TYR B 390 -1.352 31.814 -80.420 1.00173.68 C
ATOM 5661 CE1 TYR B 390 0.966 32.309 -81.831 1.00173.61 C
ATOM 5662 CE2 TYR B 390 -1.197 33.013 -81.090 1.00173.01 C
ATOM 5663 CZ TYR B 390 -0.036 33.254 -81.794 1.00172.83 C
ATOM 5664 OH TYR B 390 0.124 34.446 -82.463 1.00172.35 O
ATOM 5665 N SER B 391 -2.265 26.351 -79.985 1.00173.47 N
ATOM 5666 CA SER B 391 -2.504 25.129 -79.221 1.00173.06 C
ATOM 5667 C SER B 391 -1.314 24.182 -79.347 1.00172.75 C
ATOM 5668 O SER B 391 -0.673 24.120 -80.396 1.00173.40 O
ATOM 5669 CB SER B 391 -3.787 24.435 -79.685 1.00173.04 C
ATOM 5670 OG SER B 391 -3.678 24.004 -81.028 1.00173.23 O
ATOM 5671 N PHE B 392 -1.028 23.451 -78.273 1.00172.08 N
ATOM 5672 CA PHE B 392 0.102 22.523 -78.225 1.00173.10 C
ATOM 5673 C PHE B 392 0.109 21.532 -79.387 1.00173.57 C
ATOM 5674 O PHE B 392 1.170 21.111 -79.850 1.00173.73 O
ATOM 5675 CB PHE B 392 0.100 21.758 -76.900 1.00173.87 C
ATOM 5676 CG PHE B 392 0.751 22.503 -75.768 1.00173.79 C
ATOM 5677 CD1 PHE B 392 0.424 23.823 -75.507 1.00173.58 C
ATOM 5678 CD2 PHE B 392 1.690 21.879 -74.962 1.00173.71 C
ATOM 5679 CE1 PHE B 392 1.023 24.507 -74.468 1.00173.52 C
ATOM 5680 CE2 PHE B 392 2.290 22.557 -73.922 1.00173.54 C
ATOM 5681 CZ PHE B 392 1.956 23.872 -73.674 1.00173.66 C
ATOM 5682 N GLU B 393 -1.080 21.168 -79.855 1.00173.72 N
ATOM 5683 CA GLU B 393 -1.218 20.240 -80.970 1.00173.75 C
ATOM 5684 C GLU B 393 -0.711 20.853 -82.272 1.00173.21 C
ATOM 5685 O GLU B 393 0.071 20.235 -82.994 1.00173.17 O
ATOM 5686 CB GLU B 393 -2.678 19.803 -81.123 1.00173.93 C
ATOM 5687 CG GLU B 393 -3.206 18.963 -79.966 1.00174.55 C
ATOM 5688 CD GLU B 393 -3.529 19.789 -78.733 1.00173.94 C
ATOM 5689 OE1 GLU B 393 -3.608 21.030 -78.850 1.00173.54 O
ATOM 5690 OE2 GLU B 393 -3.702 19.198 -77.646 1.00173.88 O
ATOM 5691 N GLN B 394 -1.159 22.070 -82.565 1.00173.02 N
ATOM 5692 CA GLN B 394 -0.754 22.770 -83.781 1.00173.22 C
ATOM 5693 C GLN B 394 0.741 23.078 -83.826 1.00173.12 C
ATOM 5694 O GLN B 394 1.309 23.262 -84.901 1.00173.89 O
ATOM 5695 CB GLN B 394 -1.541 24.073 -83.929 1.00173.43 C
ATOM 5696 CG GLN B 394 -3.034 23.887 -84.105 1.00173.90 C
ATOM 5697 CD GLN B 394 -3.799 25.188 -83.966 1.00174.19 C
ATOM 5698 OE1 GLN B 394 -3.820 25.800 -82.897 1.00174.14 O
ATOM 5699 NE2 GLN B 394 -4.427 25.623 -85.052 1.00174.17 N
ATOM 5700 N GLN B 395 1.374 23.139 -82.660 1.00172.42 N
ATOM 5701 CA GLN B 395 2.768 23.557 -82.584 1.00172.31 C
ATOM 5702 C GLN B 395 3.710 22.387 -82.336 1.00172.82 C
ATOM 5703 O GLN B 395 4.931 22.547 -82.373 1.00172.53 O
ATOM 5704 CB GLN B 395 2.946 24.609 -81.491 1.00172.46 C
ATOM 5705 CG GLN B 395 2.126 25.866 -81.721 1.00172.97 C
ATOM 5706 CD GLN B 395 2.436 26.522 -83.051 1.00172.48 C
ATOM 5707 OE1 GLN B 395 3.598 26.647 -83.439 1.00172.25 O
ATOM 5708 NE2 GLN B 395 1.395 26.945 -83.759 1.00172.92 N
ATOM 5709 N GLY B 396 3.141 21.213 -82.081 1.00173.34 N
ATOM 5710 CA GLY B 396 3.933 20.017 -81.859 1.00174.04 C
ATOM 5711 C GLY B 396 4.832 20.144 -80.646 1.00174.02 C
ATOM 5712 O GLY B 396 5.956 19.644 -80.640 1.00174.51 O
ATOM 5713 N VAL B 397 4.334 20.831 -79.622 1.00173.25 N
ATOM 5714 CA VAL B 397 5.092 21.061 -78.400 1.00172.86 C
ATOM 5715 C VAL B 397 5.493 19.758 -77.713 1.00172.88 C
ATOM 5716 O VAL B 397 4.676 18.851 -77.553 1.00172.57 O
ATOM 5717 CB VAL B 397 4.292 21.921 -77.409 1.00173.28 C
ATOM 5718 CG1 VAL B 397 5.143 22.276 -76.201 1.00174.11 C
ATOM 5719 CG2 VAL B 397 3.791 23.180 -78.096 1.00174.04 C
ATOM 5720 N THR B 398 6.757 19.676 -77.311 1.00172.96 N
ATOM 5721 CA THR B 398 7.276 18.516 -76.596 1.00173.25 C
ATOM 5722 C THR B 398 8.009 18.961 -75.339 1.00172.90 C
ATOM 5723 O THR B 398 8.378 20.128 -75.208 1.00172.54 O
ATOM 5724 CB THR B 398 8.236 17.682 -77.468 1.00174.26 C
ATOM 5725 OG1 THR B 398 9.432 18.432 -77.718 1.00174.33 O
ATOM 5726 CG2 THR B 398 7.585 17.319 -78.796 1.00174.79 C
ATOM 5727 N VAL B 399 8.219 18.030 -74.416 1.00172.82 N
ATOM 5728 CA VAL B 399 8.910 18.342 -73.173 1.00172.55 C
ATOM 5729 C VAL B 399 9.965 17.289 -72.841 1.00173.04 C
ATOM 5730 O VAL B 399 9.725 16.086 -72.955 1.00172.86 O
ATOM 5731 CB VAL B 399 7.911 18.478 -71.999 1.00172.75 C
ATOM 5732 CG1 VAL B 399 7.053 17.225 -71.866 1.00173.43 C
ATOM 5733 CG2 VAL B 399 8.642 18.786 -70.700 1.00173.43 C
ATOM 5734 N SER B 400 11.143 17.758 -72.446 1.00173.52 N
ATOM 5735 CA SER B 400 12.236 16.878 -72.058 1.00173.95 C
ATOM 5736 C SER B 400 12.747 17.256 -70.674 1.00173.69 C
ATOM 5737 O SER B 400 12.734 18.428 -70.298 1.00173.44 O
ATOM 5738 CB SER B 400 13.372 16.943 -73.082 1.00174.84 C
ATOM 5739 OG SER B 400 12.952 16.454 -74.343 1.00174.92 O
ATOM 5740 N PHE B 401 13.195 16.261 -69.916 1.00173.84 N
ATOM 5741 CA PHE B 401 13.678 16.503 -68.562 1.00174.31 C
ATOM 5742 C PHE B 401 15.166 16.195 -68.433 1.00174.24 C
ATOM 5743 O PHE B 401 15.696 15.331 -69.131 1.00174.26 O
ATOM 5744 CB PHE B 401 12.883 15.676 -67.551 1.00174.30 C
ATOM 5745 CG PHE B 401 11.470 16.147 -67.357 1.00174.24 C
ATOM 5746 CD1 PHE B 401 11.145 16.984 -66.302 1.00174.23 C
ATOM 5747 CD2 PHE B 401 10.468 15.758 -68.230 1.00174.57 C
ATOM 5748 CE1 PHE B 401 9.847 17.421 -66.120 1.00174.18 C
ATOM 5749 CE2 PHE B 401 9.167 16.192 -68.054 1.00174.33 C
ATOM 5750 CZ PHE B 401 8.857 17.026 -66.998 1.00173.92 C
ATOM 5751 N TYR B 402 15.830 16.909 -67.529 1.00174.14 N
ATOM 5752 CA TYR B 402 17.263 16.753 -67.319 1.00174.60 C
ATOM 5753 C TYR B 402 17.584 16.753 -65.827 1.00173.95 C
ATOM 5754 O TYR B 402 17.333 17.737 -65.131 1.00173.47 O
ATOM 5755 CB TYR B 402 18.035 17.868 -68.032 1.00174.62 C
ATOM 5756 CG TYR B 402 17.782 17.937 -69.523 1.00174.36 C
ATOM 5757 CD1 TYR B 402 18.487 17.128 -70.406 1.00174.22 C
ATOM 5758 CD2 TYR B 402 16.835 18.807 -70.047 1.00174.13 C
ATOM 5759 CE1 TYR B 402 18.258 17.188 -71.770 1.00174.14 C
ATOM 5760 CE2 TYR B 402 16.598 18.872 -71.408 1.00174.17 C
ATOM 5761 CZ TYR B 402 17.311 18.061 -72.265 1.00173.88 C
ATOM 5762 OH TYR B 402 17.076 18.128 -73.621 1.00172.39 O
ATOM 5763 N GLY B 403 18.135 15.644 -65.342 1.00173.91 N
ATOM 5764 CA GLY B 403 18.422 15.487 -63.927 1.00173.60 C
ATOM 5765 C GLY B 403 17.155 15.248 -63.130 1.00173.42 C
ATOM 5766 O GLY B 403 16.123 15.848 -63.409 1.00173.16 O
ATOM 5767 N GLY B 404 17.220 14.361 -62.143 1.00173.41 N
ATOM 5768 CA GLY B 404 16.062 14.081 -61.315 1.00173.19 C
ATOM 5769 C GLY B 404 15.341 12.806 -61.704 1.00172.89 C
ATOM 5770 O GLY B 404 15.899 11.955 -62.397 1.00174.01 O
ATOM 5771 N GLU B 405 14.101 12.674 -61.240 1.00172.12 N
ATOM 5772 CA GLU B 405 13.268 11.512 -61.540 1.00173.01 C
ATOM 5773 C GLU B 405 13.116 11.259 -63.040 1.00173.92 C
ATOM 5774 O GLU B 405 13.439 10.177 -63.530 1.00174.32 O
ATOM 5775 CB GLU B 405 11.884 11.676 -60.904 1.00172.84 C
ATOM 5776 CG GLU B 405 11.868 11.551 -59.387 1.00173.50 C
ATOM 5777 CD GLU B 405 12.252 10.163 -58.909 1.00173.69 C
ATOM 5778 OE1 GLU B 405 13.447 9.939 -58.621 1.00173.84 O
ATOM 5779 OE2 GLU B 405 11.356 9.297 -58.815 1.00173.02 O
ATOM 5780 N LEU B 406 12.625 12.261 -63.762 1.00174.26 N
ATOM 5781 CA LEU B 406 12.316 12.114 -65.182 1.00174.20 C
ATOM 5782 C LEU B 406 13.516 12.366 -66.095 1.00174.54 C
ATOM 5783 O LEU B 406 13.348 12.564 -67.299 1.00174.67 O
ATOM 5784 CB LEU B 406 11.175 13.056 -65.568 1.00173.48 C
ATOM 5785 CG LEU B 406 9.876 12.905 -64.775 1.00173.58 C
ATOM 5786 CD1 LEU B 406 8.839 13.904 -65.254 1.00173.29 C
ATOM 5787 CD2 LEU B 406 9.345 11.484 -64.883 1.00173.56 C
ATOM 5788 N ASN B 407 14.716 12.361 -65.521 1.00174.43 N
ATOM 5789 CA ASN B 407 15.945 12.637 -66.264 1.00173.72 C
ATOM 5790 C ASN B 407 16.119 11.801 -67.531 1.00173.64 C
ATOM 5791 O ASN B 407 15.987 10.578 -67.502 1.00173.70 O
ATOM 5792 CB ASN B 407 17.159 12.424 -65.361 1.00173.26 C
ATOM 5793 CG ASN B 407 18.466 12.471 -66.126 1.00172.30 C
ATOM 5794 OD1 ASN B 407 18.861 13.520 -66.631 1.00172.24 O
ATOM 5795 ND2 ASN B 407 19.144 11.333 -66.215 1.00172.02 N
ATOM 5796 N GLY B 408 16.423 12.471 -68.639 1.00173.66 N
ATOM 5797 CA GLY B 408 16.681 11.799 -69.900 1.00173.60 C
ATOM 5798 C GLY B 408 15.440 11.390 -70.670 1.00172.38 C
ATOM 5799 O GLY B 408 15.535 10.894 -71.792 1.00171.93 O
ATOM 5800 N GLN B 409 14.273 11.599 -70.073 1.00172.40 N
ATOM 5801 CA GLN B 409 13.023 11.191 -70.700 1.00172.38 C
ATOM 5802 C GLN B 409 12.393 12.327 -71.496 1.00172.25 C
ATOM 5803 O GLN B 409 12.660 13.502 -71.245 1.00172.14 O
ATOM 5804 CB GLN B 409 12.038 10.681 -69.648 1.00173.38 C
ATOM 5805 CG GLN B 409 12.536 9.481 -68.864 1.00174.29 C
ATOM 5806 CD GLN B 409 11.580 9.069 -67.763 1.00174.70 C
ATOM 5807 OE1 GLN B 409 10.380 8.923 -67.992 1.00174.49 O
ATOM 5808 NE2 GLN B 409 12.109 8.879 -66.558 1.00174.81 N
ATOM 5809 N THR B 410 11.558 11.959 -72.461 1.00173.25 N
ATOM 5810 CA THR B 410 10.871 12.926 -73.306 1.00173.54 C
ATOM 5811 C THR B 410 9.404 12.531 -73.471 1.00173.86 C
ATOM 5812 O THR B 410 9.078 11.346 -73.539 1.00175.08 O
ATOM 5813 CB THR B 410 11.542 13.033 -74.692 1.00173.72 C
ATOM 5814 OG1 THR B 410 12.952 13.232 -74.529 1.00173.68 O
ATOM 5815 CG2 THR B 410 10.961 14.189 -75.492 1.00173.33 C
ATOM 5816 N PHE B 411 8.522 13.522 -73.527 1.00173.17 N
ATOM 5817 CA PHE B 411 7.095 13.268 -73.690 1.00173.01 C
ATOM 5818 C PHE B 411 6.542 14.099 -74.840 1.00172.92 C
ATOM 5819 O PHE B 411 6.823 15.294 -74.941 1.00173.25 O
ATOM 5820 CB PHE B 411 6.344 13.575 -72.395 1.00172.69 C
ATOM 5821 CG PHE B 411 6.843 12.800 -71.211 1.00172.34 C
ATOM 5822 CD1 PHE B 411 6.433 11.495 -71.000 1.00172.32 C
ATOM 5823 CD2 PHE B 411 7.730 13.372 -70.316 1.00173.26 C
ATOM 5824 CE1 PHE B 411 6.892 10.777 -69.913 1.00172.09 C
ATOM 5825 CE2 PHE B 411 8.193 12.660 -69.228 1.00174.03 C
ATOM 5826 CZ PHE B 411 7.773 11.360 -69.026 1.00173.22 C
ATOM 5827 N THR B 412 5.760 13.465 -75.709 1.00172.36 N
ATOM 5828 CA THR B 412 5.296 14.124 -76.926 1.00172.92 C
ATOM 5829 C THR B 412 3.778 14.134 -77.079 1.00172.82 C
ATOM 5830 O THR B 412 3.245 14.872 -77.907 1.00172.74 O
ATOM 5831 CB THR B 412 5.900 13.461 -78.178 1.00174.61 C
ATOM 5832 OG1 THR B 412 5.475 12.095 -78.248 1.00175.47 O
ATOM 5833 CG2 THR B 412 7.420 13.511 -78.133 1.00175.43 C
ATOM 5834 N ASP B 413 3.082 13.328 -76.285 1.00173.25 N
ATOM 5835 CA ASP B 413 1.624 13.313 -76.341 1.00173.62 C
ATOM 5836 C ASP B 413 1.048 14.535 -75.627 1.00173.80 C
ATOM 5837 O ASP B 413 1.273 14.722 -74.430 1.00174.09 O
ATOM 5838 CB ASP B 413 1.066 12.012 -75.747 1.00173.85 C
ATOM 5839 CG ASP B 413 1.404 11.841 -74.279 1.00173.66 C
ATOM 5840 OD1 ASP B 413 2.605 11.866 -73.938 1.00173.67 O
ATOM 5841 OD2 ASP B 413 0.467 11.684 -73.467 1.00173.02 O
ATOM 5842 N PRO B 414 0.318 15.382 -76.377 1.00173.32 N
ATOM 5843 CA PRO B 414 -0.265 16.656 -75.932 1.00173.23 C
ATOM 5844 C PRO B 414 -0.829 16.667 -74.500 1.00173.12 C
ATOM 5845 O PRO B 414 -0.517 17.612 -73.778 1.00173.52 O
ATOM 5846 CB PRO B 414 -1.372 16.904 -76.961 1.00172.46 C
ATOM 5847 CG PRO B 414 -0.848 16.288 -78.199 1.00173.78 C
ATOM 5848 CD PRO B 414 -0.034 15.085 -77.777 1.00173.53 C
ATOM 5849 N PRO B 415 -1.646 15.669 -74.100 1.00172.30 N
ATOM 5850 CA PRO B 415 -2.117 15.707 -72.712 1.00172.64 C
ATOM 5851 C PRO B 415 -0.986 15.752 -71.688 1.00172.71 C
ATOM 5852 O PRO B 415 -0.996 16.601 -70.797 1.00172.87 O
ATOM 5853 CB PRO B 415 -2.903 14.401 -72.583 1.00173.06 C
ATOM 5854 CG PRO B 415 -3.386 14.136 -73.954 1.00173.16 C
ATOM 5855 CD PRO B 415 -2.220 14.512 -74.814 1.00172.81 C
ATOM 5856 N THR B 416 -0.028 14.843 -71.826 1.00172.25 N
ATOM 5857 CA THR B 416 1.092 14.755 -70.897 1.00172.72 C
ATOM 5858 C THR B 416 1.942 16.022 -70.934 1.00173.05 C
ATOM 5859 O THR B 416 2.353 16.534 -69.892 1.00173.66 O
ATOM 5860 CB THR B 416 1.982 13.533 -71.211 1.00173.11 C
ATOM 5861 OG1 THR B 416 1.248 12.325 -70.974 1.00172.90 O
ATOM 5862 CG2 THR B 416 3.240 13.537 -70.354 1.00173.78 C
ATOM 5863 N VAL B 417 2.195 16.527 -72.138 1.00173.37 N
ATOM 5864 CA VAL B 417 2.988 17.739 -72.315 1.00173.75 C
ATOM 5865 C VAL B 417 2.317 18.946 -71.667 1.00173.27 C
ATOM 5866 O VAL B 417 2.959 19.710 -70.946 1.00173.66 O
ATOM 5867 CB VAL B 417 3.235 18.040 -73.807 1.00175.03 C
ATOM 5868 CG1 VAL B 417 4.096 19.287 -73.963 1.00174.55 C
ATOM 5869 CG2 VAL B 417 3.889 16.846 -74.485 1.00175.19 C
ATOM 5870 N LYS B 418 1.024 19.112 -71.928 1.00172.94 N
ATOM 5871 CA LYS B 418 0.258 20.203 -71.338 1.00173.48 C
ATOM 5872 C LYS B 418 0.196 20.079 -69.818 1.00174.21 C
ATOM 5873 O LYS B 418 0.162 21.085 -69.112 1.00174.72 O
ATOM 5874 CB LYS B 418 -1.157 20.245 -71.920 1.00173.22 C
ATOM 5875 CG LYS B 418 -1.219 20.684 -73.373 1.00172.99 C
ATOM 5876 CD LYS B 418 -2.653 20.802 -73.859 1.00173.17 C
ATOM 5877 CE LYS B 418 -3.313 19.437 -73.961 1.00173.23 C
ATOM 5878 NZ LYS B 418 -4.544 19.479 -74.797 1.00173.84 N
ATOM 5879 N SER B 419 0.173 18.845 -69.323 1.00173.82 N
ATOM 5880 CA SER B 419 0.167 18.586 -67.884 1.00173.84 C
ATOM 5881 C SER B 419 1.385 19.196 -67.193 1.00173.74 C
ATOM 5882 O SER B 419 1.249 19.943 -66.224 1.00173.90 O
ATOM 5883 CB SER B 419 0.111 17.081 -67.611 1.00173.78 C
ATOM 5884 OG SER B 419 0.368 16.798 -66.247 1.00173.59 O
ATOM 5885 N TYR B 420 2.573 18.867 -67.692 1.00173.45 N
ATOM 5886 CA TYR B 420 3.813 19.404 -67.141 1.00173.55 C
ATOM 5887 C TYR B 420 3.928 20.907 -67.380 1.00174.48 C
ATOM 5888 O TYR B 420 4.474 21.634 -66.550 1.00175.37 O
ATOM 5889 CB TYR B 420 5.021 18.679 -67.735 1.00172.78 C
ATOM 5890 CG TYR B 420 5.189 17.270 -67.217 1.00172.01 C
ATOM 5891 CD1 TYR B 420 5.510 17.034 -65.888 1.00171.90 C
ATOM 5892 CD2 TYR B 420 5.021 16.176 -68.055 1.00173.26 C
ATOM 5893 CE1 TYR B 420 5.661 15.749 -65.408 1.00171.97 C
ATOM 5894 CE2 TYR B 420 5.170 14.888 -67.584 1.00173.15 C
ATOM 5895 CZ TYR B 420 5.490 14.680 -66.261 1.00172.62 C
ATOM 5896 OH TYR B 420 5.639 13.397 -65.791 1.00173.87 O
ATOM 5897 N ALA B 421 3.416 21.366 -68.518 1.00174.42 N
ATOM 5898 CA ALA B 421 3.377 22.792 -68.825 1.00174.14 C
ATOM 5899 C ALA B 421 2.499 23.515 -67.811 1.00173.63 C
ATOM 5900 O ALA B 421 2.812 24.621 -67.371 1.00173.64 O
ATOM 5901 CB ALA B 421 2.869 23.023 -70.240 1.00174.31 C
ATOM 5902 N ARG B 422 1.390 22.875 -67.456 1.00173.43 N
ATOM 5903 CA ARG B 422 0.486 23.377 -66.429 1.00173.88 C
ATOM 5904 C ARG B 422 1.172 23.429 -65.062 1.00173.40 C
ATOM 5905 O ARG B 422 0.766 24.188 -64.182 1.00172.79 O
ATOM 5906 CB ARG B 422 -0.764 22.497 -66.363 1.00174.53 C
ATOM 5907 CG ARG B 422 -1.973 23.133 -65.699 1.00175.13 C
ATOM 5908 CD ARG B 422 -3.175 23.103 -66.637 1.00174.81 C
ATOM 5909 NE ARG B 422 -3.145 21.950 -67.535 1.00174.32 N
ATOM 5910 CZ ARG B 422 -3.647 20.754 -67.241 1.00173.52 C
ATOM 5911 NH1 ARG B 422 -4.221 20.542 -66.066 1.00173.63 N
ATOM 5912 NH2 ARG B 422 -3.571 19.767 -68.124 1.00173.25 N
ATOM 5913 N LYS B 423 2.209 22.613 -64.894 1.00173.64 N
ATOM 5914 CA LYS B 423 2.942 22.529 -63.632 1.00173.59 C
ATOM 5915 C LYS B 423 4.139 23.476 -63.587 1.00174.04 C
ATOM 5916 O LYS B 423 4.453 24.042 -62.539 1.00174.11 O
ATOM 5917 CB LYS B 423 3.417 21.096 -63.387 1.00173.33 C
ATOM 5918 CG LYS B 423 2.684 20.380 -62.266 1.00172.89 C
ATOM 5919 CD LYS B 423 1.180 20.451 -62.464 1.00173.57 C
ATOM 5920 CE LYS B 423 0.445 19.856 -61.277 1.00174.76 C
ATOM 5921 NZ LYS B 423 -1.031 19.911 -61.459 1.00175.44 N
ATOM 5922 N ALA B 424 4.813 23.628 -64.725 1.00174.62 N
ATOM 5923 CA ALA B 424 5.985 24.496 -64.835 1.00174.97 C
ATOM 5924 C ALA B 424 5.676 25.940 -64.442 1.00174.82 C
ATOM 5925 O ALA B 424 6.574 26.692 -64.062 1.00174.88 O
ATOM 5926 CB ALA B 424 6.543 24.444 -66.248 1.00175.08 C
ATOM 5927 N ILE B 425 4.404 26.317 -64.555 1.00174.22 N
ATOM 5928 CA ILE B 425 3.919 27.622 -64.114 1.00173.36 C
ATOM 5929 C ILE B 425 4.353 27.923 -62.678 1.00173.69 C
ATOM 5930 O ILE B 425 4.681 29.061 -62.338 1.00173.75 O
ATOM 5931 CB ILE B 425 2.375 27.694 -64.231 1.00172.77 C
ATOM 5932 CG1 ILE B 425 1.969 28.183 -65.621 1.00173.51 C
ATOM 5933 CG2 ILE B 425 1.775 28.598 -63.171 1.00173.17 C
ATOM 5934 CD1 ILE B 425 0.473 28.288 -65.812 1.00174.37 C
ATOM 5935 N PHE B 426 4.389 26.883 -61.852 1.00174.06 N
ATOM 5936 CA PHE B 426 4.745 27.023 -60.446 1.00174.01 C
ATOM 5937 C PHE B 426 6.252 26.943 -60.230 1.00173.86 C
ATOM 5938 O PHE B 426 6.726 26.981 -59.095 1.00174.15 O
ATOM 5939 CB PHE B 426 4.045 25.946 -59.616 1.00173.98 C
ATOM 5940 CG PHE B 426 2.557 25.906 -59.812 1.00174.17 C
ATOM 5941 CD1 PHE B 426 1.808 27.071 -59.772 1.00174.05 C
ATOM 5942 CD2 PHE B 426 1.907 24.706 -60.040 1.00174.39 C
ATOM 5943 CE1 PHE B 426 0.439 27.039 -59.954 1.00174.07 C
ATOM 5944 CE2 PHE B 426 0.537 24.667 -60.223 1.00174.63 C
ATOM 5945 CZ PHE B 426 -0.197 25.835 -60.179 1.00174.63 C
ATOM 5946 N GLY B 427 7.003 26.834 -61.321 1.00173.42 N
ATOM 5947 CA GLY B 427 8.443 26.686 -61.235 1.00173.59 C
ATOM 5948 C GLY B 427 8.874 25.242 -61.391 1.00173.00 C
ATOM 5949 O GLY B 427 8.268 24.486 -62.153 1.00173.01 O
ATOM 5950 N GLU B 428 9.931 24.864 -60.676 1.00172.74 N
ATOM 5951 CA GLU B 428 10.437 23.497 -60.707 1.00172.21 C
ATOM 5952 C GLU B 428 9.356 22.496 -60.324 1.00172.22 C
ATOM 5953 O GLU B 428 8.679 22.654 -59.310 1.00172.94 O
ATOM 5954 CB GLU B 428 11.641 23.349 -59.774 1.00172.87 C
ATOM 5955 CG GLU B 428 12.871 24.115 -60.223 1.00173.05 C
ATOM 5956 CD GLU B 428 13.326 23.712 -61.610 1.00172.68 C
ATOM 5957 OE1 GLU B 428 13.381 22.495 -61.887 1.00172.36 O
ATOM 5958 OE2 GLU B 428 13.634 24.610 -62.422 1.00173.54 O
ATOM 5959 N ILE B 429 9.198 21.468 -61.149 1.00172.14 N
ATOM 5960 CA ILE B 429 8.160 20.469 -60.940 1.00173.11 C
ATOM 5961 C ILE B 429 8.637 19.370 -59.995 1.00173.38 C
ATOM 5962 O ILE B 429 9.717 18.810 -60.177 1.00173.58 O
ATOM 5963 CB ILE B 429 7.717 19.846 -62.272 1.00174.40 C
ATOM 5964 CG1 ILE B 429 7.404 20.945 -63.290 1.00174.10 C
ATOM 5965 CG2 ILE B 429 6.522 18.927 -62.062 1.00174.80 C
ATOM 5966 CD1 ILE B 429 6.996 20.425 -64.651 1.00174.79 C
ATOM 5967 N PHE B 430 7.828 19.067 -58.985 1.00173.04 N
ATOM 5968 CA PHE B 430 8.190 18.067 -57.986 1.00172.92 C
ATOM 5969 C PHE B 430 7.168 16.940 -57.872 1.00173.29 C
ATOM 5970 O PHE B 430 6.063 17.027 -58.406 1.00173.68 O
ATOM 5971 CB PHE B 430 8.379 18.730 -56.621 1.00173.06 C
ATOM 5972 CG PHE B 430 9.723 19.372 -56.441 1.00173.68 C
ATOM 5973 CD1 PHE B 430 10.747 18.692 -55.804 1.00173.66 C
ATOM 5974 CD2 PHE B 430 9.963 20.654 -56.905 1.00174.05 C
ATOM 5975 CE1 PHE B 430 11.986 19.277 -55.633 1.00173.31 C
ATOM 5976 CE2 PHE B 430 11.202 21.244 -56.739 1.00173.92 C
ATOM 5977 CZ PHE B 430 12.215 20.553 -56.103 1.00173.47 C
ATOM 5978 N GLU B 431 7.553 15.884 -57.163 1.00173.31 N
ATOM 5979 CA GLU B 431 6.687 14.734 -56.931 1.00173.51 C
ATOM 5980 C GLU B 431 6.197 14.722 -55.487 1.00173.54 C
ATOM 5981 O GLU B 431 6.992 14.580 -54.558 1.00173.87 O
ATOM 5982 CB GLU B 431 7.428 13.436 -57.252 1.00173.65 C
ATOM 5983 CG GLU B 431 6.547 12.201 -57.288 1.00173.97 C
ATOM 5984 CD GLU B 431 7.338 10.934 -57.546 1.00174.70 C
ATOM 5985 OE1 GLU B 431 8.064 10.881 -58.561 1.00174.89 O
ATOM 5986 OE2 GLU B 431 7.235 9.990 -56.733 1.00175.13 O
ATOM 5987 N PHE B 432 4.889 14.874 -55.302 1.00173.26 N
ATOM 5988 CA PHE B 432 4.317 14.989 -53.963 1.00173.46 C
ATOM 5989 C PHE B 432 3.581 13.737 -53.495 1.00173.66 C
ATOM 5990 O PHE B 432 3.058 12.967 -54.299 1.00173.42 O
ATOM 5991 CB PHE B 432 3.364 16.183 -53.905 1.00173.23 C
ATOM 5992 CG PHE B 432 4.037 17.502 -54.138 1.00173.38 C
ATOM 5993 CD1 PHE B 432 4.676 18.159 -53.100 1.00173.72 C
ATOM 5994 CD2 PHE B 432 4.039 18.083 -55.395 1.00173.04 C
ATOM 5995 CE1 PHE B 432 5.300 19.372 -53.309 1.00174.49 C
ATOM 5996 CE2 PHE B 432 4.662 19.296 -55.612 1.00173.43 C
ATOM 5997 CZ PHE B 432 5.293 19.940 -54.567 1.00174.40 C
ATOM 5998 N ASP B 433 3.545 13.553 -52.179 1.00173.94 N
ATOM 5999 CA ASP B 433 2.769 12.487 -51.560 1.00174.20 C
ATOM 6000 C ASP B 433 1.502 13.089 -50.951 1.00174.08 C
ATOM 6001 O ASP B 433 1.546 13.680 -49.874 1.00174.55 O
ATOM 6002 CB ASP B 433 3.601 11.760 -50.497 1.00174.42 C
ATOM 6003 CG ASP B 433 2.766 10.844 -49.619 1.00174.35 C
ATOM 6004 OD1 ASP B 433 1.777 10.270 -50.120 1.00174.37 O
ATOM 6005 OD2 ASP B 433 3.101 10.697 -48.423 1.00173.82 O
ATOM 6006 N THR B 434 0.380 12.947 -51.650 1.00173.20 N
ATOM 6007 CA THR B 434 -0.880 13.548 -51.219 1.00172.47 C
ATOM 6008 C THR B 434 -1.728 12.600 -50.374 1.00172.86 C
ATOM 6009 O THR B 434 -2.666 13.028 -49.700 1.00172.81 O
ATOM 6010 CB THR B 434 -1.712 14.008 -52.426 1.00172.78 C
ATOM 6011 OG1 THR B 434 -2.198 12.861 -53.134 1.00173.63 O
ATOM 6012 CG2 THR B 434 -0.864 14.852 -53.363 1.00173.50 C
ATOM 6013 N GLU B 435 -1.401 11.312 -50.429 1.00173.48 N
ATOM 6014 CA GLU B 435 -2.147 10.284 -49.704 1.00174.41 C
ATOM 6015 C GLU B 435 -2.128 10.470 -48.187 1.00174.45 C
ATOM 6016 O GLU B 435 -3.167 10.729 -47.578 1.00174.56 O
ATOM 6017 CB GLU B 435 -1.600 8.898 -50.051 1.00175.09 C
ATOM 6018 CG GLU B 435 -1.941 8.423 -51.454 1.00175.65 C
ATOM 6019 CD GLU B 435 -3.433 8.415 -51.721 1.00176.28 C
ATOM 6020 OE1 GLU B 435 -4.185 7.850 -50.897 1.00177.10 O
ATOM 6021 OE2 GLU B 435 -3.854 8.970 -52.758 1.00175.77 O
ATOM 6022 N THR B 436 -0.942 10.315 -47.598 1.00174.10 N
ATOM 6023 CA THR B 436 -0.716 10.404 -46.150 1.00173.10 C
ATOM 6024 C THR B 436 -1.595 11.403 -45.393 1.00172.00 C
ATOM 6025 O THR B 436 -2.476 11.011 -44.629 1.00171.48 O
ATOM 6026 CB THR B 436 0.752 10.765 -45.853 1.00173.20 C
ATOM 6027 OG1 THR B 436 1.618 9.984 -46.686 1.00173.26 O
ATOM 6028 CG2 THR B 436 1.081 10.499 -44.392 1.00173.29 C
ATOM 6029 N LEU B 437 -1.352 12.690 -45.612 1.00172.11 N
ATOM 6030 CA LEU B 437 -2.054 13.735 -44.875 1.00172.42 C
ATOM 6031 C LEU B 437 -3.388 14.114 -45.512 1.00172.94 C
ATOM 6032 O LEU B 437 -4.048 15.051 -45.060 1.00173.59 O
ATOM 6033 CB LEU B 437 -1.171 14.979 -44.751 1.00172.57 C
ATOM 6034 CG LEU B 437 0.239 14.739 -44.206 1.00173.11 C
ATOM 6035 CD1 LEU B 437 1.001 16.048 -44.102 1.00173.28 C
ATOM 6036 CD2 LEU B 437 0.187 14.037 -42.858 1.00174.21 C
ATOM 6037 N ASN B 438 -3.771 13.388 -46.561 1.00173.25 N
ATOM 6038 CA ASN B 438 -5.019 13.635 -47.281 1.00173.17 C
ATOM 6039 C ASN B 438 -5.102 15.081 -47.772 1.00173.33 C
ATOM 6040 O ASN B 438 -6.012 15.826 -47.407 1.00173.52 O
ATOM 6041 CB ASN B 438 -6.227 13.297 -46.399 1.00172.79 C
ATOM 6042 CG ASN B 438 -7.541 13.353 -47.155 1.00171.61 C
ATOM 6043 OD1 ASN B 438 -7.658 12.828 -48.262 1.00171.08 O
ATOM 6044 ND2 ASN B 438 -8.539 13.996 -46.560 1.00171.90 N
ATOM 6045 N SER B 439 -4.130 15.474 -48.588 1.00173.54 N
ATOM 6046 CA SER B 439 -4.038 16.846 -49.075 1.00173.40 C
ATOM 6047 C SER B 439 -5.162 17.185 -50.049 1.00172.54 C
ATOM 6048 O SER B 439 -5.768 16.296 -50.649 1.00172.25 O
ATOM 6049 CB SER B 439 -2.681 17.082 -49.740 1.00173.72 C
ATOM 6050 OG SER B 439 -1.622 16.673 -48.891 1.00174.25 O
ATOM 6051 N ASP B 440 -5.438 18.477 -50.198 1.00171.88 N
ATOM 6052 CA ASP B 440 -6.515 18.937 -51.066 1.00171.50 C
ATOM 6053 C ASP B 440 -5.981 19.640 -52.310 1.00173.56 C
ATOM 6054 O ASP B 440 -6.743 19.982 -53.212 1.00175.20 O
ATOM 6055 CB ASP B 440 -7.454 19.871 -50.299 1.00171.71 C
ATOM 6056 CG ASP B 440 -6.710 20.949 -49.532 1.00173.15 C
ATOM 6057 OD1 ASP B 440 -5.743 21.522 -50.077 1.00172.97 O
ATOM 6058 OD2 ASP B 440 -7.095 21.225 -48.377 1.00174.40 O
ATOM 6059 N GLY B 441 -4.671 19.858 -52.351 1.00173.52 N
ATOM 6060 CA GLY B 441 -4.042 20.470 -53.508 1.00173.98 C
ATOM 6061 C GLY B 441 -4.209 21.976 -53.570 1.00173.48 C
ATOM 6062 O GLY B 441 -4.207 22.560 -54.653 1.00173.72 O
ATOM 6063 N ILE B 442 -4.356 22.607 -52.410 1.00172.57 N
ATOM 6064 CA ILE B 442 -4.518 24.055 -52.344 1.00172.22 C
ATOM 6065 C ILE B 442 -3.425 24.687 -51.489 1.00172.66 C
ATOM 6066 O ILE B 442 -3.281 24.354 -50.315 1.00173.36 O
ATOM 6067 CB ILE B 442 -5.892 24.442 -51.776 1.00171.69 C
ATOM 6068 CG1 ILE B 442 -7.007 23.778 -52.584 1.00172.07 C
ATOM 6069 CG2 ILE B 442 -6.058 25.951 -51.776 1.00171.79 C
ATOM 6070 CD1 ILE B 442 -8.395 24.117 -52.095 1.00173.29 C
ATOM 6071 N PHE B 443 -2.658 25.593 -52.092 1.00172.47 N
ATOM 6072 CA PHE B 443 -1.507 26.219 -51.442 1.00172.39 C
ATOM 6073 C PHE B 443 -1.803 26.799 -50.064 1.00173.02 C
ATOM 6074 O PHE B 443 -2.847 27.410 -49.843 1.00173.33 O
ATOM 6075 CB PHE B 443 -0.937 27.324 -52.332 1.00172.67 C
ATOM 6076 CG PHE B 443 -0.379 26.828 -53.631 1.00173.64 C
ATOM 6077 CD1 PHE B 443 0.782 26.074 -53.655 1.00173.75 C
ATOM 6078 CD2 PHE B 443 -1.009 27.121 -54.828 1.00174.50 C
ATOM 6079 CE1 PHE B 443 1.302 25.615 -54.849 1.00174.35 C
ATOM 6080 CE2 PHE B 443 -0.494 26.665 -56.027 1.00175.42 C
ATOM 6081 CZ PHE B 443 0.664 25.911 -56.037 1.00175.26 C
ATOM 6082 N ARG B 444 -0.868 26.599 -49.142 1.00173.60 N
ATOM 6083 CA ARG B 444 -0.954 27.183 -47.811 1.00174.18 C
ATOM 6084 C ARG B 444 0.348 27.910 -47.494 1.00173.16 C
ATOM 6085 O ARG B 444 1.398 27.572 -48.039 1.00173.14 O
ATOM 6086 CB ARG B 444 -1.247 26.108 -46.762 1.00174.85 C
ATOM 6087 CG ARG B 444 -2.640 25.494 -46.868 1.00175.01 C
ATOM 6088 CD ARG B 444 -2.781 24.275 -45.969 1.00174.46 C
ATOM 6089 NE ARG B 444 -4.166 23.828 -45.815 1.00173.48 N
ATOM 6090 CZ ARG B 444 -4.880 23.230 -46.764 1.00173.09 C
ATOM 6091 NH1 ARG B 444 -4.342 22.977 -47.948 1.00174.05 N
ATOM 6092 NH2 ARG B 444 -6.132 22.868 -46.520 1.00172.22 N
ATOM 6093 N THR B 445 0.279 28.901 -46.613 1.00172.43 N
ATOM 6094 CA THR B 445 1.437 29.741 -46.338 1.00171.89 C
ATOM 6095 C THR B 445 2.375 29.121 -45.310 1.00172.39 C
ATOM 6096 O THR B 445 1.989 28.242 -44.539 1.00172.52 O
ATOM 6097 CB THR B 445 1.015 31.139 -45.847 1.00172.18 C
ATOM 6098 OG1 THR B 445 2.173 31.976 -45.737 1.00172.17 O
ATOM 6099 CG2 THR B 445 0.332 31.046 -44.496 1.00173.47 C
ATOM 6100 N SER B 446 3.617 29.591 -45.319 1.00172.92 N
ATOM 6101 CA SER B 446 4.652 29.086 -44.429 1.00173.56 C
ATOM 6102 C SER B 446 4.532 29.724 -43.046 1.00172.66 C
ATOM 6103 O SER B 446 3.802 30.702 -42.879 1.00172.71 O
ATOM 6104 CB SER B 446 6.034 29.362 -45.032 1.00174.25 C
ATOM 6105 OG SER B 446 6.256 30.754 -45.173 1.00174.46 O
ATOM 6106 N PRO B 447 5.231 29.160 -42.045 1.00172.03 N
ATOM 6107 CA PRO B 447 5.288 29.776 -40.717 1.00171.93 C
ATOM 6108 C PRO B 447 5.717 31.238 -40.766 1.00172.15 C
ATOM 6109 O PRO B 447 5.228 32.042 -39.973 1.00172.35 O
ATOM 6110 CB PRO B 447 6.326 28.924 -39.994 1.00172.81 C
ATOM 6111 CG PRO B 447 6.133 27.578 -40.584 1.00172.86 C
ATOM 6112 CD PRO B 447 5.872 27.832 -42.044 1.00172.30 C
ATOM 6113 N ARG B 448 6.624 31.564 -41.683 1.00172.52 N
ATOM 6114 CA ARG B 448 7.027 32.946 -41.921 1.00173.58 C
ATOM 6115 C ARG B 448 5.814 33.837 -42.179 1.00173.85 C
ATOM 6116 O ARG B 448 5.727 34.950 -41.661 1.00174.28 O
ATOM 6117 CB ARG B 448 7.998 33.023 -43.104 1.00174.15 C
ATOM 6118 CG ARG B 448 8.386 34.442 -43.503 1.00174.60 C
ATOM 6119 CD ARG B 448 9.303 34.458 -44.722 1.00174.40 C
ATOM 6120 NE ARG B 448 10.558 33.741 -44.502 1.00174.75 N
ATOM 6121 CZ ARG B 448 11.563 34.186 -43.753 1.00175.13 C
ATOM 6122 NH1 ARG B 448 11.480 35.362 -43.147 1.00174.61 N
ATOM 6123 NH2 ARG B 448 12.660 33.454 -43.619 1.00175.25 N
ATOM 6124 N GLY B 449 4.878 33.332 -42.976 1.00173.65 N
ATOM 6125 CA GLY B 449 3.668 34.064 -43.296 1.00173.58 C
ATOM 6126 C GLY B 449 2.770 34.277 -42.093 1.00173.05 C
ATOM 6127 O GLY B 449 2.296 35.387 -41.851 1.00173.16 O
ATOM 6128 N TRP B 450 2.538 33.209 -41.338 1.00172.20 N
ATOM 6129 CA TRP B 450 1.654 33.271 -40.181 1.00172.81 C
ATOM 6130 C TRP B 450 2.195 34.196 -39.097 1.00173.63 C
ATOM 6131 O TRP B 450 1.452 35.001 -38.536 1.00174.02 O
ATOM 6132 CB TRP B 450 1.424 31.873 -39.608 1.00172.90 C
ATOM 6133 CG TRP B 450 0.454 31.069 -40.407 1.00172.72 C
ATOM 6134 CD1 TRP B 450 0.713 29.928 -41.104 1.00172.80 C
ATOM 6135 CD2 TRP B 450 -0.936 31.356 -40.606 1.00173.19 C
ATOM 6136 NE1 TRP B 450 -0.431 29.480 -41.720 1.00173.23 N
ATOM 6137 CE2 TRP B 450 -1.457 30.340 -41.431 1.00173.34 C
ATOM 6138 CE3 TRP B 450 -1.790 32.371 -40.165 1.00173.70 C
ATOM 6139 CZ2 TRP B 450 -2.794 30.309 -41.822 1.00173.80 C
ATOM 6140 CZ3 TRP B 450 -3.117 32.339 -40.555 1.00173.73 C
ATOM 6141 CH2 TRP B 450 -3.606 31.315 -41.376 1.00173.51 C
ATOM 6142 N PHE B 451 3.486 34.069 -38.802 1.00173.82 N
ATOM 6143 CA PHE B 451 4.138 34.922 -37.816 1.00173.63 C
ATOM 6144 C PHE B 451 3.980 36.391 -38.188 1.00173.63 C
ATOM 6145 O PHE B 451 3.669 37.227 -37.340 1.00173.25 O
ATOM 6146 CB PHE B 451 5.623 34.565 -37.695 1.00173.63 C
ATOM 6147 CG PHE B 451 6.354 35.340 -36.632 1.00173.45 C
ATOM 6148 CD1 PHE B 451 6.572 34.782 -35.385 1.00173.49 C
ATOM 6149 CD2 PHE B 451 6.826 36.620 -36.880 1.00173.61 C
ATOM 6150 CE1 PHE B 451 7.244 35.483 -34.406 1.00173.83 C
ATOM 6151 CE2 PHE B 451 7.492 37.327 -35.903 1.00174.04 C
ATOM 6152 CZ PHE B 451 7.698 36.759 -34.665 1.00174.09 C
ATOM 6153 N THR B 452 4.207 36.694 -39.462 1.00173.85 N
ATOM 6154 CA THR B 452 4.111 38.059 -39.963 1.00174.22 C
ATOM 6155 C THR B 452 2.694 38.602 -39.817 1.00174.33 C
ATOM 6156 O THR B 452 2.499 39.732 -39.375 1.00175.33 O
ATOM 6157 CB THR B 452 4.538 38.151 -41.439 1.00173.91 C
ATOM 6158 OG1 THR B 452 5.908 37.755 -41.568 1.00174.45 O
ATOM 6159 CG2 THR B 452 4.375 39.571 -41.958 1.00173.03 C
ATOM 6160 N PHE B 453 1.707 37.789 -40.183 1.00173.35 N
ATOM 6161 CA PHE B 453 0.311 38.205 -40.112 1.00172.72 C
ATOM 6162 C PHE B 453 -0.138 38.482 -38.683 1.00173.16 C
ATOM 6163 O PHE B 453 -0.708 39.532 -38.395 1.00173.29 O
ATOM 6164 CB PHE B 453 -0.596 37.144 -40.729 1.00172.10 C
ATOM 6165 CG PHE B 453 -2.046 37.323 -40.386 1.00172.16 C
ATOM 6166 CD1 PHE B 453 -2.783 38.351 -40.947 1.00172.64 C
ATOM 6167 CD2 PHE B 453 -2.670 36.466 -39.495 1.00172.56 C
ATOM 6168 CE1 PHE B 453 -4.116 38.520 -40.629 1.00172.77 C
ATOM 6169 CE2 PHE B 453 -4.002 36.630 -39.173 1.00173.09 C
ATOM 6170 CZ PHE B 453 -4.727 37.658 -39.741 1.00172.96 C
ATOM 6171 N ALA B 454 0.123 37.528 -37.797 1.00173.36 N
ATOM 6172 CA ALA B 454 -0.302 37.619 -36.406 1.00173.53 C
ATOM 6173 C ALA B 454 0.272 38.859 -35.725 1.00173.35 C
ATOM 6174 O ALA B 454 -0.451 39.620 -35.080 1.00173.50 O
ATOM 6175 CB ALA B 454 0.104 36.366 -35.651 1.00173.91 C
ATOM 6176 N HIS B 455 1.578 39.051 -35.876 1.00173.15 N
ATOM 6177 CA HIS B 455 2.287 40.128 -35.200 1.00173.33 C
ATOM 6178 C HIS B 455 1.990 41.497 -35.795 1.00173.42 C
ATOM 6179 O HIS B 455 2.094 42.513 -35.111 1.00174.17 O
ATOM 6180 CB HIS B 455 3.787 39.851 -35.246 1.00173.32 C
ATOM 6181 CG HIS B 455 4.216 38.765 -34.315 1.00174.19 C
ATOM 6182 ND1 HIS B 455 3.951 37.434 -34.554 1.00174.49 N
ATOM 6183 CD2 HIS B 455 4.894 38.812 -33.144 1.00174.12 C
ATOM 6184 CE1 HIS B 455 4.440 36.708 -33.564 1.00174.57 C
ATOM 6185 NE2 HIS B 455 5.023 37.519 -32.701 1.00173.97 N
ATOM 6186 N ALA B 456 1.623 41.518 -37.070 1.00173.33 N
ATOM 6187 CA ALA B 456 1.224 42.759 -37.714 1.00173.84 C
ATOM 6188 C ALA B 456 -0.140 43.192 -37.196 1.00172.78 C
ATOM 6189 O ALA B 456 -0.394 44.381 -37.002 1.00172.57 O
ATOM 6190 CB ALA B 456 1.195 42.599 -39.222 1.00175.03 C
ATOM 6191 N VAL B 457 -1.010 42.216 -36.964 1.00172.30 N
ATOM 6192 CA VAL B 457 -2.343 42.489 -36.443 1.00173.13 C
ATOM 6193 C VAL B 457 -2.273 42.904 -34.977 1.00174.01 C
ATOM 6194 O VAL B 457 -2.813 43.944 -34.595 1.00174.43 O
ATOM 6195 CB VAL B 457 -3.271 41.268 -36.590 1.00173.39 C
ATOM 6196 CG1 VAL B 457 -4.560 41.484 -35.811 1.00174.12 C
ATOM 6197 CG2 VAL B 457 -3.573 41.008 -38.059 1.00173.10 C
ATOM 6198 N PHE B 458 -1.619 42.080 -34.163 1.00174.07 N
ATOM 6199 CA PHE B 458 -1.387 42.388 -32.752 1.00173.58 C
ATOM 6200 C PHE B 458 -0.801 43.786 -32.554 1.00173.66 C
ATOM 6201 O PHE B 458 -1.245 44.533 -31.683 1.00173.12 O
ATOM 6202 CB PHE B 458 -0.460 41.343 -32.126 1.00173.20 C
ATOM 6203 CG PHE B 458 -1.108 40.008 -31.908 1.00172.26 C
ATOM 6204 CD1 PHE B 458 -2.462 39.916 -31.634 1.00171.60 C
ATOM 6205 CD2 PHE B 458 -0.358 38.846 -31.958 1.00172.71 C
ATOM 6206 CE1 PHE B 458 -3.057 38.687 -31.430 1.00171.37 C
ATOM 6207 CE2 PHE B 458 -0.948 37.615 -31.753 1.00172.23 C
ATOM 6208 CZ PHE B 458 -2.299 37.536 -31.488 1.00171.71 C
ATOM 6209 N ALA B 459 0.205 44.123 -33.358 1.00174.09 N
ATOM 6210 CA ALA B 459 0.829 45.444 -33.311 1.00174.12 C
ATOM 6211 C ALA B 459 -0.185 46.555 -33.548 1.00173.88 C
ATOM 6212 O ALA B 459 -0.308 47.476 -32.742 1.00174.11 O
ATOM 6213 CB ALA B 459 1.953 45.539 -34.331 1.00174.18 C
ATOM 6214 N LEU B 460 -0.905 46.461 -34.663 1.00173.11 N
ATOM 6215 CA LEU B 460 -1.906 47.459 -35.018 1.00172.86 C
ATOM 6216 C LEU B 460 -2.992 47.543 -33.949 1.00173.04 C
ATOM 6217 O LEU B 460 -3.561 48.606 -33.710 1.00173.09 O
ATOM 6218 CB LEU B 460 -2.527 47.135 -36.379 1.00172.21 C
ATOM 6219 CG LEU B 460 -3.489 48.174 -36.960 1.00171.81 C
ATOM 6220 CD1 LEU B 460 -2.806 49.527 -37.071 1.00172.59 C
ATOM 6221 CD2 LEU B 460 -4.020 47.727 -38.311 1.00172.07 C
ATOM 6222 N LEU B 461 -3.264 46.415 -33.300 1.00172.85 N
ATOM 6223 CA LEU B 461 -4.249 46.366 -32.229 1.00172.77 C
ATOM 6224 C LEU B 461 -3.721 47.037 -30.968 1.00173.89 C
ATOM 6225 O LEU B 461 -4.447 47.762 -30.289 1.00174.98 O
ATOM 6226 CB LEU B 461 -4.641 44.919 -31.927 1.00172.61 C
ATOM 6227 CG LEU B 461 -5.802 44.347 -32.739 1.00172.29 C
ATOM 6228 CD1 LEU B 461 -6.130 42.937 -32.274 1.00173.06 C
ATOM 6229 CD2 LEU B 461 -7.024 45.250 -32.645 1.00172.18 C
ATOM 6230 N PHE B 462 -2.450 46.792 -30.663 1.00173.69 N
ATOM 6231 CA PHE B 462 -1.821 47.362 -29.477 1.00173.64 C
ATOM 6232 C PHE B 462 -1.677 48.877 -29.571 1.00173.69 C
ATOM 6233 O PHE B 462 -1.560 49.556 -28.551 1.00173.74 O
ATOM 6234 CB PHE B 462 -0.454 46.718 -29.239 1.00173.76 C
ATOM 6235 CG PHE B 462 -0.490 45.571 -28.275 1.00173.72 C
ATOM 6236 CD1 PHE B 462 0.166 45.652 -27.059 1.00173.91 C
ATOM 6237 CD2 PHE B 462 -1.200 44.421 -28.573 1.00173.69 C
ATOM 6238 CE1 PHE B 462 0.128 44.602 -26.166 1.00173.84 C
ATOM 6239 CE2 PHE B 462 -1.244 43.367 -27.682 1.00173.77 C
ATOM 6240 CZ PHE B 462 -0.579 43.458 -26.477 1.00173.47 C
ATOM 6241 N PHE B 463 -1.673 49.399 -30.795 1.00173.12 N
ATOM 6242 CA PHE B 463 -1.671 50.842 -31.011 1.00173.01 C
ATOM 6243 C PHE B 463 -2.852 51.486 -30.290 1.00174.18 C
ATOM 6244 O PHE B 463 -2.701 52.507 -29.618 1.00174.62 O
ATOM 6245 CB PHE B 463 -1.714 51.165 -32.508 1.00172.44 C
ATOM 6246 CG PHE B 463 -2.030 52.605 -32.815 1.00172.47 C
ATOM 6247 CD1 PHE B 463 -1.027 53.560 -32.829 1.00172.94 C
ATOM 6248 CD2 PHE B 463 -3.327 52.999 -33.107 1.00172.83 C
ATOM 6249 CE1 PHE B 463 -1.313 54.882 -33.113 1.00173.33 C
ATOM 6250 CE2 PHE B 463 -3.618 54.319 -33.391 1.00172.96 C
ATOM 6251 CZ PHE B 463 -2.610 55.262 -33.395 1.00172.91 C
ATOM 6252 N PHE B 464 -4.025 50.877 -30.435 1.00174.49 N
ATOM 6253 CA PHE B 464 -5.227 51.352 -29.758 1.00174.45 C
ATOM 6254 C PHE B 464 -5.087 51.299 -28.240 1.00173.88 C
ATOM 6255 O PHE B 464 -5.566 52.188 -27.538 1.00174.21 O
ATOM 6256 CB PHE B 464 -6.445 50.534 -30.193 1.00174.57 C
ATOM 6257 CG PHE B 464 -7.739 51.017 -29.605 1.00173.80 C
ATOM 6258 CD1 PHE B 464 -8.469 52.012 -30.231 1.00174.05 C
ATOM 6259 CD2 PHE B 464 -8.231 50.470 -28.430 1.00172.98 C
ATOM 6260 CE1 PHE B 464 -9.662 52.456 -29.695 1.00173.86 C
ATOM 6261 CE2 PHE B 464 -9.422 50.911 -27.889 1.00173.27 C
ATOM 6262 CZ PHE B 464 -10.139 51.905 -28.522 1.00173.21 C
ATOM 6263 N GLY B 465 -4.428 50.258 -27.741 1.00173.59 N
ATOM 6264 CA GLY B 465 -4.235 50.098 -26.313 1.00174.26 C
ATOM 6265 C GLY B 465 -3.381 51.223 -25.778 1.00174.19 C
ATOM 6266 O GLY B 465 -3.630 51.756 -24.694 1.00174.68 O
ATOM 6267 N HIS B 466 -2.362 51.575 -26.552 1.00172.87 N
ATOM 6268 CA HIS B 466 -1.520 52.717 -26.249 1.00172.84 C
ATOM 6269 C HIS B 466 -2.312 54.025 -26.187 1.00173.63 C
ATOM 6270 O HIS B 466 -2.242 54.750 -25.194 1.00174.34 O
ATOM 6271 CB HIS B 466 -0.410 52.842 -27.285 1.00172.82 C
ATOM 6272 CG HIS B 466 0.271 54.169 -27.255 1.00173.58 C
ATOM 6273 ND1 HIS B 466 0.851 54.679 -26.114 1.00174.99 N
ATOM 6274 CD2 HIS B 466 0.433 55.109 -28.214 1.00173.20 C
ATOM 6275 CE1 HIS B 466 1.358 55.869 -26.376 1.00174.74 C
ATOM 6276 NE2 HIS B 466 1.115 56.153 -27.643 1.00173.69 N
ATOM 6277 N ILE B 467 -3.044 54.323 -27.260 1.00173.44 N
ATOM 6278 CA ILE B 467 -3.877 55.526 -27.338 1.00174.88 C
ATOM 6279 C ILE B 467 -4.899 55.574 -26.197 1.00175.53 C
ATOM 6280 O ILE B 467 -5.166 56.637 -25.631 1.00175.74 O
ATOM 6281 CB ILE B 467 -4.606 55.622 -28.711 1.00174.59 C
ATOM 6282 CG1 ILE B 467 -3.863 56.576 -29.653 1.00173.68 C
ATOM 6283 CG2 ILE B 467 -6.035 56.127 -28.555 1.00174.78 C
ATOM 6284 CD1 ILE B 467 -2.394 56.273 -29.830 1.00173.42 C
ATOM 6285 N TRP B 468 -5.449 54.415 -25.849 1.00175.24 N
ATOM 6286 CA TRP B 468 -6.485 54.335 -24.825 1.00174.26 C
ATOM 6287 C TRP B 468 -5.923 54.610 -23.434 1.00173.80 C
ATOM 6288 O TRP B 468 -6.371 55.528 -22.750 1.00174.18 O
ATOM 6289 CB TRP B 468 -7.165 52.964 -24.859 1.00174.20 C
ATOM 6290 CG TRP B 468 -8.011 52.690 -23.657 1.00173.45 C
ATOM 6291 CD1 TRP B 468 -7.700 51.883 -22.601 1.00172.65 C
ATOM 6292 CD2 TRP B 468 -9.308 53.233 -23.379 1.00173.85 C
ATOM 6293 NE1 TRP B 468 -8.725 51.887 -21.685 1.00172.84 N
ATOM 6294 CE2 TRP B 468 -9.723 52.709 -22.139 1.00173.59 C
ATOM 6295 CE3 TRP B 468 -10.159 54.111 -24.058 1.00174.36 C
ATOM 6296 CZ2 TRP B 468 -10.950 53.032 -21.565 1.00173.72 C
ATOM 6297 CZ3 TRP B 468 -11.377 54.431 -23.486 1.00174.12 C
ATOM 6298 CH2 TRP B 468 -11.760 53.893 -22.252 1.00173.56 C
ATOM 6299 N HIS B 469 -4.947 53.809 -23.019 1.00173.68 N
ATOM 6300 CA HIS B 469 -4.324 53.976 -21.709 1.00174.77 C
ATOM 6301 C HIS B 469 -3.597 55.308 -21.562 1.00175.26 C
ATOM 6302 O HIS B 469 -3.556 55.884 -20.472 1.00175.25 O
ATOM 6303 CB HIS B 469 -3.353 52.835 -21.437 1.00174.88 C
ATOM 6304 CG HIS B 469 -4.025 51.550 -21.084 1.00174.43 C
ATOM 6305 ND1 HIS B 469 -4.918 51.441 -20.038 1.00174.65 N
ATOM 6306 CD2 HIS B 469 -3.933 50.316 -21.629 1.00173.80 C
ATOM 6307 CE1 HIS B 469 -5.349 50.197 -19.959 1.00174.33 C
ATOM 6308 NE2 HIS B 469 -4.764 49.493 -20.912 1.00173.93 N
ATOM 6309 N GLY B 470 -3.013 55.780 -22.659 1.00174.73 N
ATOM 6310 CA GLY B 470 -2.348 57.068 -22.679 1.00174.46 C
ATOM 6311 C GLY B 470 -3.337 58.152 -22.313 1.00174.59 C
ATOM 6312 O GLY B 470 -3.080 58.979 -21.437 1.00174.80 O
ATOM 6313 N ALA B 471 -4.474 58.140 -22.999 1.00174.55 N
ATOM 6314 CA ALA B 471 -5.569 59.059 -22.715 1.00174.74 C
ATOM 6315 C ALA B 471 -6.056 58.956 -21.269 1.00175.26 C
ATOM 6316 O ALA B 471 -6.201 59.967 -20.584 1.00174.78 O
ATOM 6317 CB ALA B 471 -6.722 58.804 -23.672 1.00173.58 C
ATOM 6318 N ARG B 472 -6.284 57.730 -20.803 1.00175.39 N
ATOM 6319 CA ARG B 472 -6.829 57.501 -19.465 1.00174.23 C
ATOM 6320 C ARG B 472 -5.864 57.936 -18.361 1.00173.75 C
ATOM 6321 O ARG B 472 -6.246 58.049 -17.197 1.00174.45 O
ATOM 6322 CB ARG B 472 -7.198 56.024 -19.289 1.00173.85 C
ATOM 6323 CG ARG B 472 -8.138 55.757 -18.127 1.00173.65 C
ATOM 6324 CD ARG B 472 -8.575 54.304 -18.077 1.00173.64 C
ATOM 6325 NE ARG B 472 -9.486 54.041 -16.965 1.00173.94 N
ATOM 6326 CZ ARG B 472 -9.122 53.995 -15.687 1.00173.94 C
ATOM 6327 NH1 ARG B 472 -7.855 54.181 -15.344 1.00173.95 N
ATOM 6328 NH2 ARG B 472 -10.027 53.753 -14.750 1.00174.20 N
ATOM 6329 N THR B 473 -4.616 58.197 -18.734 1.00173.47 N
ATOM 6330 CA THR B 473 -3.610 58.624 -17.771 1.00173.92 C
ATOM 6331 C THR B 473 -3.569 60.146 -17.685 1.00174.57 C
ATOM 6332 O THR B 473 -3.530 60.719 -16.593 1.00174.87 O
ATOM 6333 CB THR B 473 -2.212 58.097 -18.140 1.00173.14 C
ATOM 6334 OG1 THR B 473 -2.181 56.672 -17.989 1.00172.39 O
ATOM 6335 CG2 THR B 473 -1.156 58.720 -17.245 1.00173.45 C
ATOM 6336 N LEU B 474 -3.588 60.796 -18.843 1.00174.33 N
ATOM 6337 CA LEU B 474 -3.527 62.250 -18.904 1.00174.50 C
ATOM 6338 C LEU B 474 -4.896 62.876 -18.655 1.00174.54 C
ATOM 6339 O LEU B 474 -5.007 64.087 -18.466 1.00175.26 O
ATOM 6340 CB LEU B 474 -2.983 62.702 -20.260 1.00174.05 C
ATOM 6341 CG LEU B 474 -1.580 62.221 -20.636 1.00173.70 C
ATOM 6342 CD1 LEU B 474 -1.097 62.933 -21.887 1.00173.27 C
ATOM 6343 CD2 LEU B 474 -0.609 62.430 -19.486 1.00174.39 C
ATOM 6344 N PHE B 475 -5.933 62.044 -18.648 1.00174.09 N
ATOM 6345 CA PHE B 475 -7.301 62.520 -18.462 1.00174.70 C
ATOM 6346 C PHE B 475 -8.000 61.817 -17.299 1.00173.96 C
ATOM 6347 O PHE B 475 -9.228 61.704 -17.281 1.00173.89 O
ATOM 6348 CB PHE B 475 -8.116 62.331 -19.745 1.00175.13 C
ATOM 6349 CG PHE B 475 -7.690 63.226 -20.877 1.00174.67 C
ATOM 6350 CD1 PHE B 475 -8.367 64.408 -21.135 1.00173.82 C
ATOM 6351 CD2 PHE B 475 -6.617 62.886 -21.684 1.00174.41 C
ATOM 6352 CE1 PHE B 475 -7.981 65.232 -22.175 1.00173.40 C
ATOM 6353 CE2 PHE B 475 -6.225 63.707 -22.724 1.00174.23 C
ATOM 6354 CZ PHE B 475 -6.908 64.881 -22.969 1.00173.83 C
ATOM 6355 N ARG B 476 -7.213 61.334 -16.342 1.00173.73 N
ATOM 6356 CA ARG B 476 -7.756 60.659 -15.165 1.00173.81 C
ATOM 6357 C ARG B 476 -8.702 61.561 -14.368 1.00174.11 C
ATOM 6358 O ARG B 476 -9.718 61.099 -13.848 1.00173.48 O
ATOM 6359 CB ARG B 476 -6.625 60.166 -14.259 1.00173.75 C
ATOM 6360 CG ARG B 476 -6.974 58.908 -13.477 1.00173.56 C
ATOM 6361 CD ARG B 476 -5.987 58.650 -12.350 1.00174.73 C
ATOM 6362 NE ARG B 476 -6.077 59.666 -11.304 1.00176.29 N
ATOM 6363 CZ ARG B 476 -5.436 59.604 -10.141 1.00175.97 C
ATOM 6364 NH1 ARG B 476 -4.655 58.568 -9.866 1.00176.35 N
ATOM 6365 NH2 ARG B 476 -5.579 60.576 -9.250 1.00174.74 N
ATOM 6366 N ASP B 477 -8.355 62.842 -14.267 1.00174.68 N
ATOM 6367 CA ASP B 477 -9.178 63.811 -13.544 1.00174.45 C
ATOM 6368 C ASP B 477 -10.566 63.984 -14.172 1.00174.16 C
ATOM 6369 O ASP B 477 -11.578 63.928 -13.474 1.00173.87 O
ATOM 6370 CB ASP B 477 -8.460 65.166 -13.453 1.00174.38 C
ATOM 6371 CG ASP B 477 -8.138 65.757 -14.813 1.00174.59 C
ATOM 6372 OD1 ASP B 477 -7.539 65.046 -15.647 1.00174.74 O
ATOM 6373 OD2 ASP B 477 -8.484 66.934 -15.047 1.00174.60 O
ATOM 6374 N VAL B 478 -10.611 64.188 -15.486 1.00174.29 N
ATOM 6375 CA VAL B 478 -11.876 64.403 -16.184 1.00174.13 C
ATOM 6376 C VAL B 478 -12.590 63.091 -16.498 1.00173.45 C
ATOM 6377 O VAL B 478 -13.644 63.086 -17.136 1.00172.58 O
ATOM 6378 CB VAL B 478 -11.672 65.185 -17.493 1.00174.48 C
ATOM 6379 CG1 VAL B 478 -11.272 66.621 -17.194 1.00174.68 C
ATOM 6380 CG2 VAL B 478 -10.623 64.510 -18.350 1.00174.68 C
ATOM 6381 N PHE B 479 -12.010 61.980 -16.056 1.00173.66 N
ATOM 6382 CA PHE B 479 -12.677 60.688 -16.151 1.00173.93 C
ATOM 6383 C PHE B 479 -13.926 60.715 -15.276 1.00175.19 C
ATOM 6384 O PHE B 479 -14.010 61.518 -14.345 1.00176.36 O
ATOM 6385 CB PHE B 479 -11.740 59.557 -15.727 1.00173.97 C
ATOM 6386 CG PHE B 479 -12.139 58.207 -16.250 1.00174.04 C
ATOM 6387 CD1 PHE B 479 -12.140 57.951 -17.610 1.00173.60 C
ATOM 6388 CD2 PHE B 479 -12.507 57.192 -15.381 1.00174.24 C
ATOM 6389 CE1 PHE B 479 -12.505 56.709 -18.096 1.00173.70 C
ATOM 6390 CE2 PHE B 479 -12.873 55.949 -15.861 1.00173.57 C
ATOM 6391 CZ PHE B 479 -12.871 55.707 -17.219 1.00173.45 C
ATOM 6392 N SER B 480 -14.893 59.858 -15.603 1.00175.03 N
ATOM 6393 CA SER B 480 -16.196 59.790 -14.927 1.00175.20 C
ATOM 6394 C SER B 480 -17.082 61.009 -15.225 1.00174.35 C
ATOM 6395 O SER B 480 -18.276 61.000 -14.920 1.00173.49 O
ATOM 6396 CB SER B 480 -16.029 59.619 -13.409 1.00175.30 C
ATOM 6397 OG SER B 480 -15.062 58.626 -13.105 1.00174.57 O
ATOM 6398 N GLY B 481 -16.501 62.055 -15.809 1.00174.14 N
ATOM 6399 CA GLY B 481 -17.267 63.222 -16.211 1.00173.50 C
ATOM 6400 C GLY B 481 -16.589 64.560 -15.969 1.00173.31 C
ATOM 6401 O GLY B 481 -15.444 64.619 -15.523 1.00173.43 O
ATOM 6402 N ILE B 482 -17.309 65.639 -16.268 1.00173.78 N
ATOM 6403 CA ILE B 482 -16.808 67.000 -16.086 1.00174.19 C
ATOM 6404 C ILE B 482 -17.652 67.777 -15.071 1.00174.92 C
ATOM 6405 O ILE B 482 -18.447 67.185 -14.344 1.00175.06 O
ATOM 6406 CB ILE B 482 -16.776 67.760 -17.423 1.00173.34 C
ATOM 6407 CG1 ILE B 482 -18.189 67.905 -17.992 1.00173.19 C
ATOM 6408 CG2 ILE B 482 -15.898 67.027 -18.420 1.00172.23 C
ATOM 6409 CD1 ILE B 482 -18.243 68.699 -19.273 1.00172.89 C
ATOM 6410 N ASP B 483 -17.486 69.098 -15.026 1.00174.95 N
ATOM 6411 CA ASP B 483 -18.154 69.911 -14.012 1.00173.72 C
ATOM 6412 C ASP B 483 -18.140 71.411 -14.359 1.00173.69 C
ATOM 6413 O ASP B 483 -17.142 71.905 -14.881 1.00173.73 O
ATOM 6414 CB ASP B 483 -17.495 69.666 -12.649 1.00172.29 C
ATOM 6415 CG ASP B 483 -18.351 68.810 -11.738 1.00173.10 C
ATOM 6416 OD1 ASP B 483 -17.827 68.311 -10.722 1.00173.91 O
ATOM 6417 OD2 ASP B 483 -19.547 68.623 -12.048 1.00173.10 O
ATOM 6418 N PRO B 484 -19.237 72.133 -14.024 1.00173.54 N
ATOM 6419 CA PRO B 484 -19.679 73.496 -14.351 1.00173.52 C
ATOM 6420 C PRO B 484 -18.742 74.459 -15.093 1.00172.82 C
ATOM 6421 O PRO B 484 -18.015 74.072 -16.006 1.00171.52 O
ATOM 6422 CB PRO B 484 -19.995 74.056 -12.962 1.00173.81 C
ATOM 6423 CG PRO B 484 -20.512 72.830 -12.188 1.00172.75 C
ATOM 6424 CD PRO B 484 -20.150 71.590 -13.005 1.00173.07 C
ATOM 6425 N GLU B 485 -18.839 75.732 -14.708 1.00173.91 N
ATOM 6426 CA GLU B 485 -18.163 76.871 -15.345 1.00173.62 C
ATOM 6427 C GLU B 485 -18.598 77.085 -16.801 1.00173.30 C
ATOM 6428 O GLU B 485 -19.207 76.210 -17.416 1.00172.62 O
ATOM 6429 CB GLU B 485 -16.638 76.718 -15.252 1.00173.57 C
ATOM 6430 CG GLU B 485 -15.928 76.388 -16.553 1.00173.93 C
ATOM 6431 CD GLU B 485 -14.431 76.590 -16.458 1.00174.99 C
ATOM 6432 OE1 GLU B 485 -13.833 76.121 -15.470 1.00175.33 O
ATOM 6433 OE2 GLU B 485 -13.857 77.229 -17.364 1.00175.37 O
ATOM 6434 N LEU B 486 -18.287 78.263 -17.340 1.00173.73 N
ATOM 6435 CA LEU B 486 -18.743 78.658 -18.672 1.00173.96 C
ATOM 6436 C LEU B 486 -17.796 79.698 -19.274 1.00174.25 C
ATOM 6437 O LEU B 486 -18.161 80.862 -19.443 1.00174.62 O
ATOM 6438 CB LEU B 486 -20.174 79.206 -18.605 1.00173.44 C
ATOM 6439 CG LEU B 486 -21.034 79.364 -19.868 1.00172.83 C
ATOM 6440 CD1 LEU B 486 -21.436 80.822 -20.076 1.00172.31 C
ATOM 6441 CD2 LEU B 486 -20.373 78.799 -21.124 1.00173.12 C
ATOM 6442 N SER B 487 -16.583 79.262 -19.598 1.00174.23 N
ATOM 6443 CA SER B 487 -15.538 80.150 -20.114 1.00174.54 C
ATOM 6444 C SER B 487 -15.407 80.270 -21.653 1.00175.28 C
ATOM 6445 O SER B 487 -15.503 81.382 -22.172 1.00176.09 O
ATOM 6446 CB SER B 487 -14.184 79.728 -19.529 1.00173.15 C
ATOM 6447 OG SER B 487 -13.821 78.419 -19.933 1.00171.54 O
ATOM 6448 N PRO B 488 -15.227 79.140 -22.379 1.00173.96 N
ATOM 6449 CA PRO B 488 -14.705 79.076 -23.751 1.00173.30 C
ATOM 6450 C PRO B 488 -14.204 80.367 -24.410 1.00174.64 C
ATOM 6451 O PRO B 488 -13.149 80.874 -24.029 1.00175.22 O
ATOM 6452 CB PRO B 488 -15.908 78.525 -24.520 1.00172.28 C
ATOM 6453 CG PRO B 488 -16.626 77.638 -23.491 1.00172.15 C
ATOM 6454 CD PRO B 488 -16.002 77.915 -22.130 1.00173.02 C
ATOM 6455 N GLU B 489 -14.952 80.880 -25.383 1.00175.17 N
ATOM 6456 CA GLU B 489 -14.433 81.859 -26.344 1.00175.06 C
ATOM 6457 C GLU B 489 -14.026 83.223 -25.778 1.00175.90 C
ATOM 6458 O GLU B 489 -14.520 84.257 -26.233 1.00174.50 O
ATOM 6459 CB GLU B 489 -15.466 82.077 -27.451 1.00173.84 C
ATOM 6460 CG GLU B 489 -16.040 80.793 -28.020 1.00174.39 C
ATOM 6461 CD GLU B 489 -15.064 80.070 -28.925 1.00174.02 C
ATOM 6462 OE1 GLU B 489 -14.133 80.726 -29.438 1.00174.25 O
ATOM 6463 OE2 GLU B 489 -15.231 78.849 -29.129 1.00172.75 O
ATOM 6464 N GLN B 490 -13.113 83.215 -24.808 1.00177.13 N
ATOM 6465 CA GLN B 490 -12.494 84.437 -24.293 1.00176.70 C
ATOM 6466 C GLN B 490 -11.276 84.100 -23.428 1.00175.75 C
ATOM 6467 O GLN B 490 -11.411 83.579 -22.320 1.00174.35 O
ATOM 6468 CB GLN B 490 -13.504 85.282 -23.502 1.00175.35 C
ATOM 6469 CG GLN B 490 -14.343 84.521 -22.484 1.00174.34 C
ATOM 6470 CD GLN B 490 -14.022 84.918 -21.057 1.00173.69 C
ATOM 6471 OE1 GLN B 490 -14.908 85.301 -20.293 1.00174.54 O
ATOM 6472 NE2 GLN B 490 -12.750 84.825 -20.689 1.00173.84 N
ATOM 6473 N VAL B 491 -10.088 84.380 -23.963 1.00176.31 N
ATOM 6474 CA VAL B 491 -8.822 84.107 -23.280 1.00174.98 C
ATOM 6475 C VAL B 491 -8.786 84.683 -21.864 1.00175.10 C
ATOM 6476 O VAL B 491 -8.814 83.941 -20.882 1.00175.42 O
ATOM 6477 CB VAL B 491 -7.623 84.667 -24.074 1.00172.79 C
ATOM 6478 CG1 VAL B 491 -7.653 86.188 -24.087 1.00172.95 C
ATOM 6479 CG2 VAL B 491 -6.314 84.160 -23.487 1.00171.53 C
TER 6480 VAL B 491
ATOM 6481 N ASP C 27 -45.291 92.574 -44.446 1.00174.94 N
ATOM 6482 CA ASP C 27 -46.490 91.908 -43.951 1.00175.41 C
ATOM 6483 C ASP C 27 -46.143 90.565 -43.312 1.00175.42 C
ATOM 6484 O ASP C 27 -46.505 90.302 -42.164 1.00174.69 O
ATOM 6485 CB ASP C 27 -47.503 91.720 -45.084 1.00175.56 C
ATOM 6486 CG ASP C 27 -48.690 90.868 -44.674 1.00175.29 C
ATOM 6487 OD1 ASP C 27 -48.605 89.627 -44.795 1.00175.31 O
ATOM 6488 OD2 ASP C 27 -49.707 91.439 -44.228 1.00175.27 O
ATOM 6489 N GLN C 28 -45.437 89.720 -44.059 1.00175.89 N
ATOM 6490 CA GLN C 28 -45.025 88.414 -43.557 1.00175.16 C
ATOM 6491 C GLN C 28 -43.505 88.300 -43.494 1.00174.47 C
ATOM 6492 O GLN C 28 -42.800 88.635 -44.450 1.00173.86 O
ATOM 6493 CB GLN C 28 -45.602 87.292 -44.425 1.00175.22 C
ATOM 6494 CG GLN C 28 -47.014 86.844 -44.045 1.00174.93 C
ATOM 6495 CD GLN C 28 -47.060 85.990 -42.784 1.00174.27 C
ATOM 6496 OE1 GLN C 28 -46.541 86.371 -41.734 1.00173.11 O
ATOM 6497 NE2 GLN C 28 -47.691 84.825 -42.887 1.00174.28 N
ATOM 6498 N GLU C 29 -43.010 87.827 -42.354 1.00174.67 N
ATOM 6499 CA GLU C 29 -41.577 87.705 -42.119 1.00174.63 C
ATOM 6500 C GLU C 29 -41.275 86.521 -41.203 1.00174.63 C
ATOM 6501 O GLU C 29 -41.996 85.522 -41.209 1.00174.35 O
ATOM 6502 CB GLU C 29 -41.020 89.002 -41.526 1.00174.84 C
ATOM 6503 CG GLU C 29 -42.022 89.801 -40.705 1.00175.58 C
ATOM 6504 CD GLU C 29 -42.438 89.086 -39.436 1.00176.63 C
ATOM 6505 OE1 GLU C 29 -43.638 89.134 -39.087 1.00176.29 O
ATOM 6506 OE2 GLU C 29 -41.560 88.482 -38.783 1.00177.17 O
ATOM 6507 N SER C 30 -40.201 86.636 -40.427 1.00174.57 N
ATOM 6508 CA SER C 30 -39.770 85.574 -39.521 1.00174.68 C
ATOM 6509 C SER C 30 -40.849 85.164 -38.514 1.00174.53 C
ATOM 6510 O SER C 30 -40.882 84.018 -38.067 1.00174.49 O
ATOM 6511 CB SER C 30 -38.505 86.006 -38.774 1.00175.25 C
ATOM 6512 OG SER C 30 -38.002 84.950 -37.974 1.00176.21 O
ATOM 6513 N SER C 31 -41.726 86.098 -38.160 1.00174.24 N
ATOM 6514 CA SER C 31 -42.805 85.814 -37.217 1.00173.40 C
ATOM 6515 C SER C 31 -43.988 85.156 -37.922 1.00173.47 C
ATOM 6516 O SER C 31 -45.119 85.641 -37.859 1.00173.23 O
ATOM 6517 CB SER C 31 -43.254 87.092 -36.507 1.00172.89 C
ATOM 6518 OG SER C 31 -42.279 87.523 -35.572 1.00171.50 O
ATOM 6519 N GLY C 32 -43.707 84.048 -38.599 1.00173.58 N
ATOM 6520 CA GLY C 32 -44.722 83.250 -39.261 1.00174.47 C
ATOM 6521 C GLY C 32 -44.125 81.908 -39.635 1.00175.38 C
ATOM 6522 O GLY C 32 -44.620 80.856 -39.230 1.00175.88 O
ATOM 6523 N PHE C 33 -43.047 81.958 -40.411 1.00175.41 N
ATOM 6524 CA PHE C 33 -42.261 80.778 -40.753 1.00175.14 C
ATOM 6525 C PHE C 33 -40.801 81.184 -40.925 1.00175.02 C
ATOM 6526 O PHE C 33 -40.470 82.368 -40.851 1.00175.06 O
ATOM 6527 CB PHE C 33 -42.784 80.118 -42.033 1.00174.35 C
ATOM 6528 CG PHE C 33 -43.990 79.245 -41.823 1.00174.31 C
ATOM 6529 CD1 PHE C 33 -43.852 77.956 -41.335 1.00173.48 C
ATOM 6530 CD2 PHE C 33 -45.261 79.713 -42.116 1.00174.41 C
ATOM 6531 CE1 PHE C 33 -44.960 77.151 -41.144 1.00173.22 C
ATOM 6532 CE2 PHE C 33 -46.372 78.913 -41.923 1.00173.56 C
ATOM 6533 CZ PHE C 33 -46.221 77.631 -41.437 1.00173.31 C
ATOM 6534 N ALA C 34 -39.929 80.207 -41.152 1.00174.64 N
ATOM 6535 CA ALA C 34 -38.534 80.500 -41.458 1.00174.09 C
ATOM 6536 C ALA C 34 -38.393 80.851 -42.934 1.00174.57 C
ATOM 6537 O ALA C 34 -39.298 80.591 -43.728 1.00174.64 O
ATOM 6538 CB ALA C 34 -37.644 79.325 -41.100 1.00174.30 C
ATOM 6539 N TRP C 35 -37.260 81.448 -43.294 1.00174.67 N
ATOM 6540 CA TRP C 35 -36.993 81.837 -44.677 1.00175.01 C
ATOM 6541 C TRP C 35 -37.054 80.636 -45.626 1.00174.52 C
ATOM 6542 O TRP C 35 -37.613 80.728 -46.720 1.00173.23 O
ATOM 6543 CB TRP C 35 -35.631 82.538 -44.783 1.00175.29 C
ATOM 6544 CG TRP C 35 -34.448 81.618 -44.674 1.00175.57 C
ATOM 6545 CD1 TRP C 35 -33.783 81.267 -43.534 1.00175.19 C
ATOM 6546 CD2 TRP C 35 -33.788 80.937 -45.749 1.00175.13 C
ATOM 6547 NE1 TRP C 35 -32.754 80.406 -43.833 1.00175.26 N
ATOM 6548 CE2 TRP C 35 -32.737 80.187 -45.187 1.00174.59 C
ATOM 6549 CE3 TRP C 35 -33.989 80.885 -47.132 1.00174.14 C
ATOM 6550 CZ2 TRP C 35 -31.888 79.396 -45.958 1.00173.50 C
ATOM 6551 CZ3 TRP C 35 -33.145 80.100 -47.897 1.00174.16 C
ATOM 6552 CH2 TRP C 35 -32.107 79.366 -47.307 1.00173.85 C
ATOM 6553 N TRP C 36 -36.478 79.514 -45.202 1.00174.63 N
ATOM 6554 CA TRP C 36 -36.440 78.303 -46.019 1.00173.59 C
ATOM 6555 C TRP C 36 -37.790 77.592 -46.056 1.00172.77 C
ATOM 6556 O TRP C 36 -37.926 76.531 -46.664 1.00172.47 O
ATOM 6557 CB TRP C 36 -35.360 77.347 -45.505 1.00173.77 C
ATOM 6558 CG TRP C 36 -35.394 77.128 -44.021 1.00174.31 C
ATOM 6559 CD1 TRP C 36 -34.616 77.744 -43.083 1.00174.14 C
ATOM 6560 CD2 TRP C 36 -36.245 76.225 -43.305 1.00174.41 C
ATOM 6561 NE1 TRP C 36 -34.934 77.284 -41.828 1.00173.44 N
ATOM 6562 CE2 TRP C 36 -35.930 76.349 -41.937 1.00174.23 C
ATOM 6563 CE3 TRP C 36 -37.244 75.323 -43.688 1.00174.16 C
ATOM 6564 CZ2 TRP C 36 -36.578 75.608 -40.951 1.00174.73 C
ATOM 6565 CZ3 TRP C 36 -37.886 74.588 -42.708 1.00174.41 C
ATOM 6566 CH2 TRP C 36 -37.550 74.735 -41.356 1.00175.09 C
ATOM 6567 N ALA C 37 -38.780 78.174 -45.390 1.00172.96 N
ATOM 6568 CA ALA C 37 -40.147 77.668 -45.424 1.00173.07 C
ATOM 6569 C ALA C 37 -41.086 78.804 -45.812 1.00173.64 C
ATOM 6570 O ALA C 37 -42.282 78.766 -45.530 1.00174.41 O
ATOM 6571 CB ALA C 37 -40.539 77.075 -44.081 1.00172.86 C
ATOM 6572 N GLY C 38 -40.506 79.819 -46.448 1.00173.56 N
ATOM 6573 CA GLY C 38 -41.206 81.022 -46.860 1.00174.03 C
ATOM 6574 C GLY C 38 -42.573 80.866 -47.504 1.00174.63 C
ATOM 6575 O GLY C 38 -43.521 81.541 -47.108 1.00175.32 O
ATOM 6576 N ASN C 39 -42.679 79.985 -48.495 1.00173.87 N
ATOM 6577 CA ASN C 39 -43.931 79.790 -49.222 1.00173.69 C
ATOM 6578 C ASN C 39 -45.083 79.270 -48.363 1.00173.75 C
ATOM 6579 O ASN C 39 -46.234 79.266 -48.799 1.00173.55 O
ATOM 6580 CB ASN C 39 -43.709 78.836 -50.395 1.00173.74 C
ATOM 6581 CG ASN C 39 -42.788 79.413 -51.450 1.00173.26 C
ATOM 6582 OD1 ASN C 39 -43.142 80.366 -52.140 1.00173.10 O
ATOM 6583 ND2 ASN C 39 -41.591 78.848 -51.568 1.00173.24 N
ATOM 6584 N ALA C 40 -44.777 78.853 -47.139 1.00174.20 N
ATOM 6585 CA ALA C 40 -45.807 78.401 -46.211 1.00174.16 C
ATOM 6586 C ALA C 40 -46.465 79.580 -45.501 1.00173.78 C
ATOM 6587 O ALA C 40 -47.464 79.416 -44.803 1.00172.68 O
ATOM 6588 CB ALA C 40 -45.221 77.432 -45.197 1.00174.62 C
ATOM 6589 N ARG C 41 -45.902 80.770 -45.680 1.00174.29 N
ATOM 6590 CA ARG C 41 -46.482 81.982 -45.115 1.00173.91 C
ATOM 6591 C ARG C 41 -47.678 82.420 -45.950 1.00173.58 C
ATOM 6592 O ARG C 41 -48.412 83.335 -45.578 1.00173.26 O
ATOM 6593 CB ARG C 41 -45.444 83.104 -45.055 1.00174.36 C
ATOM 6594 CG ARG C 41 -44.213 82.795 -44.211 1.00174.71 C
ATOM 6595 CD ARG C 41 -43.087 83.777 -44.522 1.00174.93 C
ATOM 6596 NE ARG C 41 -41.893 83.540 -43.715 1.00175.11 N
ATOM 6597 CZ ARG C 41 -40.745 84.195 -43.867 1.00174.88 C
ATOM 6598 NH1 ARG C 41 -40.630 85.132 -44.799 1.00174.28 N
ATOM 6599 NH2 ARG C 41 -39.710 83.914 -43.087 1.00175.07 N
ATOM 6600 N LEU C 42 -47.859 81.754 -47.086 1.00173.66 N
ATOM 6601 CA LEU C 42 -48.896 82.109 -48.046 1.00174.55 C
ATOM 6602 C LEU C 42 -50.094 81.171 -47.981 1.00174.68 C
ATOM 6603 O LEU C 42 -50.995 81.251 -48.816 1.00174.83 O
ATOM 6604 CB LEU C 42 -48.317 82.107 -49.461 1.00174.50 C
ATOM 6605 CG LEU C 42 -47.132 83.046 -49.678 1.00174.29 C
ATOM 6606 CD1 LEU C 42 -46.200 82.491 -50.737 1.00174.18 C
ATOM 6607 CD2 LEU C 42 -47.623 84.431 -50.063 1.00174.26 C
ATOM 6608 N ILE C 43 -50.095 80.279 -46.995 1.00174.19 N
ATOM 6609 CA ILE C 43 -51.182 79.320 -46.824 1.00174.63 C
ATOM 6610 C ILE C 43 -52.525 80.028 -46.631 1.00175.06 C
ATOM 6611 O ILE C 43 -53.561 79.557 -47.105 1.00174.30 O
ATOM 6612 CB ILE C 43 -50.907 78.383 -45.625 1.00174.93 C
ATOM 6613 CG1 ILE C 43 -49.695 77.496 -45.916 1.00174.78 C
ATOM 6614 CG2 ILE C 43 -52.128 77.529 -45.297 1.00174.68 C
ATOM 6615 CD1 ILE C 43 -49.323 76.580 -44.773 1.00175.16 C
ATOM 6616 N ASN C 44 -52.498 81.179 -45.965 1.00175.84 N
ATOM 6617 CA ASN C 44 -53.720 81.932 -45.699 1.00175.61 C
ATOM 6618 C ASN C 44 -53.681 83.323 -46.323 1.00174.94 C
ATOM 6619 O ASN C 44 -54.112 84.302 -45.715 1.00174.75 O
ATOM 6620 CB ASN C 44 -53.962 82.047 -44.190 1.00175.92 C
ATOM 6621 CG ASN C 44 -54.055 80.696 -43.505 1.00175.74 C
ATOM 6622 OD1 ASN C 44 -54.807 79.818 -43.932 1.00175.58 O
ATOM 6623 ND2 ASN C 44 -53.294 80.526 -42.431 1.00175.63 N
ATOM 6624 N LEU C 45 -53.160 83.394 -47.544 1.00174.67 N
ATOM 6625 CA LEU C 45 -53.084 84.641 -48.299 1.00174.36 C
ATOM 6626 C LEU C 45 -53.548 84.399 -49.730 1.00174.10 C
ATOM 6627 O LEU C 45 -52.779 84.579 -50.677 1.00174.21 O
ATOM 6628 CB LEU C 45 -51.662 85.214 -48.293 1.00174.38 C
ATOM 6629 CG LEU C 45 -51.162 86.050 -47.106 1.00173.94 C
ATOM 6630 CD1 LEU C 45 -50.981 85.229 -45.839 1.00173.28 C
ATOM 6631 CD2 LEU C 45 -49.863 86.763 -47.467 1.00173.75 C
ATOM 6632 N SER C 46 -54.805 83.969 -49.857 1.00174.52 N
ATOM 6633 CA SER C 46 -55.455 83.633 -51.129 1.00174.64 C
ATOM 6634 C SER C 46 -55.006 84.470 -52.327 1.00174.95 C
ATOM 6635 O SER C 46 -54.742 83.932 -53.403 1.00174.85 O
ATOM 6636 CB SER C 46 -56.975 83.753 -50.976 1.00174.37 C
ATOM 6637 OG SER C 46 -57.343 85.029 -50.485 1.00174.47 O
ATOM 6638 N GLY C 47 -54.940 85.785 -52.138 1.00175.09 N
ATOM 6639 CA GLY C 47 -54.496 86.693 -53.181 1.00174.68 C
ATOM 6640 C GLY C 47 -53.107 86.377 -53.702 1.00174.85 C
ATOM 6641 O GLY C 47 -52.932 86.063 -54.881 1.00174.40 O
ATOM 6642 N LYS C 48 -52.120 86.466 -52.818 1.00175.14 N
ATOM 6643 CA LYS C 48 -50.737 86.170 -53.169 1.00175.25 C
ATOM 6644 C LYS C 48 -50.551 84.699 -53.530 1.00175.61 C
ATOM 6645 O LYS C 48 -49.735 84.363 -54.388 1.00175.65 O
ATOM 6646 CB LYS C 48 -49.801 86.550 -52.022 1.00173.68 C
ATOM 6647 CG LYS C 48 -49.675 88.047 -51.800 1.00173.21 C
ATOM 6648 CD LYS C 48 -48.621 88.363 -50.755 1.00173.19 C
ATOM 6649 CE LYS C 48 -48.294 89.847 -50.741 1.00172.94 C
ATOM 6650 NZ LYS C 48 -47.726 90.319 -52.031 1.00172.60 N
ATOM 6651 N LEU C 49 -51.310 83.826 -52.875 1.00175.65 N
ATOM 6652 CA LEU C 49 -51.226 82.395 -53.143 1.00175.21 C
ATOM 6653 C LEU C 49 -51.754 82.072 -54.541 1.00175.06 C
ATOM 6654 O LEU C 49 -51.470 81.009 -55.093 1.00175.08 O
ATOM 6655 CB LEU C 49 -52.001 81.605 -52.085 1.00174.93 C
ATOM 6656 CG LEU C 49 -51.814 80.086 -52.081 1.00174.55 C
ATOM 6657 CD1 LEU C 49 -50.334 79.746 -52.003 1.00174.22 C
ATOM 6658 CD2 LEU C 49 -52.584 79.435 -50.940 1.00174.06 C
ATOM 6659 N LEU C 50 -52.503 83.005 -55.118 1.00174.55 N
ATOM 6660 CA LEU C 50 -53.002 82.850 -56.477 1.00173.86 C
ATOM 6661 C LEU C 50 -51.918 83.278 -57.453 1.00174.84 C
ATOM 6662 O LEU C 50 -51.729 82.658 -58.499 1.00175.89 O
ATOM 6663 CB LEU C 50 -54.276 83.668 -56.694 1.00173.19 C
ATOM 6664 CG LEU C 50 -54.818 83.694 -58.125 1.00172.76 C
ATOM 6665 CD1 LEU C 50 -55.227 82.301 -58.577 1.00172.48 C
ATOM 6666 CD2 LEU C 50 -55.979 84.667 -58.254 1.00172.55 C
ATOM 6667 N GLY C 51 -51.205 84.342 -57.091 1.00174.66 N
ATOM 6668 CA GLY C 51 -50.093 84.847 -57.878 1.00174.72 C
ATOM 6669 C GLY C 51 -49.027 83.801 -58.131 1.00175.15 C
ATOM 6670 O GLY C 51 -48.541 83.663 -59.252 1.00175.78 O
ATOM 6671 N ALA C 52 -48.661 83.075 -57.079 1.00174.32 N
ATOM 6672 CA ALA C 52 -47.693 81.988 -57.178 1.00174.00 C
ATOM 6673 C ALA C 52 -48.109 80.963 -58.234 1.00174.49 C
ATOM 6674 O ALA C 52 -47.356 80.680 -59.163 1.00174.23 O
ATOM 6675 CB ALA C 52 -47.519 81.313 -55.826 1.00173.28 C
ATOM 6676 N HIS C 53 -49.314 80.420 -58.081 1.00174.63 N
ATOM 6677 CA HIS C 53 -49.848 79.401 -58.982 1.00174.09 C
ATOM 6678 C HIS C 53 -49.964 79.870 -60.429 1.00174.28 C
ATOM 6679 O HIS C 53 -49.896 79.067 -61.358 1.00174.34 O
ATOM 6680 CB HIS C 53 -51.228 78.955 -58.504 1.00173.42 C
ATOM 6681 CG HIS C 53 -51.216 78.248 -57.187 1.00174.42 C
ATOM 6682 ND1 HIS C 53 -51.011 78.901 -55.992 1.00175.26 N
ATOM 6683 CD2 HIS C 53 -51.409 76.945 -56.877 1.00174.47 C
ATOM 6684 CE1 HIS C 53 -51.066 78.028 -55.001 1.00175.14 C
ATOM 6685 NE2 HIS C 53 -51.305 76.834 -55.513 1.00174.52 N
ATOM 6686 N VAL C 54 -50.151 81.172 -60.612 1.00174.54 N
ATOM 6687 CA VAL C 54 -50.272 81.743 -61.947 1.00174.44 C
ATOM 6688 C VAL C 54 -48.894 82.049 -62.531 1.00174.36 C
ATOM 6689 O VAL C 54 -48.665 81.879 -63.730 1.00174.46 O
ATOM 6690 CB VAL C 54 -51.141 83.022 -61.920 1.00174.95 C
ATOM 6691 CG1 VAL C 54 -51.104 83.735 -63.257 1.00174.76 C
ATOM 6692 CG2 VAL C 54 -52.578 82.675 -61.552 1.00175.48 C
ATOM 6693 N ALA C 55 -47.971 82.464 -61.671 1.00174.35 N
ATOM 6694 CA ALA C 55 -46.604 82.751 -62.088 1.00174.49 C
ATOM 6695 C ALA C 55 -45.882 81.444 -62.370 1.00174.51 C
ATOM 6696 O ALA C 55 -45.072 81.347 -63.291 1.00175.08 O
ATOM 6697 CB ALA C 55 -45.869 83.549 -61.023 1.00174.49 C
ATOM 6698 N HIS C 56 -46.183 80.444 -61.549 1.00173.76 N
ATOM 6699 CA HIS C 56 -45.642 79.106 -61.712 1.00173.39 C
ATOM 6700 C HIS C 56 -46.117 78.463 -63.007 1.00173.65 C
ATOM 6701 O HIS C 56 -45.320 77.903 -63.761 1.00173.45 O
ATOM 6702 CB HIS C 56 -46.042 78.226 -60.533 1.00173.62 C
ATOM 6703 CG HIS C 56 -45.486 76.840 -60.604 1.00173.88 C
ATOM 6704 ND1 HIS C 56 -45.960 75.889 -61.482 1.00173.25 N
ATOM 6705 CD2 HIS C 56 -44.491 76.245 -59.906 1.00174.15 C
ATOM 6706 CE1 HIS C 56 -45.278 74.769 -61.325 1.00173.67 C
ATOM 6707 NE2 HIS C 56 -44.384 74.958 -60.372 1.00173.81 N
ATOM 6708 N ALA C 57 -47.426 78.525 -63.240 1.00174.19 N
ATOM 6709 CA ALA C 57 -48.033 77.985 -64.455 1.00174.41 C
ATOM 6710 C ALA C 57 -47.434 78.603 -65.712 1.00173.72 C
ATOM 6711 O ALA C 57 -47.457 77.997 -66.782 1.00172.92 O
ATOM 6712 CB ALA C 57 -49.537 78.200 -64.433 1.00174.89 C
ATOM 6713 N GLY C 58 -46.895 79.810 -65.573 1.00173.91 N
ATOM 6714 CA GLY C 58 -46.231 80.481 -66.672 1.00173.46 C
ATOM 6715 C GLY C 58 -44.897 79.833 -66.966 1.00173.83 C
ATOM 6716 O GLY C 58 -44.509 79.695 -68.125 1.00174.04 O
ATOM 6717 N LEU C 59 -44.199 79.431 -65.907 1.00173.93 N
ATOM 6718 CA LEU C 59 -42.913 78.754 -66.038 1.00173.93 C
ATOM 6719 C LEU C 59 -43.051 77.447 -66.812 1.00173.94 C
ATOM 6720 O LEU C 59 -42.157 77.066 -67.568 1.00174.25 O
ATOM 6721 CB LEU C 59 -42.307 78.479 -64.662 1.00173.80 C
ATOM 6722 CG LEU C 59 -41.964 79.693 -63.798 1.00174.00 C
ATOM 6723 CD1 LEU C 59 -41.609 79.258 -62.384 1.00174.00 C
ATOM 6724 CD2 LEU C 59 -40.830 80.493 -64.420 1.00173.85 C
ATOM 6725 N ILE C 60 -44.171 76.761 -66.612 1.00173.66 N
ATOM 6726 CA ILE C 60 -44.427 75.502 -67.302 1.00173.67 C
ATOM 6727 C ILE C 60 -44.682 75.761 -68.782 1.00174.07 C
ATOM 6728 O ILE C 60 -44.177 75.041 -69.645 1.00174.39 O
ATOM 6729 CB ILE C 60 -45.626 74.751 -66.694 1.00173.65 C
ATOM 6730 CG1 ILE C 60 -45.403 74.512 -65.201 1.00174.40 C
ATOM 6731 CG2 ILE C 60 -45.847 73.428 -67.410 1.00173.69 C
ATOM 6732 CD1 ILE C 60 -46.525 73.751 -64.528 1.00174.62 C
ATOM 6733 N VAL C 61 -45.465 76.797 -69.068 1.00174.09 N
ATOM 6734 CA VAL C 61 -45.745 77.185 -70.445 1.00174.23 C
ATOM 6735 C VAL C 61 -44.476 77.723 -71.102 1.00173.82 C
ATOM 6736 O VAL C 61 -44.197 77.430 -72.265 1.00173.88 O
ATOM 6737 CB VAL C 61 -46.861 78.248 -70.531 1.00174.14 C
ATOM 6738 CG1 VAL C 61 -47.184 78.548 -71.975 1.00174.00 C
ATOM 6739 CG2 VAL C 61 -48.109 77.767 -69.830 1.00173.99 C
ATOM 6740 N PHE C 62 -43.715 78.512 -70.346 1.00173.80 N
ATOM 6741 CA PHE C 62 -42.445 79.062 -70.818 1.00173.58 C
ATOM 6742 C PHE C 62 -41.491 77.968 -71.279 1.00173.21 C
ATOM 6743 O PHE C 62 -40.945 78.040 -72.379 1.00173.49 O
ATOM 6744 CB PHE C 62 -41.778 79.898 -69.723 1.00174.26 C
ATOM 6745 CG PHE C 62 -40.526 80.596 -70.173 1.00174.04 C
ATOM 6746 CD1 PHE C 62 -40.592 81.843 -70.771 1.00174.46 C
ATOM 6747 CD2 PHE C 62 -39.283 80.011 -69.992 1.00173.22 C
ATOM 6748 CE1 PHE C 62 -39.446 82.490 -71.187 1.00174.18 C
ATOM 6749 CE2 PHE C 62 -38.133 80.654 -70.407 1.00173.42 C
ATOM 6750 CZ PHE C 62 -38.215 81.895 -71.004 1.00173.97 C
ATOM 6751 N TRP C 63 -41.283 76.969 -70.426 1.00173.29 N
ATOM 6752 CA TRP C 63 -40.409 75.848 -70.756 1.00173.80 C
ATOM 6753 C TRP C 63 -40.862 75.158 -72.035 1.00173.63 C
ATOM 6754 O TRP C 63 -40.111 75.095 -73.006 1.00173.97 O
ATOM 6755 CB TRP C 63 -40.361 74.836 -69.611 1.00174.49 C
ATOM 6756 CG TRP C 63 -39.484 73.658 -69.915 1.00174.66 C
ATOM 6757 CD1 TRP C 63 -38.125 73.598 -69.801 1.00173.84 C
ATOM 6758 CD2 TRP C 63 -39.903 72.376 -70.400 1.00174.73 C
ATOM 6759 NE1 TRP C 63 -37.673 72.356 -70.180 1.00173.51 N
ATOM 6760 CE2 TRP C 63 -38.746 71.587 -70.552 1.00174.16 C
ATOM 6761 CE3 TRP C 63 -41.146 71.817 -70.719 1.00174.40 C
ATOM 6762 CZ2 TRP C 63 -38.791 70.272 -71.008 1.00173.82 C
ATOM 6763 CZ3 TRP C 63 -41.190 70.510 -71.172 1.00173.92 C
ATOM 6764 CH2 TRP C 63 -40.020 69.752 -71.311 1.00173.74 C
ATOM 6765 N ALA C 64 -42.090 74.645 -72.019 1.00173.09 N
ATOM 6766 CA ALA C 64 -42.697 73.984 -73.173 1.00173.23 C
ATOM 6767 C ALA C 64 -42.477 74.758 -74.471 1.00173.75 C
ATOM 6768 O ALA C 64 -42.124 74.180 -75.498 1.00173.91 O
ATOM 6769 CB ALA C 64 -44.186 73.779 -72.930 1.00173.99 C
ATOM 6770 N GLY C 65 -42.683 76.070 -74.413 1.00174.07 N
ATOM 6771 CA GLY C 65 -42.475 76.930 -75.563 1.00174.29 C
ATOM 6772 C GLY C 65 -41.018 77.096 -75.954 1.00174.14 C
ATOM 6773 O GLY C 65 -40.627 76.770 -77.075 1.00173.95 O
ATOM 6774 N ALA C 66 -40.216 77.611 -75.026 1.00174.37 N
ATOM 6775 CA ALA C 66 -38.803 77.889 -75.279 1.00173.86 C
ATOM 6776 C ALA C 66 -38.008 76.635 -75.635 1.00173.06 C
ATOM 6777 O ALA C 66 -37.030 76.704 -76.379 1.00172.58 O
ATOM 6778 CB ALA C 66 -38.181 78.574 -74.069 1.00174.58 C
ATOM 6779 N MET C 67 -38.430 75.490 -75.106 1.00172.84 N
ATOM 6780 CA MET C 67 -37.730 74.234 -75.355 1.00173.08 C
ATOM 6781 C MET C 67 -38.036 73.700 -76.745 1.00173.19 C
ATOM 6782 O MET C 67 -37.150 73.195 -77.434 1.00173.58 O
ATOM 6783 CB MET C 67 -38.104 73.187 -74.308 1.00174.29 C
ATOM 6784 CG MET C 67 -37.377 71.867 -74.470 1.00175.51 C
ATOM 6785 SD MET C 67 -35.613 71.997 -74.143 1.00177.32 S
ATOM 6786 CE MET C 67 -35.489 70.929 -72.718 1.00174.18 C
ATOM 6787 N THR C 68 -39.300 73.804 -77.142 1.00173.12 N
ATOM 6788 CA THR C 68 -39.731 73.379 -78.468 1.00173.72 C
ATOM 6789 C THR C 68 -38.935 74.102 -79.550 1.00174.08 C
ATOM 6790 O THR C 68 -38.466 73.485 -80.507 1.00173.79 O
ATOM 6791 CB THR C 68 -41.230 73.638 -78.679 1.00174.22 C
ATOM 6792 OG1 THR C 68 -41.981 72.968 -77.658 1.00174.37 O
ATOM 6793 CG2 THR C 68 -41.671 73.134 -80.045 1.00174.71 C
ATOM 6794 N LEU C 69 -38.787 75.413 -79.388 1.00174.37 N
ATOM 6795 CA LEU C 69 -38.002 76.217 -80.318 1.00174.31 C
ATOM 6796 C LEU C 69 -36.527 75.837 -80.264 1.00174.54 C
ATOM 6797 O LEU C 69 -35.826 75.894 -81.272 1.00174.77 O
ATOM 6798 CB LEU C 69 -38.171 77.705 -80.017 1.00174.05 C
ATOM 6799 CG LEU C 69 -39.601 78.232 -80.116 1.00174.90 C
ATOM 6800 CD1 LEU C 69 -39.660 79.700 -79.726 1.00175.15 C
ATOM 6801 CD2 LEU C 69 -40.144 78.016 -81.519 1.00174.60 C
ATOM 6802 N PHE C 70 -36.062 75.457 -79.078 1.00174.53 N
ATOM 6803 CA PHE C 70 -34.687 75.005 -78.902 1.00174.31 C
ATOM 6804 C PHE C 70 -34.455 73.692 -79.640 1.00174.38 C
ATOM 6805 O PHE C 70 -33.442 73.518 -80.318 1.00174.20 O
ATOM 6806 CB PHE C 70 -34.362 74.844 -77.416 1.00173.95 C
ATOM 6807 CG PHE C 70 -32.940 74.440 -77.145 1.00173.88 C
ATOM 6808 CD1 PHE C 70 -31.926 75.384 -77.139 1.00174.20 C
ATOM 6809 CD2 PHE C 70 -32.618 73.117 -76.889 1.00173.94 C
ATOM 6810 CE1 PHE C 70 -30.617 75.013 -76.888 1.00174.27 C
ATOM 6811 CE2 PHE C 70 -31.312 72.741 -76.639 1.00173.79 C
ATOM 6812 CZ PHE C 70 -30.310 73.690 -76.638 1.00173.62 C
ATOM 6813 N GLU C 71 -35.404 72.771 -79.496 1.00174.35 N
ATOM 6814 CA GLU C 71 -35.358 71.486 -80.183 1.00174.06 C
ATOM 6815 C GLU C 71 -35.400 71.664 -81.699 1.00173.90 C
ATOM 6816 O GLU C 71 -34.579 71.095 -82.418 1.00173.78 O
ATOM 6817 CB GLU C 71 -36.512 70.591 -79.721 1.00173.74 C
ATOM 6818 CG GLU C 71 -36.301 69.966 -78.348 1.00173.66 C
ATOM 6819 CD GLU C 71 -37.366 68.944 -77.998 1.00173.70 C
ATOM 6820 OE1 GLU C 71 -37.897 68.293 -78.921 1.00173.60 O
ATOM 6821 OE2 GLU C 71 -37.668 68.790 -76.796 1.00173.98 O
ATOM 6822 N LEU C 72 -36.362 72.450 -82.175 1.00173.35 N
ATOM 6823 CA LEU C 72 -36.495 72.738 -83.601 1.00172.60 C
ATOM 6824 C LEU C 72 -35.236 73.377 -84.182 1.00173.18 C
ATOM 6825 O LEU C 72 -34.816 73.040 -85.288 1.00173.20 O
ATOM 6826 CB LEU C 72 -37.697 73.651 -83.851 1.00172.38 C
ATOM 6827 CG LEU C 72 -37.985 73.952 -85.323 1.00172.88 C
ATOM 6828 CD1 LEU C 72 -38.505 72.711 -86.028 1.00173.14 C
ATOM 6829 CD2 LEU C 72 -38.966 75.105 -85.459 1.00173.95 C
ATOM 6830 N ALA C 73 -34.641 74.298 -83.428 1.00173.59 N
ATOM 6831 CA ALA C 73 -33.430 74.996 -83.857 1.00173.52 C
ATOM 6832 C ALA C 73 -32.270 74.034 -84.104 1.00173.47 C
ATOM 6833 O ALA C 73 -31.355 74.336 -84.870 1.00173.43 O
ATOM 6834 CB ALA C 73 -33.030 76.043 -82.828 1.00173.79 C
ATOM 6835 N HIS C 74 -32.310 72.880 -83.447 1.00173.61 N
ATOM 6836 CA HIS C 74 -31.277 71.863 -83.608 1.00173.80 C
ATOM 6837 C HIS C 74 -31.776 70.698 -84.456 1.00173.82 C
ATOM 6838 O HIS C 74 -30.986 69.879 -84.926 1.00174.23 O
ATOM 6839 CB HIS C 74 -30.805 71.351 -82.243 1.00173.20 C
ATOM 6840 CG HIS C 74 -30.209 72.412 -81.372 1.00173.07 C
ATOM 6841 ND1 HIS C 74 -30.968 73.388 -80.764 1.00173.36 N
ATOM 6842 CD2 HIS C 74 -28.928 72.648 -81.004 1.00173.07 C
ATOM 6843 CE1 HIS C 74 -30.179 74.182 -80.062 1.00173.27 C
ATOM 6844 NE2 HIS C 74 -28.936 73.754 -80.189 1.00173.11 N
ATOM 6845 N PHE C 75 -33.091 70.626 -84.634 1.00173.56 N
ATOM 6846 CA PHE C 75 -33.715 69.519 -85.350 1.00173.48 C
ATOM 6847 C PHE C 75 -33.195 69.336 -86.774 1.00173.56 C
ATOM 6848 O PHE C 75 -33.158 70.280 -87.564 1.00173.41 O
ATOM 6849 CB PHE C 75 -35.231 69.701 -85.389 1.00173.64 C
ATOM 6850 CG PHE C 75 -35.947 68.606 -86.122 1.00174.04 C
ATOM 6851 CD1 PHE C 75 -36.050 67.343 -85.569 1.00173.72 C
ATOM 6852 CD2 PHE C 75 -36.517 68.838 -87.361 1.00174.92 C
ATOM 6853 CE1 PHE C 75 -36.706 66.329 -86.235 1.00174.03 C
ATOM 6854 CE2 PHE C 75 -37.176 67.828 -88.034 1.00174.97 C
ATOM 6855 CZ PHE C 75 -37.270 66.571 -87.469 1.00174.62 C
ATOM 6856 N ILE C 76 -32.797 68.106 -87.087 1.00173.58 N
ATOM 6857 CA ILE C 76 -32.352 67.746 -88.427 1.00173.46 C
ATOM 6858 C ILE C 76 -33.352 66.787 -89.065 1.00173.42 C
ATOM 6859 O ILE C 76 -33.446 65.629 -88.659 1.00172.94 O
ATOM 6860 CB ILE C 76 -30.954 67.100 -88.406 1.00173.15 C
ATOM 6861 CG1 ILE C 76 -29.981 67.969 -87.606 1.00172.84 C
ATOM 6862 CG2 ILE C 76 -30.443 66.886 -89.824 1.00173.54 C
ATOM 6863 CD1 ILE C 76 -28.591 67.379 -87.488 1.00172.47 C
ATOM 6864 N PRO C 77 -34.105 67.273 -90.065 1.00173.95 N
ATOM 6865 CA PRO C 77 -35.180 66.537 -90.743 1.00174.64 C
ATOM 6866 C PRO C 77 -34.790 65.133 -91.207 1.00174.64 C
ATOM 6867 O PRO C 77 -35.436 64.167 -90.806 1.00174.46 O
ATOM 6868 CB PRO C 77 -35.507 67.434 -91.948 1.00174.98 C
ATOM 6869 CG PRO C 77 -34.295 68.295 -92.127 1.00174.39 C
ATOM 6870 CD PRO C 77 -33.840 68.559 -90.730 1.00174.26 C
ATOM 6871 N GLU C 78 -33.750 65.020 -92.028 1.00174.82 N
ATOM 6872 CA GLU C 78 -33.339 63.720 -92.550 1.00174.47 C
ATOM 6873 C GLU C 78 -32.498 62.953 -91.533 1.00173.22 C
ATOM 6874 O GLU C 78 -31.389 62.505 -91.822 1.00173.93 O
ATOM 6875 CB GLU C 78 -32.579 63.885 -93.873 1.00175.12 C
ATOM 6876 CG GLU C 78 -31.374 64.820 -93.831 1.00175.39 C
ATOM 6877 CD GLU C 78 -31.751 66.287 -93.916 1.00175.21 C
ATOM 6878 OE1 GLU C 78 -32.280 66.708 -94.965 1.00174.76 O
ATOM 6879 OE2 GLU C 78 -31.499 67.023 -92.939 1.00174.49 O
ATOM 6880 N LYS C 79 -33.060 62.787 -90.343 1.00172.32 N
ATOM 6881 CA LYS C 79 -32.376 62.132 -89.242 1.00173.01 C
ATOM 6882 C LYS C 79 -33.381 61.803 -88.149 1.00173.97 C
ATOM 6883 O LYS C 79 -34.209 62.643 -87.796 1.00174.05 O
ATOM 6884 CB LYS C 79 -31.259 63.024 -88.692 1.00173.51 C
ATOM 6885 CG LYS C 79 -30.460 62.403 -87.556 1.00173.56 C
ATOM 6886 CD LYS C 79 -29.316 63.302 -87.122 1.00173.78 C
ATOM 6887 CE LYS C 79 -28.473 62.641 -86.044 1.00173.86 C
ATOM 6888 NZ LYS C 79 -27.422 63.560 -85.526 1.00172.99 N
ATOM 6889 N PRO C 80 -33.318 60.572 -87.619 1.00174.71 N
ATOM 6890 CA PRO C 80 -34.193 60.094 -86.544 1.00175.05 C
ATOM 6891 C PRO C 80 -34.283 61.058 -85.362 1.00174.20 C
ATOM 6892 O PRO C 80 -33.279 61.641 -84.955 1.00174.06 O
ATOM 6893 CB PRO C 80 -33.528 58.783 -86.131 1.00175.01 C
ATOM 6894 CG PRO C 80 -32.941 58.279 -87.402 1.00174.69 C
ATOM 6895 CD PRO C 80 -32.406 59.511 -88.080 1.00173.93 C
ATOM 6896 N MET C 81 -35.488 61.215 -84.826 1.00173.57 N
ATOM 6897 CA MET C 81 -35.738 62.152 -83.740 1.00173.38 C
ATOM 6898 C MET C 81 -35.060 61.709 -82.454 1.00173.30 C
ATOM 6899 O MET C 81 -34.524 62.530 -81.711 1.00173.96 O
ATOM 6900 CB MET C 81 -37.238 62.305 -83.506 1.00173.42 C
ATOM 6901 CG MET C 81 -38.005 62.764 -84.731 1.00173.99 C
ATOM 6902 SD MET C 81 -39.784 62.720 -84.466 1.00172.15 S
ATOM 6903 CE MET C 81 -40.047 64.323 -83.725 1.00172.71 C
ATOM 6904 N TYR C 82 -35.090 60.407 -82.195 1.00172.61 N
ATOM 6905 CA TYR C 82 -34.480 59.852 -80.993 1.00172.79 C
ATOM 6906 C TYR C 82 -32.958 60.008 -80.972 1.00172.87 C
ATOM 6907 O TYR C 82 -32.331 59.857 -79.924 1.00172.58 O
ATOM 6908 CB TYR C 82 -34.867 58.378 -80.835 1.00173.13 C
ATOM 6909 CG TYR C 82 -34.654 57.516 -82.062 1.00173.88 C
ATOM 6910 CD1 TYR C 82 -35.619 57.442 -83.060 1.00173.92 C
ATOM 6911 CD2 TYR C 82 -33.502 56.755 -82.210 1.00174.57 C
ATOM 6912 CE1 TYR C 82 -35.437 56.646 -84.176 1.00173.95 C
ATOM 6913 CE2 TYR C 82 -33.310 55.957 -83.324 1.00174.97 C
ATOM 6914 CZ TYR C 82 -34.281 55.907 -84.305 1.00174.68 C
ATOM 6915 OH TYR C 82 -34.093 55.115 -85.415 1.00173.77 O
ATOM 6916 N GLU C 83 -32.370 60.314 -82.124 1.00173.46 N
ATOM 6917 CA GLU C 83 -30.932 60.551 -82.205 1.00174.03 C
ATOM 6918 C GLU C 83 -30.589 62.030 -82.060 1.00174.45 C
ATOM 6919 O GLU C 83 -29.466 62.443 -82.351 1.00174.49 O
ATOM 6920 CB GLU C 83 -30.369 60.033 -83.529 1.00174.29 C
ATOM 6921 CG GLU C 83 -30.574 58.553 -83.774 1.00174.78 C
ATOM 6922 CD GLU C 83 -29.829 58.075 -85.002 1.00174.68 C
ATOM 6923 OE1 GLU C 83 -30.117 56.959 -85.481 1.00175.77 O
ATOM 6924 OE2 GLU C 83 -28.953 58.821 -85.487 1.00173.91 O
ATOM 6925 N GLN C 84 -31.555 62.828 -81.615 1.00174.59 N
ATOM 6926 CA GLN C 84 -31.356 64.270 -81.533 1.00174.61 C
ATOM 6927 C GLN C 84 -31.786 64.837 -80.182 1.00173.57 C
ATOM 6928 O GLN C 84 -31.759 66.049 -79.973 1.00173.47 O
ATOM 6929 CB GLN C 84 -32.114 64.975 -82.661 1.00175.00 C
ATOM 6930 CG GLN C 84 -31.634 64.604 -84.060 1.00174.16 C
ATOM 6931 CD GLN C 84 -32.356 65.374 -85.149 1.00173.58 C
ATOM 6932 OE1 GLN C 84 -32.515 66.591 -85.063 1.00173.23 O
ATOM 6933 NE2 GLN C 84 -32.799 64.665 -86.181 1.00173.63 N
ATOM 6934 N GLY C 85 -32.169 63.956 -79.264 1.00172.89 N
ATOM 6935 CA GLY C 85 -32.519 64.365 -77.916 1.00173.09 C
ATOM 6936 C GLY C 85 -33.806 65.161 -77.857 1.00173.13 C
ATOM 6937 O GLY C 85 -33.908 66.141 -77.120 1.00173.99 O
ATOM 6938 N LEU C 86 -34.792 64.736 -78.637 1.00172.53 N
ATOM 6939 CA LEU C 86 -36.083 65.410 -78.674 1.00173.07 C
ATOM 6940 C LEU C 86 -37.083 64.714 -77.758 1.00173.90 C
ATOM 6941 O LEU C 86 -37.134 63.485 -77.707 1.00174.90 O
ATOM 6942 CB LEU C 86 -36.624 65.452 -80.104 1.00173.04 C
ATOM 6943 CG LEU C 86 -36.148 66.528 -81.084 1.00173.51 C
ATOM 6944 CD1 LEU C 86 -34.823 67.157 -80.672 1.00174.02 C
ATOM 6945 CD2 LEU C 86 -36.038 65.919 -82.467 1.00173.73 C
ATOM 6946 N ILE C 87 -37.882 65.500 -77.042 1.00173.44 N
ATOM 6947 CA ILE C 87 -38.897 64.946 -76.151 1.00173.02 C
ATOM 6948 C ILE C 87 -40.208 65.720 -76.243 1.00172.58 C
ATOM 6949 O ILE C 87 -41.216 65.319 -75.662 1.00172.57 O
ATOM 6950 CB ILE C 87 -38.425 64.943 -74.681 1.00173.69 C
ATOM 6951 CG1 ILE C 87 -37.948 66.339 -74.271 1.00173.59 C
ATOM 6952 CG2 ILE C 87 -37.311 63.929 -74.470 1.00173.81 C
ATOM 6953 CD1 ILE C 87 -37.626 66.467 -72.798 1.00173.54 C
ATOM 6954 N LEU C 88 -40.196 66.821 -76.987 1.00172.79 N
ATOM 6955 CA LEU C 88 -41.396 67.634 -77.151 1.00173.48 C
ATOM 6956 C LEU C 88 -41.923 67.563 -78.578 1.00173.86 C
ATOM 6957 O LEU C 88 -43.121 67.393 -78.795 1.00174.03 O
ATOM 6958 CB LEU C 88 -41.124 69.088 -76.765 1.00173.89 C
ATOM 6959 CG LEU C 88 -40.653 69.337 -75.331 1.00173.93 C
ATOM 6960 CD1 LEU C 88 -40.784 70.809 -74.977 1.00173.49 C
ATOM 6961 CD2 LEU C 88 -41.421 68.473 -74.341 1.00174.00 C
ATOM 6962 N ILE C 89 -41.027 67.709 -79.548 1.00174.33 N
ATOM 6963 CA ILE C 89 -41.393 67.534 -80.949 1.00174.60 C
ATOM 6964 C ILE C 89 -41.961 66.131 -81.235 1.00174.27 C
ATOM 6965 O ILE C 89 -42.904 66.003 -82.016 1.00174.09 O
ATOM 6966 CB ILE C 89 -40.194 67.809 -81.889 1.00174.64 C
ATOM 6967 CG1 ILE C 89 -39.558 69.162 -81.565 1.00174.73 C
ATOM 6968 CG2 ILE C 89 -40.637 67.787 -83.342 1.00174.24 C
ATOM 6969 CD1 ILE C 89 -38.492 69.586 -82.556 1.00174.55 C
ATOM 6970 N PRO C 90 -41.404 65.072 -80.608 1.00174.25 N
ATOM 6971 CA PRO C 90 -42.081 63.786 -80.807 1.00173.78 C
ATOM 6972 C PRO C 90 -43.441 63.707 -80.120 1.00173.34 C
ATOM 6973 O PRO C 90 -44.254 62.865 -80.492 1.00173.16 O
ATOM 6974 CB PRO C 90 -41.105 62.779 -80.187 1.00174.19 C
ATOM 6975 CG PRO C 90 -40.311 63.576 -79.217 1.00174.34 C
ATOM 6976 CD PRO C 90 -40.124 64.889 -79.901 1.00174.57 C
ATOM 6977 N HIS C 91 -43.685 64.567 -79.137 1.00172.98 N
ATOM 6978 CA HIS C 91 -44.990 64.615 -78.490 1.00173.21 C
ATOM 6979 C HIS C 91 -46.007 65.228 -79.444 1.00173.33 C
ATOM 6980 O HIS C 91 -47.177 64.847 -79.453 1.00173.53 O
ATOM 6981 CB HIS C 91 -44.931 65.421 -77.191 1.00173.80 C
ATOM 6982 CG HIS C 91 -44.809 64.581 -75.958 1.00173.96 C
ATOM 6983 ND1 HIS C 91 -43.635 63.957 -75.593 1.00173.60 N
ATOM 6984 CD2 HIS C 91 -45.715 64.266 -75.002 1.00174.15 C
ATOM 6985 CE1 HIS C 91 -43.824 63.294 -74.466 1.00173.62 C
ATOM 6986 NE2 HIS C 91 -45.078 63.464 -74.087 1.00173.76 N
ATOM 6987 N ILE C 92 -45.542 66.175 -80.252 1.00173.43 N
ATOM 6988 CA ILE C 92 -46.385 66.835 -81.241 1.00173.96 C
ATOM 6989 C ILE C 92 -46.639 65.909 -82.425 1.00174.32 C
ATOM 6990 O ILE C 92 -47.754 65.839 -82.945 1.00174.40 O
ATOM 6991 CB ILE C 92 -45.746 68.146 -81.740 1.00174.10 C
ATOM 6992 CG1 ILE C 92 -45.440 69.077 -80.565 1.00174.15 C
ATOM 6993 CG2 ILE C 92 -46.652 68.838 -82.742 1.00173.98 C
ATOM 6994 CD1 ILE C 92 -44.712 70.340 -80.965 1.00174.02 C
ATOM 6995 N ALA C 93 -45.590 65.206 -82.846 1.00174.67 N
ATOM 6996 CA ALA C 93 -45.669 64.244 -83.943 1.00175.10 C
ATOM 6997 C ALA C 93 -46.754 63.189 -83.721 1.00174.89 C
ATOM 6998 O ALA C 93 -47.450 62.801 -84.658 1.00175.08 O
ATOM 6999 CB ALA C 93 -44.316 63.572 -84.145 1.00175.48 C
ATOM 7000 N THR C 94 -46.886 62.727 -82.479 1.00174.36 N
ATOM 7001 CA THR C 94 -47.886 61.721 -82.123 1.00173.78 C
ATOM 7002 C THR C 94 -49.302 62.187 -82.434 1.00173.99 C
ATOM 7003 O THR C 94 -50.170 61.386 -82.782 1.00173.42 O
ATOM 7004 CB THR C 94 -47.814 61.356 -80.628 1.00173.13 C
ATOM 7005 OG1 THR C 94 -47.950 62.543 -79.837 1.00172.71 O
ATOM 7006 CG2 THR C 94 -46.492 60.689 -80.303 1.00173.51 C
ATOM 7007 N LEU C 95 -49.529 63.489 -82.297 1.00174.33 N
ATOM 7008 CA LEU C 95 -50.841 64.077 -82.540 1.00174.27 C
ATOM 7009 C LEU C 95 -51.105 64.318 -84.024 1.00175.40 C
ATOM 7010 O LEU C 95 -52.059 65.007 -84.383 1.00175.81 O
ATOM 7011 CB LEU C 95 -50.976 65.392 -81.773 1.00173.37 C
ATOM 7012 CG LEU C 95 -50.878 65.259 -80.255 1.00173.53 C
ATOM 7013 CD1 LEU C 95 -50.837 66.628 -79.592 1.00174.53 C
ATOM 7014 CD2 LEU C 95 -52.029 64.425 -79.719 1.00173.75 C
ATOM 7015 N GLY C 96 -50.263 63.748 -84.881 1.00175.25 N
ATOM 7016 CA GLY C 96 -50.395 63.931 -86.315 1.00174.33 C
ATOM 7017 C GLY C 96 -50.128 65.363 -86.737 1.00174.39 C
ATOM 7018 O GLY C 96 -51.037 66.076 -87.163 1.00174.83 O
ATOM 7019 N TRP C 97 -48.872 65.782 -86.624 1.00174.06 N
ATOM 7020 CA TRP C 97 -48.487 67.148 -86.961 1.00174.50 C
ATOM 7021 C TRP C 97 -47.079 67.211 -87.538 1.00174.51 C
ATOM 7022 O TRP C 97 -46.097 66.964 -86.837 1.00174.02 O
ATOM 7023 CB TRP C 97 -48.582 68.050 -85.728 1.00174.27 C
ATOM 7024 CG TRP C 97 -49.859 68.829 -85.639 1.00173.98 C
ATOM 7025 CD1 TRP C 97 -50.659 69.213 -86.675 1.00174.02 C
ATOM 7026 CD2 TRP C 97 -50.482 69.322 -84.447 1.00173.49 C
ATOM 7027 NE1 TRP C 97 -51.741 69.915 -86.202 1.00173.41 N
ATOM 7028 CE2 TRP C 97 -51.656 69.995 -84.837 1.00173.42 C
ATOM 7029 CE3 TRP C 97 -50.162 69.258 -83.087 1.00173.71 C
ATOM 7030 CZ2 TRP C 97 -52.511 70.600 -83.918 1.00173.75 C
ATOM 7031 CZ3 TRP C 97 -51.011 69.859 -82.177 1.00174.33 C
ATOM 7032 CH2 TRP C 97 -52.171 70.521 -82.596 1.00174.35 C
ATOM 7033 N GLY C 98 -46.991 67.542 -88.822 1.00174.76 N
ATOM 7034 CA GLY C 98 -45.712 67.714 -89.486 1.00174.89 C
ATOM 7035 C GLY C 98 -45.040 66.412 -89.869 1.00175.11 C
ATOM 7036 O GLY C 98 -43.875 66.398 -90.267 1.00175.50 O
ATOM 7037 N VAL C 99 -45.776 65.312 -89.753 1.00174.50 N
ATOM 7038 CA VAL C 99 -45.235 64.001 -90.085 1.00173.66 C
ATOM 7039 C VAL C 99 -46.127 63.275 -91.082 1.00172.81 C
ATOM 7040 O VAL C 99 -47.268 63.672 -91.316 1.00172.39 O
ATOM 7041 CB VAL C 99 -45.063 63.122 -88.830 1.00173.36 C
ATOM 7042 CG1 VAL C 99 -44.044 63.738 -87.880 1.00173.18 C
ATOM 7043 CG2 VAL C 99 -46.403 62.915 -88.140 1.00173.81 C
ATOM 7044 N GLY C 100 -45.597 62.207 -91.668 1.00172.67 N
ATOM 7045 CA GLY C 100 -46.342 61.424 -92.635 1.00173.30 C
ATOM 7046 C GLY C 100 -45.997 59.950 -92.563 1.00173.67 C
ATOM 7047 O GLY C 100 -45.803 59.412 -91.474 1.00174.07 O
ATOM 7048 N PRO C 101 -45.923 59.289 -93.729 1.00173.92 N
ATOM 7049 CA PRO C 101 -45.575 57.871 -93.869 1.00174.15 C
ATOM 7050 C PRO C 101 -44.304 57.474 -93.120 1.00174.61 C
ATOM 7051 O PRO C 101 -43.251 58.072 -93.334 1.00174.40 O
ATOM 7052 CB PRO C 101 -45.381 57.719 -95.379 1.00174.62 C
ATOM 7053 CG PRO C 101 -46.302 58.731 -95.961 1.00174.99 C
ATOM 7054 CD PRO C 101 -46.188 59.913 -95.037 1.00174.63 C
ATOM 7055 N GLY C 102 -44.412 56.467 -92.258 1.00174.68 N
ATOM 7056 CA GLY C 102 -43.277 55.968 -91.501 1.00174.31 C
ATOM 7057 C GLY C 102 -42.635 56.979 -90.567 1.00173.99 C
ATOM 7058 O GLY C 102 -41.483 56.815 -90.163 1.00174.19 O
ATOM 7059 N GLY C 103 -43.376 58.026 -90.224 1.00173.75 N
ATOM 7060 CA GLY C 103 -42.883 59.041 -89.312 1.00173.33 C
ATOM 7061 C GLY C 103 -41.980 60.045 -89.997 1.00172.99 C
ATOM 7062 O GLY C 103 -41.198 60.739 -89.347 1.00172.81 O
ATOM 7063 N GLU C 104 -42.091 60.121 -91.319 1.00172.88 N
ATOM 7064 CA GLU C 104 -41.294 61.052 -92.105 1.00173.45 C
ATOM 7065 C GLU C 104 -41.732 62.484 -91.831 1.00173.40 C
ATOM 7066 O GLU C 104 -42.914 62.810 -91.929 1.00173.52 O
ATOM 7067 CB GLU C 104 -41.413 60.734 -93.597 1.00174.16 C
ATOM 7068 CG GLU C 104 -40.116 60.285 -94.258 1.00173.41 C
ATOM 7069 CD GLU C 104 -39.269 61.449 -94.739 1.00173.95 C
ATOM 7070 OE1 GLU C 104 -38.217 61.200 -95.364 1.00173.18 O
ATOM 7071 OE2 GLU C 104 -39.656 62.611 -94.497 1.00174.60 O
ATOM 7072 N VAL C 105 -40.773 63.337 -91.489 1.00173.12 N
ATOM 7073 CA VAL C 105 -41.071 64.725 -91.159 1.00173.27 C
ATOM 7074 C VAL C 105 -41.323 65.536 -92.427 1.00173.53 C
ATOM 7075 O VAL C 105 -40.432 65.697 -93.262 1.00173.49 O
ATOM 7076 CB VAL C 105 -39.931 65.366 -90.348 1.00172.83 C
ATOM 7077 CG1 VAL C 105 -40.128 66.868 -90.249 1.00172.95 C
ATOM 7078 CG2 VAL C 105 -39.864 64.747 -88.961 1.00173.20 C
ATOM 7079 N VAL C 106 -42.547 66.036 -92.569 1.00173.56 N
ATOM 7080 CA VAL C 106 -42.948 66.775 -93.763 1.00173.43 C
ATOM 7081 C VAL C 106 -42.817 68.285 -93.590 1.00173.93 C
ATOM 7082 O VAL C 106 -42.105 68.943 -94.344 1.00174.86 O
ATOM 7083 CB VAL C 106 -44.399 66.451 -94.160 1.00173.01 C
ATOM 7084 CG1 VAL C 106 -44.753 67.131 -95.476 1.00173.01 C
ATOM 7085 CG2 VAL C 106 -44.598 64.949 -94.260 1.00173.52 C
ATOM 7086 N ASP C 107 -43.516 68.830 -92.600 1.00173.53 N
ATOM 7087 CA ASP C 107 -43.555 70.274 -92.397 1.00173.60 C
ATOM 7088 C ASP C 107 -43.254 70.645 -90.944 1.00173.56 C
ATOM 7089 O ASP C 107 -43.968 70.239 -90.031 1.00173.29 O
ATOM 7090 CB ASP C 107 -44.918 70.824 -92.825 1.00173.90 C
ATOM 7091 CG ASP C 107 -45.017 72.328 -92.678 1.00174.06 C
ATOM 7092 OD1 ASP C 107 -44.129 73.042 -93.190 1.00173.56 O
ATOM 7093 OD2 ASP C 107 -46.001 72.798 -92.070 1.00174.36 O
ATOM 7094 N THR C 108 -42.191 71.418 -90.739 1.00173.87 N
ATOM 7095 CA THR C 108 -41.739 71.766 -89.394 1.00174.09 C
ATOM 7096 C THR C 108 -42.472 72.977 -88.819 1.00174.42 C
ATOM 7097 O THR C 108 -42.185 73.411 -87.701 1.00174.15 O
ATOM 7098 CB THR C 108 -40.225 72.055 -89.367 1.00174.03 C
ATOM 7099 OG1 THR C 108 -39.940 73.227 -90.140 1.00174.27 O
ATOM 7100 CG2 THR C 108 -39.446 70.877 -89.931 1.00173.59 C
ATOM 7101 N PHE C 109 -43.410 73.522 -89.585 1.00174.73 N
ATOM 7102 CA PHE C 109 -44.176 74.691 -89.155 1.00174.51 C
ATOM 7103 C PHE C 109 -45.055 74.447 -87.913 1.00174.25 C
ATOM 7104 O PHE C 109 -45.055 75.279 -87.005 1.00173.96 O
ATOM 7105 CB PHE C 109 -45.034 75.211 -90.313 1.00174.50 C
ATOM 7106 CG PHE C 109 -45.765 76.487 -90.003 1.00174.54 C
ATOM 7107 CD1 PHE C 109 -45.070 77.668 -89.801 1.00174.49 C
ATOM 7108 CD2 PHE C 109 -47.147 76.505 -89.922 1.00174.52 C
ATOM 7109 CE1 PHE C 109 -45.742 78.844 -89.521 1.00174.40 C
ATOM 7110 CE2 PHE C 109 -47.824 77.677 -89.644 1.00174.79 C
ATOM 7111 CZ PHE C 109 -47.120 78.848 -89.442 1.00174.83 C
ATOM 7112 N PRO C 110 -45.812 73.325 -87.862 1.00174.41 N
ATOM 7113 CA PRO C 110 -46.599 73.075 -86.647 1.00174.46 C
ATOM 7114 C PRO C 110 -45.752 73.021 -85.379 1.00173.80 C
ATOM 7115 O PRO C 110 -46.221 73.404 -84.308 1.00173.55 O
ATOM 7116 CB PRO C 110 -47.237 71.713 -86.925 1.00174.30 C
ATOM 7117 CG PRO C 110 -47.364 71.671 -88.397 1.00173.89 C
ATOM 7118 CD PRO C 110 -46.096 72.303 -88.888 1.00174.07 C
ATOM 7119 N PHE C 111 -44.517 72.549 -85.505 1.00173.33 N
ATOM 7120 CA PHE C 111 -43.594 72.521 -84.381 1.00173.12 C
ATOM 7121 C PHE C 111 -43.250 73.944 -83.958 1.00173.93 C
ATOM 7122 O PHE C 111 -43.300 74.279 -82.775 1.00174.27 O
ATOM 7123 CB PHE C 111 -42.328 71.747 -84.742 1.00173.44 C
ATOM 7124 CG PHE C 111 -42.588 70.335 -85.178 1.00173.78 C
ATOM 7125 CD1 PHE C 111 -43.572 69.576 -84.566 1.00173.86 C
ATOM 7126 CD2 PHE C 111 -41.853 69.768 -86.204 1.00174.48 C
ATOM 7127 CE1 PHE C 111 -43.815 68.277 -84.968 1.00174.67 C
ATOM 7128 CE2 PHE C 111 -42.090 68.469 -86.611 1.00174.80 C
ATOM 7129 CZ PHE C 111 -43.073 67.722 -85.992 1.00174.78 C
ATOM 7130 N PHE C 112 -42.898 74.772 -84.938 1.00174.16 N
ATOM 7131 CA PHE C 112 -42.595 76.181 -84.701 1.00174.16 C
ATOM 7132 C PHE C 112 -43.767 76.910 -84.047 1.00173.98 C
ATOM 7133 O PHE C 112 -43.576 77.702 -83.126 1.00174.03 O
ATOM 7134 CB PHE C 112 -42.218 76.875 -86.013 1.00173.82 C
ATOM 7135 CG PHE C 112 -41.845 78.321 -85.848 1.00173.93 C
ATOM 7136 CD1 PHE C 112 -40.650 78.677 -85.245 1.00173.76 C
ATOM 7137 CD2 PHE C 112 -42.688 79.325 -86.297 1.00174.09 C
ATOM 7138 CE1 PHE C 112 -40.304 80.006 -85.090 1.00173.52 C
ATOM 7139 CE2 PHE C 112 -42.347 80.656 -86.145 1.00173.98 C
ATOM 7140 CZ PHE C 112 -41.153 80.996 -85.540 1.00173.56 C
ATOM 7141 N VAL C 113 -44.976 76.639 -84.534 1.00174.08 N
ATOM 7142 CA VAL C 113 -46.188 77.255 -83.997 1.00174.22 C
ATOM 7143 C VAL C 113 -46.408 76.913 -82.525 1.00173.92 C
ATOM 7144 O VAL C 113 -46.452 77.805 -81.681 1.00174.07 O
ATOM 7145 CB VAL C 113 -47.435 76.837 -84.793 1.00174.66 C
ATOM 7146 CG1 VAL C 113 -48.693 77.337 -84.103 1.00174.57 C
ATOM 7147 CG2 VAL C 113 -47.362 77.387 -86.201 1.00174.53 C
ATOM 7148 N VAL C 114 -46.562 75.624 -82.231 1.00173.77 N
ATOM 7149 CA VAL C 114 -46.751 75.144 -80.862 1.00173.95 C
ATOM 7150 C VAL C 114 -45.733 75.755 -79.894 1.00173.93 C
ATOM 7151 O VAL C 114 -46.070 76.116 -78.765 1.00173.83 O
ATOM 7152 CB VAL C 114 -46.657 73.602 -80.798 1.00174.05 C
ATOM 7153 CG1 VAL C 114 -46.647 73.122 -79.357 1.00174.05 C
ATOM 7154 CG2 VAL C 114 -47.808 72.966 -81.564 1.00173.70 C
ATOM 7155 N GLY C 115 -44.493 75.885 -80.351 1.00173.63 N
ATOM 7156 CA GLY C 115 -43.442 76.487 -79.551 1.00173.46 C
ATOM 7157 C GLY C 115 -43.660 77.963 -79.270 1.00173.81 C
ATOM 7158 O GLY C 115 -43.655 78.385 -78.114 1.00173.28 O
ATOM 7159 N VAL C 116 -43.853 78.750 -80.326 1.00174.62 N
ATOM 7160 CA VAL C 116 -44.008 80.199 -80.184 1.00174.40 C
ATOM 7161 C VAL C 116 -45.310 80.612 -79.488 1.00173.68 C
ATOM 7162 O VAL C 116 -45.315 81.562 -78.707 1.00172.91 O
ATOM 7163 CB VAL C 116 -43.914 80.920 -81.557 1.00174.44 C
ATOM 7164 CG1 VAL C 116 -42.552 80.684 -82.189 1.00174.67 C
ATOM 7165 CG2 VAL C 116 -45.028 80.485 -82.499 1.00174.12 C
ATOM 7166 N VAL C 117 -46.402 79.906 -79.766 1.00174.14 N
ATOM 7167 CA VAL C 117 -47.688 80.213 -79.146 1.00174.15 C
ATOM 7168 C VAL C 117 -47.594 80.069 -77.633 1.00174.41 C
ATOM 7169 O VAL C 117 -48.016 80.955 -76.889 1.00174.50 O
ATOM 7170 CB VAL C 117 -48.818 79.311 -79.681 1.00173.75 C
ATOM 7171 CG1 VAL C 117 -50.116 79.580 -78.934 1.00173.46 C
ATOM 7172 CG2 VAL C 117 -49.008 79.532 -81.172 1.00173.44 C
ATOM 7173 N HIS C 118 -47.053 78.939 -77.186 1.00174.78 N
ATOM 7174 CA HIS C 118 -46.794 78.721 -75.767 1.00174.78 C
ATOM 7175 C HIS C 118 -45.941 79.822 -75.165 1.00174.60 C
ATOM 7176 O HIS C 118 -46.352 80.490 -74.217 1.00174.49 O
ATOM 7177 CB HIS C 118 -46.106 77.379 -75.547 1.00174.80 C
ATOM 7178 CG HIS C 118 -47.056 76.250 -75.323 1.00174.36 C
ATOM 7179 ND1 HIS C 118 -47.764 75.658 -76.346 1.00174.05 N
ATOM 7180 CD2 HIS C 118 -47.440 75.623 -74.186 1.00173.90 C
ATOM 7181 CE1 HIS C 118 -48.528 74.700 -75.851 1.00173.67 C
ATOM 7182 NE2 HIS C 118 -48.352 74.662 -74.543 1.00173.21 N
ATOM 7183 N LEU C 119 -44.752 79.998 -75.734 1.00174.38 N
ATOM 7184 CA LEU C 119 -43.785 80.989 -75.275 1.00174.18 C
ATOM 7185 C LEU C 119 -44.432 82.360 -75.079 1.00174.24 C
ATOM 7186 O LEU C 119 -44.081 83.099 -74.161 1.00174.19 O
ATOM 7187 CB LEU C 119 -42.625 81.080 -76.264 1.00173.45 C
ATOM 7188 CG LEU C 119 -41.488 82.028 -75.899 1.00173.11 C
ATOM 7189 CD1 LEU C 119 -40.868 81.611 -74.574 1.00173.01 C
ATOM 7190 CD2 LEU C 119 -40.447 82.041 -76.998 1.00172.80 C
ATOM 7191 N ILE C 120 -45.382 82.689 -75.951 1.00174.14 N
ATOM 7192 CA ILE C 120 -46.123 83.941 -75.850 1.00174.05 C
ATOM 7193 C ILE C 120 -47.047 83.940 -74.634 1.00174.14 C
ATOM 7194 O ILE C 120 -47.015 84.867 -73.824 1.00173.79 O
ATOM 7195 CB ILE C 120 -46.962 84.210 -77.119 1.00173.48 C
ATOM 7196 CG1 ILE C 120 -46.056 84.575 -78.295 1.00173.04 C
ATOM 7197 CG2 ILE C 120 -47.967 85.323 -76.871 1.00173.53 C
ATOM 7198 CD1 ILE C 120 -45.189 85.785 -78.037 1.00173.73 C
ATOM 7199 N SER C 121 -47.863 82.894 -74.510 1.00174.52 N
ATOM 7200 CA SER C 121 -48.804 82.759 -73.394 1.00174.46 C
ATOM 7201 C SER C 121 -48.122 82.795 -72.024 1.00174.42 C
ATOM 7202 O SER C 121 -48.757 83.107 -71.016 1.00174.58 O
ATOM 7203 CB SER C 121 -49.605 81.459 -73.531 1.00174.74 C
ATOM 7204 OG SER C 121 -50.096 81.299 -74.850 1.00175.42 O
ATOM 7205 N SER C 122 -46.834 82.470 -71.994 1.00174.57 N
ATOM 7206 CA SER C 122 -46.059 82.491 -70.760 1.00174.51 C
ATOM 7207 C SER C 122 -45.915 83.910 -70.220 1.00174.57 C
ATOM 7208 O SER C 122 -45.888 84.123 -69.009 1.00174.44 O
ATOM 7209 CB SER C 122 -44.680 81.873 -70.988 1.00174.13 C
ATOM 7210 OG SER C 122 -43.837 82.760 -71.703 1.00173.90 O
ATOM 7211 N ALA C 123 -45.818 84.874 -71.129 1.00174.53 N
ATOM 7212 CA ALA C 123 -45.739 86.281 -70.756 1.00174.61 C
ATOM 7213 C ALA C 123 -47.062 86.760 -70.161 1.00175.17 C
ATOM 7214 O ALA C 123 -47.078 87.514 -69.187 1.00175.06 O
ATOM 7215 CB ALA C 123 -45.359 87.130 -71.959 1.00174.54 C
ATOM 7216 N VAL C 124 -48.166 86.318 -70.756 1.00175.10 N
ATOM 7217 CA VAL C 124 -49.501 86.656 -70.270 1.00175.02 C
ATOM 7218 C VAL C 124 -49.737 86.123 -68.858 1.00174.54 C
ATOM 7219 O VAL C 124 -50.155 86.864 -67.966 1.00174.01 O
ATOM 7220 CB VAL C 124 -50.594 86.104 -71.203 1.00174.28 C
ATOM 7221 CG1 VAL C 124 -51.970 86.519 -70.707 1.00174.64 C
ATOM 7222 CG2 VAL C 124 -50.368 86.589 -72.625 1.00174.39 C
ATOM 7223 N LEU C 125 -49.476 84.833 -68.666 1.00174.67 N
ATOM 7224 CA LEU C 125 -49.601 84.206 -67.353 1.00174.17 C
ATOM 7225 C LEU C 125 -48.623 84.815 -66.356 1.00173.78 C
ATOM 7226 O LEU C 125 -48.996 85.145 -65.232 1.00173.62 O
ATOM 7227 CB LEU C 125 -49.374 82.696 -67.451 1.00173.60 C
ATOM 7228 CG LEU C 125 -50.544 81.874 -67.994 1.00173.48 C
ATOM 7229 CD1 LEU C 125 -50.120 80.433 -68.231 1.00173.89 C
ATOM 7230 CD2 LEU C 125 -51.742 81.942 -67.054 1.00173.50 C
ATOM 7231 N GLY C 126 -47.369 84.953 -66.777 1.00173.80 N
ATOM 7232 CA GLY C 126 -46.340 85.567 -65.958 1.00173.88 C
ATOM 7233 C GLY C 126 -46.724 86.950 -65.470 1.00174.05 C
ATOM 7234 O GLY C 126 -46.397 87.332 -64.348 1.00174.57 O
ATOM 7235 N PHE C 127 -47.421 87.698 -66.321 1.00173.85 N
ATOM 7236 CA PHE C 127 -47.913 89.027 -65.972 1.00174.28 C
ATOM 7237 C PHE C 127 -48.832 88.972 -64.753 1.00173.97 C
ATOM 7238 O PHE C 127 -48.564 89.608 -63.733 1.00173.72 O
ATOM 7239 CB PHE C 127 -48.648 89.650 -67.164 1.00174.91 C
ATOM 7240 CG PHE C 127 -48.881 91.130 -67.032 1.00176.02 C
ATOM 7241 CD1 PHE C 127 -47.817 92.017 -67.067 1.00175.58 C
ATOM 7242 CD2 PHE C 127 -50.163 91.634 -66.882 1.00176.49 C
ATOM 7243 CE1 PHE C 127 -48.027 93.380 -66.949 1.00175.12 C
ATOM 7244 CE2 PHE C 127 -50.379 92.996 -66.763 1.00176.58 C
ATOM 7245 CZ PHE C 127 -49.310 93.869 -66.797 1.00175.44 C
ATOM 7246 N GLY C 128 -49.916 88.209 -64.872 1.00173.74 N
ATOM 7247 CA GLY C 128 -50.857 88.018 -63.781 1.00173.89 C
ATOM 7248 C GLY C 128 -50.214 87.477 -62.520 1.00173.90 C
ATOM 7249 O GLY C 128 -50.564 87.886 -61.412 1.00174.09 O
ATOM 7250 N GLY C 129 -49.288 86.539 -62.696 1.00174.01 N
ATOM 7251 CA GLY C 129 -48.533 85.974 -61.594 1.00174.47 C
ATOM 7252 C GLY C 129 -47.830 87.042 -60.781 1.00174.68 C
ATOM 7253 O GLY C 129 -48.072 87.180 -59.581 1.00174.69 O
ATOM 7254 N VAL C 130 -46.951 87.791 -61.440 1.00174.76 N
ATOM 7255 CA VAL C 130 -46.266 88.919 -60.818 1.00175.00 C
ATOM 7256 C VAL C 130 -47.251 89.912 -60.199 1.00175.27 C
ATOM 7257 O VAL C 130 -47.073 90.341 -59.061 1.00175.40 O
ATOM 7258 CB VAL C 130 -45.370 89.655 -61.837 1.00174.88 C
ATOM 7259 CG1 VAL C 130 -44.734 90.885 -61.205 1.00175.02 C
ATOM 7260 CG2 VAL C 130 -44.304 88.715 -62.385 1.00174.61 C
ATOM 7261 N TYR C 131 -48.296 90.256 -60.948 1.00174.93 N
ATOM 7262 CA TYR C 131 -49.305 91.209 -60.488 1.00174.69 C
ATOM 7263 C TYR C 131 -49.954 90.784 -59.169 1.00174.37 C
ATOM 7264 O TYR C 131 -49.890 91.508 -58.175 1.00173.75 O
ATOM 7265 CB TYR C 131 -50.386 91.402 -61.559 1.00174.36 C
ATOM 7266 CG TYR C 131 -51.657 92.030 -61.030 1.00175.02 C
ATOM 7267 CD1 TYR C 131 -51.674 93.346 -60.584 1.00175.23 C
ATOM 7268 CD2 TYR C 131 -52.839 91.302 -60.968 1.00174.95 C
ATOM 7269 CE1 TYR C 131 -52.835 93.919 -60.093 1.00175.28 C
ATOM 7270 CE2 TYR C 131 -54.002 91.867 -60.479 1.00174.61 C
ATOM 7271 CZ TYR C 131 -53.995 93.175 -60.043 1.00174.40 C
ATOM 7272 OH TYR C 131 -55.153 93.738 -59.556 1.00173.23 O
ATOM 7273 N HIS C 132 -50.583 89.613 -59.174 1.00174.44 N
ATOM 7274 CA HIS C 132 -51.286 89.092 -58.004 1.00173.97 C
ATOM 7275 C HIS C 132 -50.408 88.870 -56.781 1.00173.36 C
ATOM 7276 O HIS C 132 -50.914 88.672 -55.677 1.00174.13 O
ATOM 7277 CB HIS C 132 -51.973 87.779 -58.355 1.00174.11 C
ATOM 7278 CG HIS C 132 -53.258 87.955 -59.083 1.00174.04 C
ATOM 7279 ND1 HIS C 132 -54.280 88.754 -58.605 1.00174.49 N
ATOM 7280 CD2 HIS C 132 -53.701 87.447 -60.254 1.00172.85 C
ATOM 7281 CE1 HIS C 132 -55.288 88.726 -59.449 1.00173.48 C
ATOM 7282 NE2 HIS C 132 -54.963 87.937 -60.462 1.00172.94 N
ATOM 7283 N ALA C 133 -49.097 88.902 -56.970 1.00172.90 N
ATOM 7284 CA ALA C 133 -48.191 88.562 -55.887 1.00173.28 C
ATOM 7285 C ALA C 133 -47.547 89.788 -55.253 1.00173.47 C
ATOM 7286 O ALA C 133 -47.060 89.715 -54.126 1.00173.31 O
ATOM 7287 CB ALA C 133 -47.120 87.608 -56.386 1.00172.97 C
ATOM 7288 N ILE C 134 -47.535 90.912 -55.965 1.00173.79 N
ATOM 7289 CA ILE C 134 -46.875 92.108 -55.442 1.00173.86 C
ATOM 7290 C ILE C 134 -47.653 93.413 -55.645 1.00174.82 C
ATOM 7291 O ILE C 134 -47.236 94.459 -55.151 1.00174.99 O
ATOM 7292 CB ILE C 134 -45.466 92.299 -56.064 1.00173.43 C
ATOM 7293 CG1 ILE C 134 -45.565 92.652 -57.549 1.00174.67 C
ATOM 7294 CG2 ILE C 134 -44.594 91.064 -55.861 1.00172.90 C
ATOM 7295 CD1 ILE C 134 -44.225 92.960 -58.184 1.00174.96 C
ATOM 7296 N ARG C 135 -48.775 93.363 -56.359 1.00175.01 N
ATOM 7297 CA ARG C 135 -49.605 94.556 -56.527 1.00175.16 C
ATOM 7298 C ARG C 135 -51.013 94.301 -56.005 1.00175.47 C
ATOM 7299 O ARG C 135 -51.466 94.971 -55.077 1.00175.66 O
ATOM 7300 CB ARG C 135 -49.660 94.995 -58.000 1.00174.50 C
ATOM 7301 CG ARG C 135 -50.188 96.432 -58.237 1.00174.86 C
ATOM 7302 CD ARG C 135 -51.704 96.575 -58.047 1.00175.32 C
ATOM 7303 NE ARG C 135 -52.243 97.809 -58.614 1.00175.09 N
ATOM 7304 CZ ARG C 135 -53.538 98.110 -58.647 1.00173.87 C
ATOM 7305 NH1 ARG C 135 -53.941 99.255 -59.179 1.00173.27 N
ATOM 7306 NH2 ARG C 135 -54.432 97.267 -58.148 1.00173.09 N
ATOM 7307 N GLY C 136 -51.705 93.352 -56.629 1.00174.66 N
ATOM 7308 CA GLY C 136 -53.087 93.050 -56.298 1.00174.43 C
ATOM 7309 C GLY C 136 -53.339 92.720 -54.839 1.00174.97 C
ATOM 7310 O GLY C 136 -52.400 92.605 -54.051 1.00175.02 O
ATOM 7311 N PRO C 137 -54.619 92.551 -54.476 1.00175.31 N
ATOM 7312 CA PRO C 137 -55.030 92.289 -53.094 1.00174.23 C
ATOM 7313 C PRO C 137 -54.300 91.096 -52.486 1.00173.45 C
ATOM 7314 O PRO C 137 -54.213 90.037 -53.106 1.00172.86 O
ATOM 7315 CB PRO C 137 -56.532 92.014 -53.224 1.00174.42 C
ATOM 7316 CG PRO C 137 -56.721 91.598 -54.646 1.00175.41 C
ATOM 7317 CD PRO C 137 -55.759 92.459 -55.404 1.00175.84 C
ATOM 7318 N GLU C 138 -53.781 91.279 -51.277 1.00174.07 N
ATOM 7319 CA GLU C 138 -53.018 90.239 -50.601 1.00174.39 C
ATOM 7320 C GLU C 138 -53.962 89.130 -50.147 1.00173.98 C
ATOM 7321 O GLU C 138 -53.544 88.000 -49.891 1.00173.56 O
ATOM 7322 CB GLU C 138 -52.250 90.833 -49.416 1.00174.91 C
ATOM 7323 CG GLU C 138 -51.343 89.862 -48.678 1.00174.53 C
ATOM 7324 CD GLU C 138 -50.437 90.563 -47.680 1.00173.97 C
ATOM 7325 OE1 GLU C 138 -50.949 91.365 -46.872 1.00174.13 O
ATOM 7326 OE2 GLU C 138 -49.214 90.310 -47.702 1.00173.64 O
ATOM 7327 N THR C 139 -55.246 89.465 -50.066 1.00173.98 N
ATOM 7328 CA THR C 139 -56.289 88.494 -49.760 1.00173.78 C
ATOM 7329 C THR C 139 -57.444 88.686 -50.739 1.00174.16 C
ATOM 7330 O THR C 139 -57.603 89.761 -51.316 1.00173.56 O
ATOM 7331 CB THR C 139 -56.796 88.633 -48.313 1.00173.38 C
ATOM 7332 OG1 THR C 139 -57.854 87.695 -48.080 1.00173.90 O
ATOM 7333 CG2 THR C 139 -57.312 90.041 -48.059 1.00173.59 C
ATOM 7334 N LEU C 140 -58.253 87.647 -50.919 1.00174.81 N
ATOM 7335 CA LEU C 140 -59.305 87.668 -51.931 1.00174.87 C
ATOM 7336 C LEU C 140 -60.706 87.753 -51.330 1.00174.75 C
ATOM 7337 O LEU C 140 -61.592 88.381 -51.909 1.00174.62 O
ATOM 7338 CB LEU C 140 -59.204 86.429 -52.826 1.00174.70 C
ATOM 7339 CG LEU C 140 -58.033 86.352 -53.807 1.00174.75 C
ATOM 7340 CD1 LEU C 140 -58.242 85.226 -54.809 1.00173.94 C
ATOM 7341 CD2 LEU C 140 -57.836 87.684 -54.522 1.00174.87 C
ATOM 7342 N GLU C 141 -60.892 87.107 -50.180 1.00175.03 N
ATOM 7343 CA GLU C 141 -62.179 87.046 -49.477 1.00174.86 C
ATOM 7344 C GLU C 141 -62.981 88.353 -49.473 1.00175.02 C
ATOM 7345 O GLU C 141 -64.207 88.331 -49.574 1.00174.34 O
ATOM 7346 CB GLU C 141 -61.963 86.591 -48.029 1.00174.64 C
ATOM 7347 CG GLU C 141 -61.523 85.139 -47.867 1.00174.03 C
ATOM 7348 CD GLU C 141 -60.104 84.885 -48.343 1.00173.95 C
ATOM 7349 OE1 GLU C 141 -59.156 85.317 -47.653 1.00174.97 O
ATOM 7350 OE2 GLU C 141 -59.939 84.253 -49.408 1.00173.22 O
ATOM 7351 N GLU C 142 -62.292 89.484 -49.347 1.00175.56 N
ATOM 7352 CA GLU C 142 -62.968 90.779 -49.309 1.00175.33 C
ATOM 7353 C GLU C 142 -63.083 91.419 -50.691 1.00175.60 C
ATOM 7354 O GLU C 142 -64.120 91.986 -51.033 1.00175.74 O
ATOM 7355 CB GLU C 142 -62.248 91.738 -48.358 1.00174.87 C
ATOM 7356 CG GLU C 142 -62.919 93.102 -48.244 1.00174.33 C
ATOM 7357 CD GLU C 142 -62.349 93.945 -47.121 1.00174.40 C
ATOM 7358 OE1 GLU C 142 -62.464 93.532 -45.948 1.00174.75 O
ATOM 7359 OE2 GLU C 142 -61.788 95.022 -47.413 1.00174.98 O
ATOM 7360 N TYR C 143 -62.020 91.330 -51.485 1.00175.16 N
ATOM 7361 CA TYR C 143 -62.007 91.967 -52.799 1.00174.73 C
ATOM 7362 C TYR C 143 -62.892 91.227 -53.802 1.00175.04 C
ATOM 7363 O TYR C 143 -63.149 91.729 -54.897 1.00174.96 O
ATOM 7364 CB TYR C 143 -60.575 92.059 -53.328 1.00173.59 C
ATOM 7365 N SER C 144 -63.375 90.055 -53.396 1.00175.01 N
ATOM 7366 CA SER C 144 -64.284 89.229 -54.189 1.00174.87 C
ATOM 7367 C SER C 144 -64.623 87.965 -53.405 1.00174.93 C
ATOM 7368 O SER C 144 -63.764 87.108 -53.192 1.00174.46 O
ATOM 7369 CB SER C 144 -63.676 88.859 -55.546 1.00173.98 C
ATOM 7370 OG SER C 144 -64.623 88.195 -56.365 1.00172.98 O
ATOM 7371 N SER C 145 -65.877 87.849 -52.982 1.00175.45 N
ATOM 7372 CA SER C 145 -66.303 86.713 -52.173 1.00175.33 C
ATOM 7373 C SER C 145 -66.410 85.440 -53.004 1.00174.78 C
ATOM 7374 O SER C 145 -66.403 84.334 -52.463 1.00174.47 O
ATOM 7375 CB SER C 145 -67.644 87.012 -51.500 1.00175.56 C
ATOM 7376 OG SER C 145 -68.027 85.954 -50.639 1.00176.34 O
ATOM 7377 N PHE C 146 -66.505 85.603 -54.319 1.00174.89 N
ATOM 7378 CA PHE C 146 -66.591 84.468 -55.230 1.00174.81 C
ATOM 7379 C PHE C 146 -65.248 83.761 -55.379 1.00174.40 C
ATOM 7380 O PHE C 146 -65.179 82.531 -55.376 1.00174.13 O
ATOM 7381 CB PHE C 146 -67.093 84.918 -56.602 1.00175.07 C
ATOM 7382 CG PHE C 146 -67.013 83.848 -57.655 1.00174.79 C
ATOM 7383 CD1 PHE C 146 -67.747 82.679 -57.534 1.00174.84 C
ATOM 7384 CD2 PHE C 146 -66.200 84.010 -58.765 1.00174.20 C
ATOM 7385 CE1 PHE C 146 -67.672 81.694 -58.502 1.00174.22 C
ATOM 7386 CE2 PHE C 146 -66.121 83.029 -59.734 1.00173.89 C
ATOM 7387 CZ PHE C 146 -66.858 81.870 -59.603 1.00173.75 C
ATOM 7388 N PHE C 147 -64.186 84.549 -55.511 1.00174.34 N
ATOM 7389 CA PHE C 147 -62.847 84.010 -55.710 1.00173.83 C
ATOM 7390 C PHE C 147 -62.156 83.720 -54.381 1.00174.32 C
ATOM 7391 O PHE C 147 -61.399 82.756 -54.272 1.00174.77 O
ATOM 7392 CB PHE C 147 -62.009 84.973 -56.551 1.00173.79 C
ATOM 7393 CG PHE C 147 -62.480 85.096 -57.973 1.00174.18 C
ATOM 7394 CD1 PHE C 147 -62.097 84.168 -58.928 1.00174.79 C
ATOM 7395 CD2 PHE C 147 -63.319 86.130 -58.351 1.00174.50 C
ATOM 7396 CE1 PHE C 147 -62.534 84.276 -60.235 1.00175.19 C
ATOM 7397 CE2 PHE C 147 -63.762 86.242 -59.655 1.00175.14 C
ATOM 7398 CZ PHE C 147 -63.368 85.315 -60.599 1.00175.04 C
ATOM 7399 N GLY C 148 -62.405 84.560 -53.380 1.00174.15 N
ATOM 7400 CA GLY C 148 -61.911 84.308 -52.036 1.00173.78 C
ATOM 7401 C GLY C 148 -62.384 82.958 -51.534 1.00174.23 C
ATOM 7402 O GLY C 148 -63.461 82.500 -51.912 1.00173.73 O
ATOM 7403 N TYR C 149 -61.589 82.316 -50.683 1.00174.72 N
ATOM 7404 CA TYR C 149 -61.936 80.976 -50.224 1.00174.52 C
ATOM 7405 C TYR C 149 -61.452 80.678 -48.813 1.00173.84 C
ATOM 7406 O TYR C 149 -60.586 81.366 -48.272 1.00172.72 O
ATOM 7407 CB TYR C 149 -61.376 79.919 -51.184 1.00174.57 C
ATOM 7408 CG TYR C 149 -59.865 79.920 -51.313 1.00175.43 C
ATOM 7409 CD1 TYR C 149 -59.231 80.683 -52.286 1.00175.81 C
ATOM 7410 CD2 TYR C 149 -59.073 79.151 -50.467 1.00174.78 C
ATOM 7411 CE1 TYR C 149 -57.851 80.683 -52.411 1.00174.70 C
ATOM 7412 CE2 TYR C 149 -57.694 79.147 -50.583 1.00174.71 C
ATOM 7413 CZ TYR C 149 -57.089 79.914 -51.556 1.00174.43 C
ATOM 7414 OH TYR C 149 -55.718 79.911 -51.674 1.00173.30 O
ATOM 7415 N ASP C 150 -62.033 79.636 -48.230 1.00174.35 N
ATOM 7416 CA ASP C 150 -61.642 79.146 -46.917 1.00175.34 C
ATOM 7417 C ASP C 150 -61.313 77.663 -47.059 1.00175.59 C
ATOM 7418 O ASP C 150 -62.104 76.901 -47.614 1.00175.20 O
ATOM 7419 CB ASP C 150 -62.760 79.379 -45.893 1.00175.21 C
ATOM 7420 CG ASP C 150 -62.345 79.030 -44.470 1.00174.83 C
ATOM 7421 OD1 ASP C 150 -61.933 77.878 -44.216 1.00175.19 O
ATOM 7422 OD2 ASP C 150 -62.440 79.916 -43.596 1.00174.11 O
ATOM 7423 N TRP C 151 -60.132 77.267 -46.596 1.00175.66 N
ATOM 7424 CA TRP C 151 -59.706 75.870 -46.650 1.00175.13 C
ATOM 7425 C TRP C 151 -60.735 74.920 -46.031 1.00175.51 C
ATOM 7426 O TRP C 151 -61.025 73.863 -46.593 1.00175.75 O
ATOM 7427 CB TRP C 151 -58.350 75.698 -45.956 1.00174.40 C
ATOM 7428 CG TRP C 151 -57.212 76.351 -46.691 1.00173.94 C
ATOM 7429 CD1 TRP C 151 -56.361 77.300 -46.204 1.00173.38 C
ATOM 7430 CD2 TRP C 151 -56.806 76.104 -48.042 1.00174.51 C
ATOM 7431 NE1 TRP C 151 -55.450 77.659 -47.166 1.00173.51 N
ATOM 7432 CE2 TRP C 151 -55.701 76.938 -48.306 1.00174.33 C
ATOM 7433 CE3 TRP C 151 -57.266 75.257 -49.056 1.00174.81 C
ATOM 7434 CZ2 TRP C 151 -55.051 76.952 -49.539 1.00174.78 C
ATOM 7435 CZ3 TRP C 151 -56.620 75.272 -50.279 1.00175.02 C
ATOM 7436 CH2 TRP C 151 -55.526 76.113 -50.510 1.00174.94 C
ATOM 7437 N LYS C 152 -61.281 75.295 -44.877 1.00175.38 N
ATOM 7438 CA LYS C 152 -62.270 74.463 -44.189 1.00174.48 C
ATOM 7439 C LYS C 152 -63.664 74.547 -44.813 1.00175.03 C
ATOM 7440 O LYS C 152 -64.573 73.823 -44.406 1.00174.48 O
ATOM 7441 CB LYS C 152 -62.346 74.845 -42.708 1.00172.71 C
ATOM 7442 CG LYS C 152 -61.006 74.816 -41.996 1.00173.22 C
ATOM 7443 CD LYS C 152 -61.147 75.171 -40.526 1.00174.04 C
ATOM 7444 CE LYS C 152 -59.787 75.301 -39.855 1.00174.80 C
ATOM 7445 NZ LYS C 152 -59.909 75.727 -38.434 1.00174.59 N
ATOM 7446 N ASP C 153 -63.832 75.429 -45.794 1.00175.43 N
ATOM 7447 CA ASP C 153 -65.113 75.565 -46.479 1.00174.19 C
ATOM 7448 C ASP C 153 -65.275 74.424 -47.478 1.00173.89 C
ATOM 7449 O ASP C 153 -64.955 74.566 -48.659 1.00173.75 O
ATOM 7450 CB ASP C 153 -65.222 76.923 -47.181 1.00174.20 C
ATOM 7451 CG ASP C 153 -66.640 77.246 -47.626 1.00174.09 C
ATOM 7452 OD1 ASP C 153 -67.474 76.323 -47.723 1.00173.72 O
ATOM 7453 OD2 ASP C 153 -66.918 78.433 -47.892 1.00174.65 O
ATOM 7454 N LYS C 154 -65.766 73.292 -46.982 1.00173.97 N
ATOM 7455 CA LYS C 154 -65.981 72.090 -47.784 1.00174.11 C
ATOM 7456 C LYS C 154 -66.793 72.339 -49.056 1.00174.20 C
ATOM 7457 O LYS C 154 -66.668 71.599 -50.029 1.00173.27 O
ATOM 7458 CB LYS C 154 -66.668 71.023 -46.932 1.00173.68 C
ATOM 7459 CG LYS C 154 -65.901 70.679 -45.669 1.00173.36 C
ATOM 7460 CD LYS C 154 -66.553 69.541 -44.913 1.00173.24 C
ATOM 7461 CE LYS C 154 -65.775 69.202 -43.653 1.00174.25 C
ATOM 7462 NZ LYS C 154 -65.550 70.394 -42.790 1.00173.88 N
ATOM 7463 N ASN C 155 -67.620 73.381 -49.042 1.00174.91 N
ATOM 7464 CA ASN C 155 -68.439 73.728 -50.199 1.00174.83 C
ATOM 7465 C ASN C 155 -67.637 74.433 -51.285 1.00174.50 C
ATOM 7466 O ASN C 155 -67.732 74.087 -52.461 1.00174.29 O
ATOM 7467 CB ASN C 155 -69.615 74.611 -49.777 1.00175.35 C
ATOM 7468 CG ASN C 155 -70.794 73.807 -49.271 1.00175.43 C
ATOM 7469 OD1 ASN C 155 -70.919 72.620 -49.564 1.00175.33 O
ATOM 7470 ND2 ASN C 155 -71.668 74.452 -48.507 1.00175.20 N
ATOM 7471 N LYS C 156 -66.856 75.431 -50.885 1.00174.62 N
ATOM 7472 CA LYS C 156 -66.012 76.164 -51.820 1.00174.61 C
ATOM 7473 C LYS C 156 -64.945 75.258 -52.421 1.00174.99 C
ATOM 7474 O LYS C 156 -64.668 75.324 -53.617 1.00175.20 O
ATOM 7475 CB LYS C 156 -65.358 77.361 -51.130 1.00173.94 C
ATOM 7476 CG LYS C 156 -66.061 78.677 -51.401 1.00173.71 C
ATOM 7477 CD LYS C 156 -65.451 79.805 -50.597 1.00173.89 C
ATOM 7478 CE LYS C 156 -66.118 81.127 -50.926 1.00174.27 C
ATOM 7479 NZ LYS C 156 -65.995 81.470 -52.371 1.00174.26 N
ATOM 7480 N MET C 157 -64.355 74.409 -51.585 1.00175.17 N
ATOM 7481 CA MET C 157 -63.319 73.480 -52.026 1.00174.95 C
ATOM 7482 C MET C 157 -63.827 72.514 -53.094 1.00174.60 C
ATOM 7483 O MET C 157 -63.241 72.413 -54.171 1.00174.87 O
ATOM 7484 CB MET C 157 -62.761 72.703 -50.833 1.00174.49 C
ATOM 7485 CG MET C 157 -62.014 73.563 -49.819 1.00174.45 C
ATOM 7486 SD MET C 157 -60.624 74.469 -50.536 1.00175.42 S
ATOM 7487 CE MET C 157 -61.311 76.119 -50.692 1.00174.34 C
ATOM 7488 N THR C 158 -64.911 71.803 -52.795 1.00174.10 N
ATOM 7489 CA THR C 158 -65.511 70.888 -53.764 1.00174.13 C
ATOM 7490 C THR C 158 -66.019 71.639 -55.001 1.00174.05 C
ATOM 7491 O THR C 158 -66.175 71.052 -56.069 1.00173.90 O
ATOM 7492 CB THR C 158 -66.671 70.072 -53.141 1.00174.00 C
ATOM 7493 OG1 THR C 158 -67.044 69.006 -54.023 1.00174.17 O
ATOM 7494 CG2 THR C 158 -67.879 70.951 -52.868 1.00174.03 C
ATOM 7495 N THR C 159 -66.264 72.939 -54.856 1.00174.02 N
ATOM 7496 CA THR C 159 -66.725 73.762 -55.970 1.00173.72 C
ATOM 7497 C THR C 159 -65.571 74.128 -56.901 1.00174.10 C
ATOM 7498 O THR C 159 -65.661 73.940 -58.115 1.00174.14 O
ATOM 7499 CB THR C 159 -67.412 75.050 -55.476 1.00174.08 C
ATOM 7500 OG1 THR C 159 -68.509 74.710 -54.619 1.00173.84 O
ATOM 7501 CG2 THR C 159 -67.932 75.865 -56.648 1.00174.68 C
ATOM 7502 N ILE C 160 -64.492 74.655 -56.328 1.00174.46 N
ATOM 7503 CA ILE C 160 -63.286 74.959 -57.093 1.00174.57 C
ATOM 7504 C ILE C 160 -62.744 73.693 -57.753 1.00174.63 C
ATOM 7505 O ILE C 160 -62.303 73.718 -58.903 1.00174.37 O
ATOM 7506 CB ILE C 160 -62.190 75.587 -56.206 1.00174.45 C
ATOM 7507 CG1 ILE C 160 -62.706 76.860 -55.532 1.00174.51 C
ATOM 7508 CG2 ILE C 160 -60.949 75.900 -57.027 1.00174.50 C
ATOM 7509 CD1 ILE C 160 -61.724 77.471 -54.557 1.00173.77 C
ATOM 7510 N LEU C 161 -62.787 72.588 -57.014 1.00174.84 N
ATOM 7511 CA LEU C 161 -62.440 71.277 -57.553 1.00174.27 C
ATOM 7512 C LEU C 161 -63.350 70.924 -58.725 1.00173.63 C
ATOM 7513 O LEU C 161 -62.902 70.368 -59.728 1.00173.27 O
ATOM 7514 CB LEU C 161 -62.534 70.207 -56.462 1.00174.24 C
ATOM 7515 CG LEU C 161 -62.566 68.743 -56.904 1.00173.57 C
ATOM 7516 CD1 LEU C 161 -61.225 68.328 -57.483 1.00173.32 C
ATOM 7517 CD2 LEU C 161 -62.956 67.839 -55.746 1.00174.10 C
ATOM 7518 N GLY C 162 -64.632 71.250 -58.584 1.00173.74 N
ATOM 7519 CA GLY C 162 -65.606 71.012 -59.631 1.00173.74 C
ATOM 7520 C GLY C 162 -65.298 71.798 -60.890 1.00173.89 C
ATOM 7521 O GLY C 162 -65.515 71.312 -61.999 1.00173.98 O
ATOM 7522 N PHE C 163 -64.797 73.018 -60.716 1.00174.19 N
ATOM 7523 CA PHE C 163 -64.394 73.857 -61.843 1.00174.50 C
ATOM 7524 C PHE C 163 -63.281 73.204 -62.652 1.00174.98 C
ATOM 7525 O PHE C 163 -63.397 73.034 -63.866 1.00175.11 O
ATOM 7526 CB PHE C 163 -63.935 75.234 -61.357 1.00174.32 C
ATOM 7527 CG PHE C 163 -65.043 76.092 -60.826 1.00174.38 C
ATOM 7528 CD1 PHE C 163 -66.273 76.131 -61.462 1.00174.09 C
ATOM 7529 CD2 PHE C 163 -64.853 76.869 -59.695 1.00174.29 C
ATOM 7530 CE1 PHE C 163 -67.294 76.926 -60.977 1.00174.45 C
ATOM 7531 CE2 PHE C 163 -65.870 77.665 -59.205 1.00174.40 C
ATOM 7532 CZ PHE C 163 -67.092 77.693 -59.847 1.00174.90 C
ATOM 7533 N HIS C 164 -62.198 72.848 -61.967 1.00174.91 N
ATOM 7534 CA HIS C 164 -61.040 72.233 -62.606 1.00175.15 C
ATOM 7535 C HIS C 164 -61.371 70.860 -63.188 1.00174.95 C
ATOM 7536 O HIS C 164 -60.784 70.444 -64.188 1.00174.91 O
ATOM 7537 CB HIS C 164 -59.884 72.119 -61.610 1.00174.93 C
ATOM 7538 CG HIS C 164 -59.474 73.429 -61.010 1.00174.83 C
ATOM 7539 ND1 HIS C 164 -58.767 73.520 -59.831 1.00175.19 N
ATOM 7540 CD2 HIS C 164 -59.676 74.701 -61.427 1.00174.24 C
ATOM 7541 CE1 HIS C 164 -58.548 74.791 -59.547 1.00174.67 C
ATOM 7542 NE2 HIS C 164 -59.090 75.529 -60.499 1.00174.44 N
ATOM 7543 N LEU C 165 -62.311 70.162 -62.558 1.00174.91 N
ATOM 7544 CA LEU C 165 -62.743 68.850 -63.032 1.00174.54 C
ATOM 7545 C LEU C 165 -63.437 68.940 -64.386 1.00174.11 C
ATOM 7546 O LEU C 165 -63.519 67.955 -65.121 1.00173.90 O
ATOM 7547 CB LEU C 165 -63.673 68.195 -62.012 1.00174.17 C
ATOM 7548 CG LEU C 165 -63.018 67.164 -61.092 1.00173.98 C
ATOM 7549 CD1 LEU C 165 -63.884 66.918 -59.866 1.00174.03 C
ATOM 7550 CD2 LEU C 165 -62.747 65.865 -61.837 1.00174.02 C
ATOM 7551 N ILE C 166 -63.935 70.128 -64.709 1.00174.01 N
ATOM 7552 CA ILE C 166 -64.566 70.372 -65.998 1.00173.77 C
ATOM 7553 C ILE C 166 -63.507 70.798 -67.004 1.00173.85 C
ATOM 7554 O ILE C 166 -63.485 70.319 -68.138 1.00174.34 O
ATOM 7555 CB ILE C 166 -65.658 71.456 -65.907 1.00174.50 C
ATOM 7556 CG1 ILE C 166 -66.742 71.045 -64.910 1.00174.82 C
ATOM 7557 CG2 ILE C 166 -66.271 71.717 -67.273 1.00174.59 C
ATOM 7558 CD1 ILE C 166 -67.737 72.145 -64.598 1.00174.92 C
ATOM 7559 N VAL C 167 -62.628 71.698 -66.569 1.00173.72 N
ATOM 7560 CA VAL C 167 -61.541 72.204 -67.400 1.00173.95 C
ATOM 7561 C VAL C 167 -60.692 71.056 -67.939 1.00173.74 C
ATOM 7562 O VAL C 167 -60.344 71.028 -69.122 1.00173.38 O
ATOM 7563 CB VAL C 167 -60.650 73.189 -66.614 1.00174.16 C
ATOM 7564 CG1 VAL C 167 -59.333 73.416 -67.333 1.00174.11 C
ATOM 7565 CG2 VAL C 167 -61.373 74.509 -66.414 1.00174.39 C
ATOM 7566 N LEU C 168 -60.377 70.104 -67.066 1.00173.84 N
ATOM 7567 CA LEU C 168 -59.648 68.907 -67.466 1.00173.67 C
ATOM 7568 C LEU C 168 -60.514 68.029 -68.360 1.00173.44 C
ATOM 7569 O LEU C 168 -60.013 67.361 -69.264 1.00173.58 O
ATOM 7570 CB LEU C 168 -59.187 68.120 -66.238 1.00174.10 C
ATOM 7571 CG LEU C 168 -57.965 68.666 -65.494 1.00174.67 C
ATOM 7572 CD1 LEU C 168 -57.687 67.847 -64.241 1.00174.40 C
ATOM 7573 CD2 LEU C 168 -56.742 68.702 -66.403 1.00174.03 C
ATOM 7574 N GLY C 169 -61.818 68.037 -68.100 1.00173.40 N
ATOM 7575 CA GLY C 169 -62.762 67.251 -68.873 1.00173.24 C
ATOM 7576 C GLY C 169 -62.856 67.689 -70.321 1.00172.85 C
ATOM 7577 O GLY C 169 -62.882 66.854 -71.225 1.00172.53 O
ATOM 7578 N ILE C 170 -62.916 68.998 -70.544 1.00172.93 N
ATOM 7579 CA ILE C 170 -62.952 69.542 -71.897 1.00173.05 C
ATOM 7580 C ILE C 170 -61.654 69.225 -72.632 1.00173.72 C
ATOM 7581 O ILE C 170 -61.665 68.889 -73.817 1.00173.92 O
ATOM 7582 CB ILE C 170 -63.178 71.065 -71.899 1.00173.05 C
ATOM 7583 CG1 ILE C 170 -64.329 71.438 -70.966 1.00173.30 C
ATOM 7584 CG2 ILE C 170 -63.476 71.556 -73.304 1.00173.60 C
ATOM 7585 CD1 ILE C 170 -64.513 72.930 -70.795 1.00173.56 C
ATOM 7586 N GLY C 171 -60.540 69.343 -71.915 1.00173.89 N
ATOM 7587 CA GLY C 171 -59.230 69.022 -72.452 1.00174.18 C
ATOM 7588 C GLY C 171 -59.138 67.608 -72.990 1.00173.79 C
ATOM 7589 O GLY C 171 -58.540 67.371 -74.039 1.00173.79 O
ATOM 7590 N ALA C 172 -59.721 66.662 -72.261 1.00173.50 N
ATOM 7591 CA ALA C 172 -59.744 65.267 -72.685 1.00173.11 C
ATOM 7592 C ALA C 172 -60.502 65.117 -73.999 1.00173.52 C
ATOM 7593 O ALA C 172 -60.221 64.219 -74.793 1.00173.66 O
ATOM 7594 CB ALA C 172 -60.366 64.393 -71.610 1.00173.84 C
ATOM 7595 N LEU C 173 -61.464 66.007 -74.221 1.00173.92 N
ATOM 7596 CA LEU C 173 -62.243 66.009 -75.453 1.00174.06 C
ATOM 7597 C LEU C 173 -61.517 66.774 -76.554 1.00173.92 C
ATOM 7598 O LEU C 173 -61.785 66.577 -77.738 1.00173.89 O
ATOM 7599 CB LEU C 173 -63.627 66.612 -75.211 1.00174.38 C
ATOM 7600 CG LEU C 173 -64.465 65.928 -74.128 1.00174.70 C
ATOM 7601 CD1 LEU C 173 -65.757 66.690 -73.878 1.00174.98 C
ATOM 7602 CD2 LEU C 173 -64.752 64.479 -74.501 1.00174.05 C
ATOM 7603 N LEU C 174 -60.598 67.650 -76.154 1.00174.13 N
ATOM 7604 CA LEU C 174 -59.777 68.390 -77.107 1.00174.11 C
ATOM 7605 C LEU C 174 -58.893 67.432 -77.898 1.00173.41 C
ATOM 7606 O LEU C 174 -58.542 67.692 -79.049 1.00172.55 O
ATOM 7607 CB LEU C 174 -58.912 69.425 -76.384 1.00174.15 C
ATOM 7608 CG LEU C 174 -58.843 70.844 -76.952 1.00174.79 C
ATOM 7609 CD1 LEU C 174 -57.664 71.600 -76.349 1.00174.57 C
ATOM 7610 CD2 LEU C 174 -58.763 70.837 -78.468 1.00175.20 C
ATOM 7611 N LEU C 175 -58.543 66.316 -77.268 1.00173.69 N
ATOM 7612 CA LEU C 175 -57.746 65.282 -77.913 1.00173.37 C
ATOM 7613 C LEU C 175 -58.616 64.470 -78.860 1.00172.88 C
ATOM 7614 O LEU C 175 -58.230 64.196 -79.998 1.00172.43 O
ATOM 7615 CB LEU C 175 -57.100 64.372 -76.867 1.00173.46 C
ATOM 7616 CG LEU C 175 -56.393 63.125 -77.397 1.00173.18 C
ATOM 7617 CD1 LEU C 175 -55.240 63.509 -78.305 1.00173.93 C
ATOM 7618 CD2 LEU C 175 -55.905 62.254 -76.254 1.00173.55 C
ATOM 7619 N VAL C 176 -59.791 64.088 -78.373 1.00173.15 N
ATOM 7620 CA VAL C 176 -60.777 63.379 -79.176 1.00173.49 C
ATOM 7621 C VAL C 176 -61.113 64.142 -80.457 1.00173.83 C
ATOM 7622 O VAL C 176 -61.284 63.546 -81.520 1.00173.58 O
ATOM 7623 CB VAL C 176 -62.071 63.143 -78.370 1.00173.64 C
ATOM 7624 CG1 VAL C 176 -63.081 62.365 -79.195 1.00175.03 C
ATOM 7625 CG2 VAL C 176 -61.760 62.417 -77.071 1.00172.76 C
ATOM 7626 N ALA C 177 -61.186 65.465 -80.350 1.00174.14 N
ATOM 7627 CA ALA C 177 -61.538 66.312 -81.485 1.00174.41 C
ATOM 7628 C ALA C 177 -60.439 66.303 -82.539 1.00174.36 C
ATOM 7629 O ALA C 177 -60.707 66.121 -83.727 1.00174.76 O
ATOM 7630 CB ALA C 177 -61.815 67.736 -81.023 1.00174.60 C
ATOM 7631 N LYS C 178 -59.205 66.515 -82.095 1.00174.10 N
ATOM 7632 CA LYS C 178 -58.044 66.482 -82.977 1.00174.70 C
ATOM 7633 C LYS C 178 -57.925 65.144 -83.708 1.00174.88 C
ATOM 7634 O LYS C 178 -57.541 65.096 -84.877 1.00174.83 O
ATOM 7635 CB LYS C 178 -56.768 66.759 -82.179 1.00174.34 C
ATOM 7636 CG LYS C 178 -55.485 66.629 -82.983 1.00173.94 C
ATOM 7637 CD LYS C 178 -55.421 67.672 -84.085 1.00173.97 C
ATOM 7638 CE LYS C 178 -54.138 67.550 -84.885 1.00174.26 C
ATOM 7639 NZ LYS C 178 -54.060 66.248 -85.603 1.00175.10 N
ATOM 7640 N ALA C 179 -58.265 64.062 -83.012 1.00174.36 N
ATOM 7641 CA ALA C 179 -58.123 62.716 -83.559 1.00174.58 C
ATOM 7642 C ALA C 179 -59.222 62.366 -84.560 1.00175.41 C
ATOM 7643 O ALA C 179 -58.952 61.802 -85.621 1.00175.29 O
ATOM 7644 CB ALA C 179 -58.102 61.694 -82.431 1.00173.42 C
ATOM 7645 N MET C 180 -60.462 62.699 -84.221 1.00175.27 N
ATOM 7646 CA MET C 180 -61.599 62.329 -85.056 1.00174.99 C
ATOM 7647 C MET C 180 -61.886 63.332 -86.171 1.00175.14 C
ATOM 7648 O MET C 180 -62.346 62.951 -87.247 1.00174.38 O
ATOM 7649 CB MET C 180 -62.848 62.155 -84.190 1.00173.53 C
ATOM 7650 CG MET C 180 -62.731 61.045 -83.163 1.00172.93 C
ATOM 7651 SD MET C 180 -64.268 60.776 -82.265 1.00173.81 S
ATOM 7652 CE MET C 180 -65.297 60.071 -83.549 1.00174.03 C
ATOM 7653 N PHE C 181 -61.615 64.608 -85.916 1.00175.20 N
ATOM 7654 CA PHE C 181 -62.000 65.664 -86.850 1.00174.11 C
ATOM 7655 C PHE C 181 -60.822 66.432 -87.447 1.00173.23 C
ATOM 7656 O PHE C 181 -60.659 66.486 -88.665 1.00173.14 O
ATOM 7657 CB PHE C 181 -62.941 66.654 -86.157 1.00174.30 C
ATOM 7658 CG PHE C 181 -64.077 66.000 -85.423 1.00174.49 C
ATOM 7659 CD1 PHE C 181 -64.812 64.986 -86.015 1.00174.16 C
ATOM 7660 CD2 PHE C 181 -64.406 66.398 -84.137 1.00174.23 C
ATOM 7661 CE1 PHE C 181 -65.855 64.382 -85.339 1.00173.65 C
ATOM 7662 CE2 PHE C 181 -65.448 65.798 -83.457 1.00174.60 C
ATOM 7663 CZ PHE C 181 -66.173 64.789 -84.059 1.00174.53 C
ATOM 7664 N PHE C 182 -60.007 67.026 -86.581 1.00173.20 N
ATOM 7665 CA PHE C 182 -59.024 68.021 -87.004 1.00173.95 C
ATOM 7666 C PHE C 182 -57.736 67.466 -87.615 1.00174.75 C
ATOM 7667 O PHE C 182 -56.807 68.227 -87.889 1.00175.17 O
ATOM 7668 CB PHE C 182 -58.663 68.921 -85.819 1.00173.78 C
ATOM 7669 CG PHE C 182 -59.727 69.924 -85.474 1.00173.78 C
ATOM 7670 CD1 PHE C 182 -59.562 71.260 -85.796 1.00174.20 C
ATOM 7671 CD2 PHE C 182 -60.896 69.530 -84.843 1.00173.94 C
ATOM 7672 CE1 PHE C 182 -60.537 72.188 -85.487 1.00174.93 C
ATOM 7673 CE2 PHE C 182 -61.876 70.454 -84.530 1.00174.62 C
ATOM 7674 CZ PHE C 182 -61.696 71.785 -84.853 1.00175.30 C
ATOM 7675 N GLY C 183 -57.669 66.158 -87.834 1.00174.56 N
ATOM 7676 CA GLY C 183 -56.511 65.590 -88.500 1.00174.93 C
ATOM 7677 C GLY C 183 -56.199 64.147 -88.159 1.00174.83 C
ATOM 7678 O GLY C 183 -55.900 63.346 -89.044 1.00175.68 O
ATOM 7679 N GLY C 184 -56.248 63.814 -86.875 1.00173.86 N
ATOM 7680 CA GLY C 184 -55.976 62.457 -86.441 1.00174.00 C
ATOM 7681 C GLY C 184 -54.740 62.344 -85.572 1.00173.99 C
ATOM 7682 O GLY C 184 -54.302 63.319 -84.962 1.00174.19 O
ATOM 7683 N LEU C 185 -54.177 61.141 -85.519 1.00173.61 N
ATOM 7684 CA LEU C 185 -52.977 60.875 -84.735 1.00173.25 C
ATOM 7685 C LEU C 185 -52.040 59.985 -85.535 1.00173.82 C
ATOM 7686 O LEU C 185 -52.448 59.388 -86.531 1.00173.87 O
ATOM 7687 CB LEU C 185 -53.326 60.201 -83.407 1.00172.51 C
ATOM 7688 CG LEU C 185 -54.404 60.842 -82.535 1.00172.70 C
ATOM 7689 CD1 LEU C 185 -54.858 59.876 -81.453 1.00173.79 C
ATOM 7690 CD2 LEU C 185 -53.899 62.136 -81.925 1.00173.42 C
ATOM 7691 N TYR C 186 -50.786 59.895 -85.108 1.00174.13 N
ATOM 7692 CA TYR C 186 -49.851 58.991 -85.762 1.00174.49 C
ATOM 7693 C TYR C 186 -50.072 57.560 -85.290 1.00174.35 C
ATOM 7694 O TYR C 186 -49.854 57.238 -84.123 1.00173.35 O
ATOM 7695 CB TYR C 186 -48.401 59.405 -85.507 1.00174.56 C
ATOM 7696 CG TYR C 186 -47.410 58.553 -86.269 1.00174.99 C
ATOM 7697 CD1 TYR C 186 -47.093 58.838 -87.591 1.00175.25 C
ATOM 7698 CD2 TYR C 186 -46.802 57.454 -85.673 1.00174.47 C
ATOM 7699 CE1 TYR C 186 -46.193 58.059 -88.296 1.00175.22 C
ATOM 7700 CE2 TYR C 186 -45.901 56.671 -86.369 1.00174.76 C
ATOM 7701 CZ TYR C 186 -45.600 56.977 -87.679 1.00175.18 C
ATOM 7702 OH TYR C 186 -44.703 56.196 -88.372 1.00174.93 O
ATOM 7703 N ASP C 187 -50.503 56.704 -86.209 1.00174.55 N
ATOM 7704 CA ASP C 187 -50.731 55.303 -85.894 1.00174.35 C
ATOM 7705 C ASP C 187 -49.610 54.441 -86.465 1.00173.97 C
ATOM 7706 O ASP C 187 -49.461 54.326 -87.680 1.00173.99 O
ATOM 7707 CB ASP C 187 -52.088 54.846 -86.434 1.00174.52 C
ATOM 7708 CG ASP C 187 -52.339 53.369 -86.208 1.00174.50 C
ATOM 7709 OD1 ASP C 187 -51.963 52.858 -85.132 1.00174.02 O
ATOM 7710 OD2 ASP C 187 -52.919 52.720 -87.105 1.00175.03 O
ATOM 7711 N THR C 188 -48.816 53.848 -85.580 1.00173.36 N
ATOM 7712 CA THR C 188 -47.715 52.989 -85.996 1.00173.32 C
ATOM 7713 C THR C 188 -48.250 51.664 -86.524 1.00173.63 C
ATOM 7714 O THR C 188 -47.610 50.998 -87.338 1.00172.97 O
ATOM 7715 CB THR C 188 -46.742 52.718 -84.839 1.00173.06 C
ATOM 7716 OG1 THR C 188 -47.357 51.836 -83.892 1.00174.11 O
ATOM 7717 CG2 THR C 188 -46.378 54.014 -84.141 1.00172.61 C
ATOM 7718 N TRP C 189 -49.434 51.292 -86.050 1.00173.92 N
ATOM 7719 CA TRP C 189 -50.073 50.041 -86.438 1.00173.28 C
ATOM 7720 C TRP C 189 -50.813 50.160 -87.767 1.00173.21 C
ATOM 7721 O TRP C 189 -51.483 49.218 -88.190 1.00172.80 O
ATOM 7722 CB TRP C 189 -51.042 49.582 -85.346 1.00173.50 C
ATOM 7723 CG TRP C 189 -50.382 49.346 -84.023 1.00173.83 C
ATOM 7724 CD1 TRP C 189 -50.422 50.163 -82.933 1.00173.45 C
ATOM 7725 CD2 TRP C 189 -49.585 48.217 -83.649 1.00173.91 C
ATOM 7726 NE1 TRP C 189 -49.699 49.616 -81.902 1.00173.10 N
ATOM 7727 CE2 TRP C 189 -49.173 48.418 -82.316 1.00172.92 C
ATOM 7728 CE3 TRP C 189 -49.176 47.053 -84.309 1.00174.43 C
ATOM 7729 CZ2 TRP C 189 -48.376 47.505 -81.631 1.00172.43 C
ATOM 7730 CZ3 TRP C 189 -48.384 46.146 -83.627 1.00174.09 C
ATOM 7731 CH2 TRP C 189 -47.994 46.377 -82.303 1.00173.00 C
ATOM 7732 N ALA C 190 -50.705 51.328 -88.395 1.00173.80 N
ATOM 7733 CA ALA C 190 -51.315 51.599 -89.697 1.00174.03 C
ATOM 7734 C ALA C 190 -51.133 50.446 -90.682 1.00173.58 C
ATOM 7735 O ALA C 190 -50.016 49.972 -90.882 1.00173.05 O
ATOM 7736 CB ALA C 190 -50.743 52.880 -90.283 1.00174.18 C
ATOM 7737 N PRO C 191 -52.242 49.993 -91.289 1.00174.10 N
ATOM 7738 CA PRO C 191 -52.303 48.871 -92.233 1.00174.34 C
ATOM 7739 C PRO C 191 -51.234 48.934 -93.321 1.00174.22 C
ATOM 7740 O PRO C 191 -50.519 47.956 -93.538 1.00173.81 O
ATOM 7741 CB PRO C 191 -53.703 49.013 -92.837 1.00175.38 C
ATOM 7742 CG PRO C 191 -54.502 49.607 -91.729 1.00175.16 C
ATOM 7743 CD PRO C 191 -53.570 50.604 -91.094 1.00174.46 C
ATOM 7744 N GLY C 192 -51.127 50.078 -93.989 1.00174.67 N
ATOM 7745 CA GLY C 192 -50.131 50.263 -95.029 1.00174.43 C
ATOM 7746 C GLY C 192 -48.765 50.651 -94.493 1.00173.34 C
ATOM 7747 O GLY C 192 -47.864 50.991 -95.259 1.00174.14 O
ATOM 7748 N GLY C 193 -48.608 50.600 -93.175 1.00172.26 N
ATOM 7749 CA GLY C 193 -47.379 51.040 -92.543 1.00172.32 C
ATOM 7750 C GLY C 193 -47.595 52.373 -91.860 1.00173.14 C
ATOM 7751 O GLY C 193 -48.353 53.203 -92.361 1.00172.87 O
ATOM 7752 N GLY C 194 -46.940 52.556 -90.713 1.00173.72 N
ATOM 7753 CA GLY C 194 -47.061 53.749 -89.886 1.00173.88 C
ATOM 7754 C GLY C 194 -47.338 55.054 -90.608 1.00173.37 C
ATOM 7755 O GLY C 194 -46.558 55.483 -91.457 1.00173.23 O
ATOM 7756 N ASP C 195 -48.458 55.682 -90.264 1.00173.02 N
ATOM 7757 CA ASP C 195 -48.914 56.878 -90.958 1.00173.19 C
ATOM 7758 C ASP C 195 -50.013 57.569 -90.156 1.00173.76 C
ATOM 7759 O ASP C 195 -50.701 56.931 -89.359 1.00173.70 O
ATOM 7760 CB ASP C 195 -49.418 56.518 -92.359 1.00172.54 C
ATOM 7761 CG ASP C 195 -49.859 57.730 -93.152 1.00172.95 C
ATOM 7762 OD1 ASP C 195 -49.106 58.725 -93.186 1.00172.75 O
ATOM 7763 OD2 ASP C 195 -50.959 57.687 -93.743 1.00173.82 O
ATOM 7764 N VAL C 196 -50.169 58.873 -90.364 1.00174.45 N
ATOM 7765 CA VAL C 196 -51.220 59.636 -89.698 1.00174.66 C
ATOM 7766 C VAL C 196 -52.597 59.177 -90.163 1.00174.14 C
ATOM 7767 O VAL C 196 -52.901 59.200 -91.357 1.00173.88 O
ATOM 7768 CB VAL C 196 -51.076 61.148 -89.956 1.00175.30 C
ATOM 7769 CG1 VAL C 196 -52.195 61.913 -89.265 1.00174.96 C
ATOM 7770 CG2 VAL C 196 -49.715 61.642 -89.484 1.00175.32 C
ATOM 7771 N ARG C 197 -53.428 58.768 -89.211 1.00173.78 N
ATOM 7772 CA ARG C 197 -54.741 58.223 -89.529 1.00173.14 C
ATOM 7773 C ARG C 197 -55.843 58.898 -88.723 1.00172.92 C
ATOM 7774 O ARG C 197 -55.669 59.202 -87.543 1.00173.07 O
ATOM 7775 CB ARG C 197 -54.764 56.714 -89.279 1.00173.40 C
ATOM 7776 CG ARG C 197 -55.896 55.985 -89.984 1.00173.24 C
ATOM 7777 CD ARG C 197 -56.094 54.596 -89.405 1.00173.17 C
ATOM 7778 NE ARG C 197 -56.445 54.648 -87.990 1.00174.06 N
ATOM 7779 CZ ARG C 197 -56.486 53.587 -87.193 1.00174.80 C
ATOM 7780 NH1 ARG C 197 -56.198 52.384 -87.672 1.00174.58 N
ATOM 7781 NH2 ARG C 197 -56.814 53.728 -85.916 1.00174.64 N
ATOM 7782 N VAL C 198 -56.978 59.130 -89.372 1.00173.08 N
ATOM 7783 CA VAL C 198 -58.128 59.725 -88.707 1.00173.23 C
ATOM 7784 C VAL C 198 -58.974 58.642 -88.051 1.00173.33 C
ATOM 7785 O VAL C 198 -59.510 57.768 -88.730 1.00173.85 O
ATOM 7786 CB VAL C 198 -59.007 60.521 -89.685 1.00174.46 C
ATOM 7787 CG1 VAL C 198 -60.185 61.132 -88.948 1.00173.46 C
ATOM 7788 CG2 VAL C 198 -58.193 61.598 -90.377 1.00174.98 C
ATOM 7789 N ILE C 199 -59.091 58.699 -86.729 1.00173.53 N
ATOM 7790 CA ILE C 199 -59.876 57.711 -85.999 1.00174.54 C
ATOM 7791 C ILE C 199 -61.355 58.064 -86.099 1.00174.39 C
ATOM 7792 O ILE C 199 -61.790 59.105 -85.602 1.00174.03 O
ATOM 7793 CB ILE C 199 -59.470 57.614 -84.507 1.00175.26 C
ATOM 7794 CG1 ILE C 199 -58.160 56.837 -84.333 1.00175.34 C
ATOM 7795 CG2 ILE C 199 -60.550 56.898 -83.711 1.00174.67 C
ATOM 7796 CD1 ILE C 199 -56.917 57.519 -84.876 1.00175.04 C
ATOM 7797 N THR C 200 -62.121 57.202 -86.760 1.00174.97 N
ATOM 7798 CA THR C 200 -63.553 57.422 -86.925 1.00175.59 C
ATOM 7799 C THR C 200 -64.341 56.214 -86.434 1.00175.06 C
ATOM 7800 O THR C 200 -65.326 55.807 -87.051 1.00175.44 O
ATOM 7801 CB THR C 200 -63.925 57.709 -88.397 1.00176.18 C
ATOM 7802 OG1 THR C 200 -63.523 56.607 -89.220 1.00176.96 O
ATOM 7803 CG2 THR C 200 -63.242 58.978 -88.890 1.00175.04 C
ATOM 7804 N ASN C 201 -63.898 55.658 -85.311 1.00174.26 N
ATOM 7805 CA ASN C 201 -64.558 54.514 -84.690 1.00174.70 C
ATOM 7806 C ASN C 201 -64.030 54.243 -83.281 1.00175.07 C
ATOM 7807 O ASN C 201 -63.508 53.160 -83.012 1.00174.85 O
ATOM 7808 CB ASN C 201 -64.380 53.264 -85.555 1.00174.52 C
ATOM 7809 CG ASN C 201 -65.685 52.525 -85.786 1.00175.28 C
ATOM 7810 OD1 ASN C 201 -66.159 51.791 -84.918 1.00176.24 O
ATOM 7811 ND2 ASN C 201 -66.271 52.713 -86.963 1.00174.63 N
ATOM 7812 N PRO C 202 -64.150 55.232 -82.379 1.00175.40 N
ATOM 7813 CA PRO C 202 -63.616 55.085 -81.021 1.00174.35 C
ATOM 7814 C PRO C 202 -64.333 54.000 -80.224 1.00174.01 C
ATOM 7815 O PRO C 202 -65.563 53.943 -80.235 1.00173.99 O
ATOM 7816 CB PRO C 202 -63.861 56.463 -80.407 1.00174.28 C
ATOM 7817 CG PRO C 202 -65.078 56.955 -81.111 1.00175.17 C
ATOM 7818 CD PRO C 202 -64.908 56.488 -82.527 1.00175.60 C
ATOM 7819 N THR C 203 -63.569 53.145 -79.551 1.00174.20 N
ATOM 7820 CA THR C 203 -64.148 52.115 -78.698 1.00174.50 C
ATOM 7821 C THR C 203 -64.917 52.744 -77.543 1.00174.38 C
ATOM 7822 O THR C 203 -64.330 53.368 -76.661 1.00174.49 O
ATOM 7823 CB THR C 203 -63.071 51.174 -78.134 1.00174.12 C
ATOM 7824 OG1 THR C 203 -62.423 50.487 -79.211 1.00174.66 O
ATOM 7825 CG2 THR C 203 -63.695 50.158 -77.188 1.00172.86 C
ATOM 7826 N LEU C 204 -66.235 52.580 -77.556 1.00174.33 N
ATOM 7827 CA LEU C 204 -67.084 53.173 -76.532 1.00174.70 C
ATOM 7828 C LEU C 204 -67.660 52.106 -75.612 1.00175.04 C
ATOM 7829 O LEU C 204 -68.325 52.420 -74.625 1.00175.73 O
ATOM 7830 CB LEU C 204 -68.211 53.985 -77.172 1.00174.72 C
ATOM 7831 CG LEU C 204 -67.807 55.368 -77.687 1.00175.24 C
ATOM 7832 CD1 LEU C 204 -68.951 56.030 -78.445 1.00176.27 C
ATOM 7833 CD2 LEU C 204 -67.323 56.257 -76.545 1.00174.73 C
ATOM 7834 N ASP C 205 -67.410 50.845 -75.951 1.00174.58 N
ATOM 7835 CA ASP C 205 -67.834 49.720 -75.124 1.00175.45 C
ATOM 7836 C ASP C 205 -67.152 49.785 -73.757 1.00175.67 C
ATOM 7837 O ASP C 205 -65.940 49.595 -73.659 1.00175.78 O
ATOM 7838 CB ASP C 205 -67.516 48.393 -75.824 1.00174.84 C
ATOM 7839 CG ASP C 205 -68.274 47.215 -75.230 1.00174.17 C
ATOM 7840 OD1 ASP C 205 -68.424 47.147 -73.992 1.00173.76 O
ATOM 7841 OD2 ASP C 205 -68.718 46.346 -76.009 1.00173.59 O
ATOM 7842 N PRO C 206 -67.933 50.057 -72.698 1.00175.11 N
ATOM 7843 CA PRO C 206 -67.412 50.164 -71.331 1.00173.77 C
ATOM 7844 C PRO C 206 -66.712 48.888 -70.870 1.00173.40 C
ATOM 7845 O PRO C 206 -65.698 48.966 -70.177 1.00173.19 O
ATOM 7846 CB PRO C 206 -68.672 50.430 -70.501 1.00174.18 C
ATOM 7847 CG PRO C 206 -69.780 49.842 -71.311 1.00174.15 C
ATOM 7848 CD PRO C 206 -69.402 50.160 -72.725 1.00174.93 C
ATOM 7849 N ARG C 207 -67.262 47.734 -71.241 1.00173.10 N
ATOM 7850 CA ARG C 207 -66.663 46.440 -70.925 1.00173.35 C
ATOM 7851 C ARG C 207 -65.218 46.354 -71.410 1.00173.24 C
ATOM 7852 O ARG C 207 -64.354 45.801 -70.731 1.00172.76 O
ATOM 7853 CB ARG C 207 -67.493 45.309 -71.542 1.00173.56 C
ATOM 7854 CG ARG C 207 -66.959 43.913 -71.270 1.00174.83 C
ATOM 7855 CD ARG C 207 -67.288 42.965 -72.417 1.00174.94 C
ATOM 7856 NE ARG C 207 -66.324 41.870 -72.527 1.00175.90 N
ATOM 7857 CZ ARG C 207 -65.118 41.981 -73.077 1.00176.60 C
ATOM 7858 NH1 ARG C 207 -64.716 43.140 -73.583 1.00177.22 N
ATOM 7859 NH2 ARG C 207 -64.313 40.928 -73.126 1.00176.08 N
ATOM 7860 N VAL C 208 -64.964 46.916 -72.587 1.00173.66 N
ATOM 7861 CA VAL C 208 -63.625 46.925 -73.163 1.00174.12 C
ATOM 7862 C VAL C 208 -62.771 48.007 -72.513 1.00174.18 C
ATOM 7863 O VAL C 208 -61.668 47.736 -72.035 1.00173.95 O
ATOM 7864 CB VAL C 208 -63.663 47.155 -74.684 1.00174.75 C
ATOM 7865 CG1 VAL C 208 -62.265 47.401 -75.218 1.00174.87 C
ATOM 7866 CG2 VAL C 208 -64.292 45.961 -75.382 1.00174.22 C
ATOM 7867 N ILE C 209 -63.292 49.232 -72.506 1.00174.79 N
ATOM 7868 CA ILE C 209 -62.607 50.381 -71.922 1.00174.95 C
ATOM 7869 C ILE C 209 -62.187 50.119 -70.479 1.00174.30 C
ATOM 7870 O ILE C 209 -61.003 49.960 -70.190 1.00174.75 O
ATOM 7871 CB ILE C 209 -63.494 51.642 -71.974 1.00175.09 C
ATOM 7872 CG1 ILE C 209 -63.755 52.042 -73.427 1.00175.00 C
ATOM 7873 CG2 ILE C 209 -62.841 52.800 -71.233 1.00174.68 C
ATOM 7874 CD1 ILE C 209 -62.503 52.440 -74.174 1.00174.36 C
ATOM 7875 N PHE C 210 -63.161 50.048 -69.578 1.00173.60 N
ATOM 7876 CA PHE C 210 -62.876 49.857 -68.159 1.00173.95 C
ATOM 7877 C PHE C 210 -62.240 48.496 -67.864 1.00174.19 C
ATOM 7878 O PHE C 210 -61.792 48.244 -66.746 1.00174.34 O
ATOM 7879 CB PHE C 210 -64.156 50.037 -67.343 1.00174.77 C
ATOM 7880 CG PHE C 210 -64.765 51.404 -67.477 1.00175.12 C
ATOM 7881 CD1 PHE C 210 -64.141 52.511 -66.924 1.00175.10 C
ATOM 7882 CD2 PHE C 210 -65.953 51.586 -68.168 1.00175.07 C
ATOM 7883 CE1 PHE C 210 -64.694 53.772 -67.050 1.00175.39 C
ATOM 7884 CE2 PHE C 210 -66.510 52.844 -68.296 1.00175.25 C
ATOM 7885 CZ PHE C 210 -65.879 53.938 -67.736 1.00175.86 C
ATOM 7886 N GLY C 211 -62.206 47.626 -68.871 1.00174.12 N
ATOM 7887 CA GLY C 211 -61.530 46.346 -68.765 1.00174.32 C
ATOM 7888 C GLY C 211 -60.047 46.491 -68.472 1.00174.47 C
ATOM 7889 O GLY C 211 -59.479 45.709 -67.708 1.00174.49 O
ATOM 7890 N TYR C 212 -59.424 47.490 -69.093 1.00174.58 N
ATOM 7891 CA TYR C 212 -58.009 47.797 -68.879 1.00174.47 C
ATOM 7892 C TYR C 212 -57.660 47.997 -67.405 1.00174.48 C
ATOM 7893 O TYR C 212 -56.583 47.607 -66.957 1.00174.81 O
ATOM 7894 CB TYR C 212 -57.610 49.047 -69.671 1.00174.42 C
ATOM 7895 CG TYR C 212 -57.357 48.802 -71.144 1.00174.76 C
ATOM 7896 CD1 TYR C 212 -56.171 48.223 -71.578 1.00174.57 C
ATOM 7897 CD2 TYR C 212 -58.296 49.165 -72.101 1.00174.54 C
ATOM 7898 CE1 TYR C 212 -55.934 48.002 -72.924 1.00174.47 C
ATOM 7899 CE2 TYR C 212 -58.067 48.949 -73.447 1.00173.68 C
ATOM 7900 CZ TYR C 212 -56.885 48.368 -73.852 1.00173.53 C
ATOM 7901 OH TYR C 212 -56.657 48.153 -75.192 1.00172.66 O
ATOM 7902 N LEU C 213 -58.568 48.616 -66.658 1.00174.15 N
ATOM 7903 CA LEU C 213 -58.346 48.871 -65.238 1.00173.40 C
ATOM 7904 C LEU C 213 -58.347 47.572 -64.436 1.00173.45 C
ATOM 7905 O LEU C 213 -57.759 47.497 -63.357 1.00173.53 O
ATOM 7906 CB LEU C 213 -59.405 49.832 -64.685 1.00172.88 C
ATOM 7907 CG LEU C 213 -59.279 51.335 -64.968 1.00172.30 C
ATOM 7908 CD1 LEU C 213 -59.371 51.660 -66.454 1.00173.52 C
ATOM 7909 CD2 LEU C 213 -60.331 52.108 -64.188 1.00172.92 C
ATOM 7910 N LEU C 214 -59.012 46.552 -64.969 1.00173.44 N
ATOM 7911 CA LEU C 214 -59.106 45.258 -64.297 1.00173.34 C
ATOM 7912 C LEU C 214 -58.008 44.312 -64.770 1.00173.70 C
ATOM 7913 O LEU C 214 -57.997 43.131 -64.421 1.00174.02 O
ATOM 7914 CB LEU C 214 -60.478 44.619 -64.533 1.00173.67 C
ATOM 7915 CG LEU C 214 -61.692 45.089 -63.720 1.00174.93 C
ATOM 7916 CD1 LEU C 214 -61.983 46.574 -63.906 1.00175.00 C
ATOM 7917 CD2 LEU C 214 -62.919 44.254 -64.066 1.00174.93 C
ATOM 7918 N LYS C 215 -57.090 44.841 -65.570 1.00173.75 N
ATOM 7919 CA LYS C 215 -55.983 44.057 -66.103 1.00173.83 C
ATOM 7920 C LYS C 215 -54.828 44.009 -65.110 1.00174.06 C
ATOM 7921 O LYS C 215 -54.589 44.971 -64.379 1.00174.44 O
ATOM 7922 CB LYS C 215 -55.509 44.640 -67.436 1.00174.38 C
ATOM 7923 CG LYS C 215 -55.154 43.607 -68.491 1.00174.43 C
ATOM 7924 CD LYS C 215 -54.973 44.267 -69.850 1.00173.77 C
ATOM 7925 CE LYS C 215 -54.697 43.243 -70.938 1.00173.21 C
ATOM 7926 NZ LYS C 215 -54.598 43.885 -72.277 1.00172.91 N
ATOM 7927 N SER C 216 -54.119 42.884 -65.082 1.00173.85 N
ATOM 7928 CA SER C 216 -52.948 42.729 -64.223 1.00174.52 C
ATOM 7929 C SER C 216 -51.865 43.747 -64.582 1.00174.45 C
ATOM 7930 O SER C 216 -51.831 44.244 -65.704 1.00174.67 O
ATOM 7931 CB SER C 216 -52.400 41.302 -64.332 1.00173.99 C
ATOM 7932 OG SER C 216 -51.245 41.126 -63.531 1.00173.67 O
ATOM 7933 N PRO C 217 -51.004 44.093 -63.613 1.00174.33 N
ATOM 7934 CA PRO C 217 -49.876 44.983 -63.895 1.00173.83 C
ATOM 7935 C PRO C 217 -48.555 44.250 -64.135 1.00174.02 C
ATOM 7936 O PRO C 217 -47.523 44.905 -64.235 1.00173.69 O
ATOM 7937 CB PRO C 217 -49.794 45.822 -62.624 1.00174.18 C
ATOM 7938 CG PRO C 217 -50.152 44.843 -61.560 1.00174.78 C
ATOM 7939 CD PRO C 217 -51.261 44.003 -62.164 1.00174.70 C
ATOM 7940 N PHE C 218 -48.583 42.923 -64.219 1.00174.28 N
ATOM 7941 CA PHE C 218 -47.359 42.140 -64.387 1.00174.62 C
ATOM 7942 C PHE C 218 -47.077 41.794 -65.849 1.00175.11 C
ATOM 7943 O PHE C 218 -47.602 42.434 -66.760 1.00175.31 O
ATOM 7944 CB PHE C 218 -47.429 40.862 -63.548 1.00173.83 C
ATOM 7945 CG PHE C 218 -47.332 41.106 -62.070 1.00173.67 C
ATOM 7946 CD1 PHE C 218 -46.097 41.260 -61.461 1.00173.85 C
ATOM 7947 CD2 PHE C 218 -48.473 41.198 -61.291 1.00173.90 C
ATOM 7948 CE1 PHE C 218 -46.001 41.490 -60.102 1.00173.99 C
ATOM 7949 CE2 PHE C 218 -48.384 41.430 -59.931 1.00174.51 C
ATOM 7950 CZ PHE C 218 -47.147 41.576 -59.336 1.00174.49 C
ATOM 7951 N GLY C 219 -46.217 40.802 -66.062 1.00174.38 N
ATOM 7952 CA GLY C 219 -45.878 40.351 -67.401 1.00174.04 C
ATOM 7953 C GLY C 219 -47.078 39.842 -68.180 1.00174.25 C
ATOM 7954 O GLY C 219 -47.901 39.094 -67.650 1.00174.28 O
ATOM 7955 N GLY C 220 -47.171 40.239 -69.446 1.00174.11 N
ATOM 7956 CA GLY C 220 -48.296 39.865 -70.284 1.00174.06 C
ATOM 7957 C GLY C 220 -49.427 40.867 -70.159 1.00174.07 C
ATOM 7958 O GLY C 220 -49.457 41.874 -70.869 1.00174.24 O
ATOM 7959 N GLU C 221 -50.363 40.588 -69.257 1.00174.15 N
ATOM 7960 CA GLU C 221 -51.418 41.538 -68.929 1.00174.36 C
ATOM 7961 C GLU C 221 -50.767 42.791 -68.357 1.00173.96 C
ATOM 7962 O GLU C 221 -50.250 42.768 -67.244 1.00174.86 O
ATOM 7963 CB GLU C 221 -52.408 40.934 -67.931 1.00174.51 C
ATOM 7964 CG GLU C 221 -52.737 39.466 -68.177 1.00174.62 C
ATOM 7965 CD GLU C 221 -53.521 39.242 -69.455 1.00175.69 C
ATOM 7966 OE1 GLU C 221 -54.618 39.824 -69.591 1.00177.04 O
ATOM 7967 OE2 GLU C 221 -53.044 38.481 -70.324 1.00175.28 O
ATOM 7968 N GLY C 222 -50.781 43.876 -69.124 1.00173.06 N
ATOM 7969 CA GLY C 222 -49.994 45.051 -68.789 1.00173.60 C
ATOM 7970 C GLY C 222 -50.729 46.244 -68.206 1.00173.55 C
ATOM 7971 O GLY C 222 -50.157 47.330 -68.116 1.00173.33 O
ATOM 7972 N TRP C 223 -51.988 46.048 -67.820 1.00173.79 N
ATOM 7973 CA TRP C 223 -52.812 47.113 -67.247 1.00174.01 C
ATOM 7974 C TRP C 223 -52.969 48.243 -68.270 1.00173.71 C
ATOM 7975 O TRP C 223 -53.054 47.981 -69.470 1.00173.76 O
ATOM 7976 CB TRP C 223 -52.213 47.624 -65.925 1.00173.76 C
ATOM 7977 CG TRP C 223 -53.183 48.376 -65.051 1.00174.20 C
ATOM 7978 CD1 TRP C 223 -54.476 48.034 -64.779 1.00173.98 C
ATOM 7979 CD2 TRP C 223 -52.929 49.587 -64.325 1.00174.69 C
ATOM 7980 NE1 TRP C 223 -55.046 48.960 -63.940 1.00173.56 N
ATOM 7981 CE2 TRP C 223 -54.117 49.923 -63.645 1.00174.18 C
ATOM 7982 CE3 TRP C 223 -51.815 50.422 -64.188 1.00175.01 C
ATOM 7983 CZ2 TRP C 223 -54.224 51.056 -62.841 1.00174.35 C
ATOM 7984 CZ3 TRP C 223 -51.923 51.548 -63.387 1.00174.73 C
ATOM 7985 CH2 TRP C 223 -53.118 51.853 -62.724 1.00174.61 C
ATOM 7986 N ILE C 224 -53.024 49.485 -67.797 1.00173.28 N
ATOM 7987 CA ILE C 224 -53.198 50.646 -68.668 1.00173.08 C
ATOM 7988 C ILE C 224 -52.154 50.731 -69.786 1.00173.68 C
ATOM 7989 O ILE C 224 -52.466 51.132 -70.905 1.00174.38 O
ATOM 7990 CB ILE C 224 -53.160 51.956 -67.858 1.00172.66 C
ATOM 7991 CG1 ILE C 224 -54.104 51.868 -66.659 1.00173.38 C
ATOM 7992 CG2 ILE C 224 -53.554 53.137 -68.728 1.00172.87 C
ATOM 7993 CD1 ILE C 224 -54.137 53.126 -65.828 1.00173.99 C
ATOM 7994 N VAL C 225 -50.917 50.354 -69.483 1.00173.34 N
ATOM 7995 CA VAL C 225 -49.830 50.454 -70.454 1.00173.20 C
ATOM 7996 C VAL C 225 -50.006 49.479 -71.624 1.00172.85 C
ATOM 7997 O VAL C 225 -49.339 49.597 -72.652 1.00172.66 O
ATOM 7998 CB VAL C 225 -48.467 50.195 -69.779 1.00174.12 C
ATOM 7999 CG1 VAL C 225 -47.329 50.728 -70.635 1.00173.90 C
ATOM 8000 CG2 VAL C 225 -48.433 50.851 -68.412 1.00175.15 C
ATOM 8001 N SER C 226 -50.931 48.536 -71.478 1.00173.17 N
ATOM 8002 CA SER C 226 -51.114 47.488 -72.476 1.00173.22 C
ATOM 8003 C SER C 226 -51.967 47.922 -73.669 1.00173.26 C
ATOM 8004 O SER C 226 -52.240 47.117 -74.559 1.00173.35 O
ATOM 8005 CB SER C 226 -51.732 46.247 -71.826 1.00173.15 C
ATOM 8006 OG SER C 226 -53.023 46.523 -71.312 1.00173.37 O
ATOM 8007 N VAL C 227 -52.394 49.182 -73.683 1.00173.01 N
ATOM 8008 CA VAL C 227 -53.148 49.716 -74.816 1.00172.95 C
ATOM 8009 C VAL C 227 -52.331 49.617 -76.099 1.00173.44 C
ATOM 8010 O VAL C 227 -51.171 50.028 -76.137 1.00173.80 O
ATOM 8011 CB VAL C 227 -53.561 51.183 -74.593 1.00173.02 C
ATOM 8012 CG1 VAL C 227 -54.338 51.703 -75.791 1.00173.85 C
ATOM 8013 CG2 VAL C 227 -54.385 51.316 -73.327 1.00173.76 C
ATOM 8014 N ASN C 228 -52.937 49.067 -77.147 1.00173.76 N
ATOM 8015 CA ASN C 228 -52.214 48.785 -78.381 1.00174.15 C
ATOM 8016 C ASN C 228 -52.924 49.259 -79.652 1.00174.13 C
ATOM 8017 O ASN C 228 -52.605 48.805 -80.753 1.00173.92 O
ATOM 8018 CB ASN C 228 -51.931 47.283 -78.475 1.00173.74 C
ATOM 8019 CG ASN C 228 -53.197 46.453 -78.506 1.00173.41 C
ATOM 8020 OD1 ASN C 228 -53.846 46.329 -79.544 1.00174.36 O
ATOM 8021 ND2 ASN C 228 -53.557 45.878 -77.364 1.00172.05 N
ATOM 8022 N ASN C 229 -53.878 50.174 -79.501 1.00174.15 N
ATOM 8023 CA ASN C 229 -54.575 50.745 -80.652 1.00174.05 C
ATOM 8024 C ASN C 229 -55.241 52.077 -80.321 1.00173.84 C
ATOM 8025 O ASN C 229 -55.724 52.283 -79.206 1.00173.62 O
ATOM 8026 CB ASN C 229 -55.615 49.760 -81.191 1.00173.91 C
ATOM 8027 CG ASN C 229 -56.664 49.400 -80.161 1.00173.81 C
ATOM 8028 OD1 ASN C 229 -56.390 48.677 -79.203 1.00174.03 O
ATOM 8029 ND2 ASN C 229 -57.876 49.902 -80.354 1.00173.62 N
ATOM 8030 N LEU C 230 -55.261 52.978 -81.299 1.00174.12 N
ATOM 8031 CA LEU C 230 -55.760 54.335 -81.093 1.00174.46 C
ATOM 8032 C LEU C 230 -57.268 54.388 -80.869 1.00174.26 C
ATOM 8033 O LEU C 230 -57.778 55.355 -80.304 1.00174.41 O
ATOM 8034 CB LEU C 230 -55.386 55.227 -82.279 1.00174.64 C
ATOM 8035 CG LEU C 230 -53.899 55.558 -82.424 1.00175.50 C
ATOM 8036 CD1 LEU C 230 -53.667 56.494 -83.599 1.00174.82 C
ATOM 8037 CD2 LEU C 230 -53.357 56.165 -81.138 1.00175.48 C
ATOM 8038 N GLU C 231 -57.977 53.361 -81.326 1.00174.10 N
ATOM 8039 CA GLU C 231 -59.419 53.273 -81.112 1.00174.18 C
ATOM 8040 C GLU C 231 -59.743 53.326 -79.622 1.00173.88 C
ATOM 8041 O GLU C 231 -60.622 54.075 -79.193 1.00173.80 O
ATOM 8042 CB GLU C 231 -59.985 51.993 -81.731 1.00174.27 C
ATOM 8043 CG GLU C 231 -60.237 52.076 -83.231 1.00174.89 C
ATOM 8044 CD GLU C 231 -58.972 52.333 -84.027 1.00174.39 C
ATOM 8045 OE1 GLU C 231 -58.022 51.529 -83.912 1.00173.37 O
ATOM 8046 OE2 GLU C 231 -58.928 53.339 -84.767 1.00174.79 O
ATOM 8047 N ASP C 232 -59.025 52.525 -78.842 1.00173.62 N
ATOM 8048 CA ASP C 232 -59.175 52.519 -77.393 1.00173.71 C
ATOM 8049 C ASP C 232 -58.722 53.843 -76.787 1.00173.89 C
ATOM 8050 O ASP C 232 -59.385 54.388 -75.906 1.00174.08 O
ATOM 8051 CB ASP C 232 -58.390 51.358 -76.779 1.00173.68 C
ATOM 8052 CG ASP C 232 -58.882 50.009 -77.259 1.00173.77 C
ATOM 8053 OD1 ASP C 232 -59.243 49.895 -78.449 1.00174.16 O
ATOM 8054 OD2 ASP C 232 -58.906 49.061 -76.447 1.00173.51 O
ATOM 8055 N VAL C 233 -57.586 54.346 -77.264 1.00173.96 N
ATOM 8056 CA VAL C 233 -57.038 55.619 -76.802 1.00174.38 C
ATOM 8057 C VAL C 233 -58.053 56.750 -76.943 1.00174.73 C
ATOM 8058 O VAL C 233 -58.382 57.426 -75.966 1.00174.64 O
ATOM 8059 CB VAL C 233 -55.759 55.999 -77.574 1.00174.39 C
ATOM 8060 CG1 VAL C 233 -55.208 57.325 -77.075 1.00174.19 C
ATOM 8061 CG2 VAL C 233 -54.713 54.904 -77.437 1.00174.01 C
ATOM 8062 N VAL C 234 -58.542 56.951 -78.163 1.00175.29 N
ATOM 8063 CA VAL C 234 -59.558 57.962 -78.435 1.00175.48 C
ATOM 8064 C VAL C 234 -60.845 57.670 -77.666 1.00174.77 C
ATOM 8065 O VAL C 234 -61.402 58.550 -77.008 1.00174.38 O
ATOM 8066 CB VAL C 234 -59.875 58.048 -79.943 1.00175.53 C
ATOM 8067 CG1 VAL C 234 -61.023 59.013 -80.193 1.00175.64 C
ATOM 8068 CG2 VAL C 234 -58.643 58.473 -80.724 1.00174.82 C
ATOM 8069 N GLY C 235 -61.306 56.425 -77.761 1.00174.66 N
ATOM 8070 CA GLY C 235 -62.484 55.968 -77.045 1.00174.50 C
ATOM 8071 C GLY C 235 -62.410 56.175 -75.543 1.00174.67 C
ATOM 8072 O GLY C 235 -63.338 56.710 -74.936 1.00174.20 O
ATOM 8073 N GLY C 236 -61.307 55.734 -74.946 1.00174.64 N
ATOM 8074 CA GLY C 236 -61.082 55.886 -73.520 1.00173.92 C
ATOM 8075 C GLY C 236 -61.168 57.333 -73.085 1.00173.86 C
ATOM 8076 O GLY C 236 -61.731 57.649 -72.037 1.00173.46 O
ATOM 8077 N HIS C 237 -60.595 58.212 -73.899 1.00174.40 N
ATOM 8078 CA HIS C 237 -60.582 59.642 -73.614 1.00174.94 C
ATOM 8079 C HIS C 237 -61.965 60.265 -73.694 1.00174.82 C
ATOM 8080 O HIS C 237 -62.244 61.270 -73.039 1.00175.13 O
ATOM 8081 CB HIS C 237 -59.647 60.354 -74.580 1.00175.02 C
ATOM 8082 CG HIS C 237 -58.217 60.324 -74.153 1.00175.85 C
ATOM 8083 ND1 HIS C 237 -57.350 59.318 -74.522 1.00175.76 N
ATOM 8084 CD2 HIS C 237 -57.506 61.165 -73.366 1.00175.46 C
ATOM 8085 CE1 HIS C 237 -56.162 59.549 -73.993 1.00175.21 C
ATOM 8086 NE2 HIS C 237 -56.231 60.663 -73.287 1.00175.04 N
ATOM 8087 N ILE C 238 -62.830 59.668 -74.502 1.00174.35 N
ATOM 8088 CA ILE C 238 -64.213 60.105 -74.574 1.00174.16 C
ATOM 8089 C ILE C 238 -64.883 59.864 -73.228 1.00174.47 C
ATOM 8090 O ILE C 238 -65.518 60.759 -72.672 1.00174.28 O
ATOM 8091 CB ILE C 238 -64.983 59.375 -75.678 1.00173.93 C
ATOM 8092 CG1 ILE C 238 -64.434 59.765 -77.052 1.00174.02 C
ATOM 8093 CG2 ILE C 238 -66.469 59.672 -75.576 1.00174.01 C
ATOM 8094 CD1 ILE C 238 -65.149 59.112 -78.204 1.00173.97 C
ATOM 8095 N TRP C 239 -64.726 58.648 -72.708 1.00174.79 N
ATOM 8096 CA TRP C 239 -65.275 58.287 -71.406 1.00174.87 C
ATOM 8097 C TRP C 239 -64.740 59.188 -70.297 1.00174.57 C
ATOM 8098 O TRP C 239 -65.511 59.712 -69.496 1.00174.03 O
ATOM 8099 CB TRP C 239 -64.964 56.825 -71.077 1.00174.49 C
ATOM 8100 CG TRP C 239 -66.032 55.865 -71.510 1.00174.69 C
ATOM 8101 CD1 TRP C 239 -66.036 55.100 -72.639 1.00174.30 C
ATOM 8102 CD2 TRP C 239 -67.256 55.573 -70.825 1.00174.53 C
ATOM 8103 NE1 TRP C 239 -67.183 54.348 -72.699 1.00173.83 N
ATOM 8104 CE2 TRP C 239 -67.951 54.620 -71.597 1.00173.37 C
ATOM 8105 CE3 TRP C 239 -67.834 56.025 -69.634 1.00174.68 C
ATOM 8106 CZ2 TRP C 239 -69.191 54.110 -71.218 1.00172.70 C
ATOM 8107 CZ3 TRP C 239 -69.064 55.518 -69.259 1.00174.44 C
ATOM 8108 CH2 TRP C 239 -69.729 54.571 -70.048 1.00173.71 C
ATOM 8109 N ILE C 240 -63.423 59.375 -70.267 1.00174.99 N
ATOM 8110 CA ILE C 240 -62.784 60.212 -69.254 1.00175.10 C
ATOM 8111 C ILE C 240 -63.297 61.647 -69.325 1.00175.22 C
ATOM 8112 O ILE C 240 -63.644 62.238 -68.302 1.00174.72 O
ATOM 8113 CB ILE C 240 -61.244 60.204 -69.404 1.00174.88 C
ATOM 8114 CG1 ILE C 240 -60.664 58.894 -68.867 1.00174.23 C
ATOM 8115 CG2 ILE C 240 -60.619 61.381 -68.667 1.00174.00 C
ATOM 8116 CD1 ILE C 240 -61.007 58.627 -67.418 1.00173.83 C
ATOM 8117 N GLY C 241 -63.352 62.192 -70.538 1.00175.43 N
ATOM 8118 CA GLY C 241 -63.855 63.536 -70.768 1.00174.54 C
ATOM 8119 C GLY C 241 -65.242 63.760 -70.196 1.00174.09 C
ATOM 8120 O GLY C 241 -65.481 64.745 -69.500 1.00173.77 O
ATOM 8121 N LEU C 242 -66.153 62.839 -70.489 1.00173.82 N
ATOM 8122 CA LEU C 242 -67.522 62.924 -69.996 1.00173.12 C
ATOM 8123 C LEU C 242 -67.586 62.730 -68.483 1.00173.19 C
ATOM 8124 O LEU C 242 -68.106 63.586 -67.766 1.00173.22 O
ATOM 8125 CB LEU C 242 -68.408 61.893 -70.696 1.00172.72 C
ATOM 8126 CG LEU C 242 -68.481 62.007 -72.220 1.00173.27 C
ATOM 8127 CD1 LEU C 242 -69.524 61.058 -72.782 1.00173.50 C
ATOM 8128 CD2 LEU C 242 -68.771 63.441 -72.641 1.00174.23 C
ATOM 8129 N ILE C 243 -67.068 61.599 -68.011 1.00173.42 N
ATOM 8130 CA ILE C 243 -66.989 61.299 -66.581 1.00173.73 C
ATOM 8131 C ILE C 243 -66.409 62.453 -65.754 1.00173.72 C
ATOM 8132 O ILE C 243 -66.917 62.769 -64.678 1.00173.41 O
ATOM 8133 CB ILE C 243 -66.149 60.026 -66.333 1.00173.57 C
ATOM 8134 CG1 ILE C 243 -66.887 58.794 -66.862 1.00173.27 C
ATOM 8135 CG2 ILE C 243 -65.847 59.849 -64.851 1.00173.91 C
ATOM 8136 CD1 ILE C 243 -66.089 57.513 -66.752 1.00173.17 C
ATOM 8137 N CYS C 244 -65.365 63.095 -66.274 1.00174.05 N
ATOM 8138 CA CYS C 244 -64.702 64.186 -65.559 1.00174.34 C
ATOM 8139 C CYS C 244 -65.628 65.382 -65.382 1.00173.97 C
ATOM 8140 O CYS C 244 -65.797 65.890 -64.273 1.00173.88 O
ATOM 8141 CB CYS C 244 -63.429 64.624 -66.290 1.00174.56 C
ATOM 8142 SG CYS C 244 -61.879 64.176 -65.468 1.00174.79 S
ATOM 8143 N ILE C 245 -66.228 65.826 -66.481 1.00173.76 N
ATOM 8144 CA ILE C 245 -67.168 66.937 -66.438 1.00173.80 C
ATOM 8145 C ILE C 245 -68.391 66.566 -65.605 1.00174.02 C
ATOM 8146 O ILE C 245 -68.924 67.395 -64.869 1.00174.29 O
ATOM 8147 CB ILE C 245 -67.605 67.360 -67.852 1.00174.02 C
ATOM 8148 CG1 ILE C 245 -66.377 67.657 -68.716 1.00173.58 C
ATOM 8149 CG2 ILE C 245 -68.501 68.584 -67.791 1.00174.46 C
ATOM 8150 CD1 ILE C 245 -66.702 67.989 -70.156 1.00173.51 C
ATOM 8151 N ALA C 246 -68.818 65.310 -65.713 1.00174.06 N
ATOM 8152 CA ALA C 246 -69.948 64.810 -64.937 1.00173.96 C
ATOM 8153 C ALA C 246 -69.676 64.941 -63.443 1.00173.73 C
ATOM 8154 O ALA C 246 -70.525 65.408 -62.685 1.00173.78 O
ATOM 8155 CB ALA C 246 -70.244 63.363 -65.297 1.00173.29 C
ATOM 8156 N GLY C 247 -68.483 64.531 -63.026 1.00173.45 N
ATOM 8157 CA GLY C 247 -68.072 64.688 -61.645 1.00173.30 C
ATOM 8158 C GLY C 247 -67.796 66.144 -61.329 1.00173.42 C
ATOM 8159 O GLY C 247 -67.846 66.561 -60.172 1.00173.05 O
ATOM 8160 N GLY C 248 -67.507 66.921 -62.368 1.00173.68 N
ATOM 8161 CA GLY C 248 -67.274 68.344 -62.215 1.00173.57 C
ATOM 8162 C GLY C 248 -68.546 69.057 -61.811 1.00173.55 C
ATOM 8163 O GLY C 248 -68.534 69.896 -60.912 1.00173.26 O
ATOM 8164 N ILE C 249 -69.648 68.703 -62.468 1.00174.00 N
ATOM 8165 CA ILE C 249 -70.954 69.271 -62.149 1.00174.29 C
ATOM 8166 C ILE C 249 -71.425 68.791 -60.783 1.00174.19 C
ATOM 8167 O ILE C 249 -71.966 69.569 -59.995 1.00174.20 O
ATOM 8168 CB ILE C 249 -72.017 68.905 -63.206 1.00173.46 C
ATOM 8169 CG1 ILE C 249 -71.498 69.188 -64.616 1.00172.61 C
ATOM 8170 CG2 ILE C 249 -73.296 69.691 -62.968 1.00174.11 C
ATOM 8171 CD1 ILE C 249 -71.089 70.624 -64.833 1.00172.78 C
ATOM 8172 N TRP C 250 -71.219 67.505 -60.516 1.00173.89 N
ATOM 8173 CA TRP C 250 -71.599 66.896 -59.246 1.00173.94 C
ATOM 8174 C TRP C 250 -71.022 67.662 -58.056 1.00174.14 C
ATOM 8175 O TRP C 250 -71.727 67.940 -57.091 1.00174.48 O
ATOM 8176 CB TRP C 250 -71.151 65.427 -59.211 1.00173.73 C
ATOM 8177 CG TRP C 250 -71.147 64.799 -57.841 1.00174.25 C
ATOM 8178 CD1 TRP C 250 -70.158 64.881 -56.900 1.00174.11 C
ATOM 8179 CD2 TRP C 250 -72.179 63.985 -57.266 1.00174.21 C
ATOM 8180 NE1 TRP C 250 -70.514 64.173 -55.777 1.00173.38 N
ATOM 8181 CE2 TRP C 250 -71.749 63.615 -55.975 1.00173.77 C
ATOM 8182 CE3 TRP C 250 -73.425 63.537 -57.716 1.00173.54 C
ATOM 8183 CZ2 TRP C 250 -72.519 62.819 -55.132 1.00173.35 C
ATOM 8184 CZ3 TRP C 250 -74.189 62.746 -56.877 1.00173.92 C
ATOM 8185 CH2 TRP C 250 -73.733 62.395 -55.599 1.00174.07 C
ATOM 8186 N HIS C 251 -69.743 68.013 -58.135 1.00173.97 N
ATOM 8187 CA HIS C 251 -69.072 68.686 -57.026 1.00173.76 C
ATOM 8188 C HIS C 251 -69.421 70.154 -56.888 1.00173.86 C
ATOM 8189 O HIS C 251 -69.300 70.734 -55.808 1.00173.48 O
ATOM 8190 CB HIS C 251 -67.570 68.542 -57.171 1.00173.64 C
ATOM 8191 CG HIS C 251 -67.079 67.185 -56.816 1.00173.37 C
ATOM 8192 ND1 HIS C 251 -67.360 66.591 -55.602 1.00173.26 N
ATOM 8193 CD2 HIS C 251 -66.340 66.290 -57.508 1.00173.87 C
ATOM 8194 CE1 HIS C 251 -66.810 65.396 -55.563 1.00174.02 C
ATOM 8195 NE2 HIS C 251 -66.182 65.188 -56.710 1.00174.42 N
ATOM 8196 N ILE C 252 -69.851 70.755 -57.986 1.00174.04 N
ATOM 8197 CA ILE C 252 -70.351 72.112 -57.945 1.00174.24 C
ATOM 8198 C ILE C 252 -71.611 72.135 -57.094 1.00174.44 C
ATOM 8199 O ILE C 252 -71.756 72.958 -56.191 1.00174.31 O
ATOM 8200 CB ILE C 252 -70.656 72.642 -59.352 1.00174.90 C
ATOM 8201 CG1 ILE C 252 -69.363 72.795 -60.156 1.00174.39 C
ATOM 8202 CG2 ILE C 252 -71.426 73.952 -59.281 1.00175.32 C
ATOM 8203 CD1 ILE C 252 -68.442 73.861 -59.626 1.00174.17 C
ATOM 8204 N LEU C 253 -72.506 71.192 -57.373 1.00174.51 N
ATOM 8205 CA LEU C 253 -73.829 71.179 -56.764 1.00174.71 C
ATOM 8206 C LEU C 253 -73.945 70.275 -55.538 1.00175.45 C
ATOM 8207 O LEU C 253 -75.022 69.740 -55.275 1.00176.48 O
ATOM 8208 CB LEU C 253 -74.867 70.747 -57.802 1.00173.93 C
ATOM 8209 CG LEU C 253 -74.737 71.348 -59.203 1.00173.37 C
ATOM 8210 CD1 LEU C 253 -75.637 70.611 -60.186 1.00173.20 C
ATOM 8211 CD2 LEU C 253 -75.055 72.835 -59.186 1.00173.68 C
ATOM 8212 N THR C 254 -72.862 70.095 -54.786 1.00175.11 N
ATOM 8213 CA THR C 254 -72.928 69.241 -53.598 1.00174.90 C
ATOM 8214 C THR C 254 -71.878 69.574 -52.543 1.00174.29 C
ATOM 8215 O THR C 254 -71.090 70.509 -52.689 1.00173.72 O
ATOM 8216 CB THR C 254 -72.773 67.737 -53.957 1.00174.66 C
ATOM 8217 OG1 THR C 254 -72.885 67.553 -55.373 1.00174.77 O
ATOM 8218 CG2 THR C 254 -73.841 66.898 -53.255 1.00174.38 C
ATOM 8219 N THR C 255 -71.891 68.780 -51.478 1.00174.57 N
ATOM 8220 CA THR C 255 -70.942 68.873 -50.381 1.00174.28 C
ATOM 8221 C THR C 255 -70.490 67.458 -50.034 1.00174.34 C
ATOM 8222 O THR C 255 -71.211 66.497 -50.307 1.00174.18 O
ATOM 8223 CB THR C 255 -71.572 69.555 -49.142 1.00174.75 C
ATOM 8224 OG1 THR C 255 -70.599 69.684 -48.098 1.00174.62 O
ATOM 8225 CG2 THR C 255 -72.756 68.747 -48.628 1.00175.25 C
ATOM 8226 N PRO C 256 -69.284 67.317 -49.460 1.00174.52 N
ATOM 8227 CA PRO C 256 -68.850 66.003 -48.975 1.00174.40 C
ATOM 8228 C PRO C 256 -69.865 65.374 -48.023 1.00173.94 C
ATOM 8229 O PRO C 256 -70.497 66.086 -47.243 1.00174.33 O
ATOM 8230 CB PRO C 256 -67.540 66.324 -48.257 1.00174.90 C
ATOM 8231 CG PRO C 256 -66.994 67.475 -49.038 1.00174.96 C
ATOM 8232 CD PRO C 256 -68.197 68.310 -49.382 1.00174.34 C
ATOM 8233 N PHE C 257 -70.023 64.056 -48.102 1.00173.59 N
ATOM 8234 CA PHE C 257 -71.033 63.346 -47.320 1.00174.23 C
ATOM 8235 C PHE C 257 -70.679 63.287 -45.836 1.00174.77 C
ATOM 8236 O PHE C 257 -70.084 64.212 -45.288 1.00175.05 O
ATOM 8237 CB PHE C 257 -71.226 61.923 -47.859 1.00174.60 C
ATOM 8238 CG PHE C 257 -72.078 61.845 -49.100 1.00175.17 C
ATOM 8239 CD1 PHE C 257 -71.870 62.710 -50.163 1.00175.14 C
ATOM 8240 CD2 PHE C 257 -73.088 60.901 -49.200 1.00175.27 C
ATOM 8241 CE1 PHE C 257 -72.654 62.636 -51.302 1.00175.11 C
ATOM 8242 CE2 PHE C 257 -73.875 60.822 -50.335 1.00175.52 C
ATOM 8243 CZ PHE C 257 -73.657 61.690 -51.387 1.00175.58 C
ATOM 8244 N GLY C 258 -71.049 62.188 -45.187 1.00174.91 N
ATOM 8245 CA GLY C 258 -70.763 62.011 -43.776 1.00175.31 C
ATOM 8246 C GLY C 258 -69.404 61.376 -43.569 1.00174.86 C
ATOM 8247 O GLY C 258 -68.527 61.955 -42.927 1.00174.68 O
ATOM 8248 N TRP C 259 -69.240 60.177 -44.118 1.00174.67 N
ATOM 8249 CA TRP C 259 -67.975 59.452 -44.064 1.00174.27 C
ATOM 8250 C TRP C 259 -66.836 60.270 -44.662 1.00173.88 C
ATOM 8251 O TRP C 259 -65.738 60.315 -44.108 1.00173.95 O
ATOM 8252 CB TRP C 259 -68.100 58.112 -44.792 1.00174.04 C
ATOM 8253 CG TRP C 259 -68.723 58.225 -46.150 1.00173.71 C
ATOM 8254 CD1 TRP C 259 -70.053 58.336 -46.435 1.00174.16 C
ATOM 8255 CD2 TRP C 259 -68.041 58.229 -47.409 1.00173.28 C
ATOM 8256 NE1 TRP C 259 -70.241 58.416 -47.793 1.00174.23 N
ATOM 8257 CE2 TRP C 259 -69.021 58.351 -48.414 1.00173.67 C
ATOM 8258 CE3 TRP C 259 -66.698 58.144 -47.785 1.00173.71 C
ATOM 8259 CZ2 TRP C 259 -68.701 58.390 -49.769 1.00173.90 C
ATOM 8260 CZ3 TRP C 259 -66.383 58.181 -49.130 1.00174.36 C
ATOM 8261 CH2 TRP C 259 -67.379 58.304 -50.106 1.00174.17 C
ATOM 8262 N ALA C 260 -67.108 60.906 -45.798 1.00173.45 N
ATOM 8263 CA ALA C 260 -66.134 61.755 -46.480 1.00173.85 C
ATOM 8264 C ALA C 260 -65.542 62.842 -45.578 1.00174.27 C
ATOM 8265 O ALA C 260 -64.413 63.280 -45.787 1.00174.71 O
ATOM 8266 CB ALA C 260 -66.771 62.389 -47.710 1.00173.97 C
ATOM 8267 N ARG C 261 -66.304 63.272 -44.577 1.00173.90 N
ATOM 8268 CA ARG C 261 -65.848 64.317 -43.666 1.00174.09 C
ATOM 8269 C ARG C 261 -65.150 63.743 -42.435 1.00174.09 C
ATOM 8270 O ARG C 261 -64.188 64.322 -41.929 1.00173.73 O
ATOM 8271 CB ARG C 261 -67.023 65.203 -43.239 1.00174.34 C
ATOM 8272 CG ARG C 261 -67.651 65.990 -44.386 1.00173.76 C
ATOM 8273 CD ARG C 261 -68.730 66.958 -43.911 1.00173.55 C
ATOM 8274 NE ARG C 261 -69.873 66.281 -43.303 1.00175.17 N
ATOM 8275 CZ ARG C 261 -70.045 66.123 -41.994 1.00176.09 C
ATOM 8276 NH1 ARG C 261 -69.152 66.604 -41.141 1.00176.56 N
ATOM 8277 NH2 ARG C 261 -71.118 65.491 -41.539 1.00176.19 N
ATOM 8278 N ARG C 262 -65.643 62.605 -41.957 1.00174.27 N
ATOM 8279 CA ARG C 262 -65.073 61.955 -40.781 1.00174.69 C
ATOM 8280 C ARG C 262 -63.821 61.143 -41.106 1.00174.75 C
ATOM 8281 O ARG C 262 -63.209 60.561 -40.211 1.00174.75 O
ATOM 8282 CB ARG C 262 -66.113 61.046 -40.120 1.00174.83 C
ATOM 8283 CG ARG C 262 -67.308 61.778 -39.534 1.00174.98 C
ATOM 8284 CD ARG C 262 -68.215 60.818 -38.779 1.00175.02 C
ATOM 8285 NE ARG C 262 -68.756 59.766 -39.637 1.00175.38 N
ATOM 8286 CZ ARG C 262 -69.795 59.919 -40.452 1.00175.27 C
ATOM 8287 NH1 ARG C 262 -70.422 61.085 -40.522 1.00175.21 N
ATOM 8288 NH2 ARG C 262 -70.212 58.901 -41.192 1.00174.56 N
ATOM 8289 N ALA C 263 -63.442 61.106 -42.380 1.00174.83 N
ATOM 8290 CA ALA C 263 -62.285 60.323 -42.805 1.00174.77 C
ATOM 8291 C ALA C 263 -61.082 61.203 -43.126 1.00174.70 C
ATOM 8292 O ALA C 263 -59.969 60.940 -42.670 1.00174.62 O
ATOM 8293 CB ALA C 263 -62.642 59.466 -44.012 1.00174.15 C
ATOM 8294 N PHE C 264 -61.311 62.253 -43.907 1.00174.29 N
ATOM 8295 CA PHE C 264 -60.225 63.112 -44.361 1.00174.11 C
ATOM 8296 C PHE C 264 -59.866 64.195 -43.353 1.00174.41 C
ATOM 8297 O PHE C 264 -60.578 64.418 -42.375 1.00174.44 O
ATOM 8298 CB PHE C 264 -60.586 63.768 -45.695 1.00173.48 C
ATOM 8299 CG PHE C 264 -60.694 62.803 -46.839 1.00173.97 C
ATOM 8300 CD1 PHE C 264 -59.593 62.520 -47.628 1.00174.18 C
ATOM 8301 CD2 PHE C 264 -61.895 62.183 -47.128 1.00174.20 C
ATOM 8302 CE1 PHE C 264 -59.690 61.633 -48.680 1.00173.89 C
ATOM 8303 CE2 PHE C 264 -61.997 61.298 -48.179 1.00174.00 C
ATOM 8304 CZ PHE C 264 -60.894 61.023 -48.958 1.00173.43 C
ATOM 8305 N ILE C 265 -58.746 64.862 -43.611 1.00174.92 N
ATOM 8306 CA ILE C 265 -58.342 66.036 -42.850 1.00174.87 C
ATOM 8307 C ILE C 265 -58.573 67.269 -43.715 1.00174.68 C
ATOM 8308 O ILE C 265 -58.195 67.292 -44.887 1.00174.26 O
ATOM 8309 CB ILE C 265 -56.865 65.956 -42.411 1.00174.04 C
ATOM 8310 CG1 ILE C 265 -56.694 64.908 -41.311 1.00173.69 C
ATOM 8311 CG2 ILE C 265 -56.372 67.306 -41.919 1.00173.94 C
ATOM 8312 CD1 ILE C 265 -57.514 65.187 -40.072 1.00174.43 C
ATOM 8313 N TRP C 266 -59.208 68.285 -43.144 1.00174.91 N
ATOM 8314 CA TRP C 266 -59.577 69.466 -43.911 1.00174.43 C
ATOM 8315 C TRP C 266 -58.706 70.669 -43.564 1.00174.57 C
ATOM 8316 O TRP C 266 -58.992 71.409 -42.623 1.00174.96 O
ATOM 8317 CB TRP C 266 -61.054 69.790 -43.685 1.00174.81 C
ATOM 8318 CG TRP C 266 -61.944 68.605 -43.908 1.00175.28 C
ATOM 8319 CD1 TRP C 266 -62.300 67.661 -42.988 1.00175.68 C
ATOM 8320 CD2 TRP C 266 -62.572 68.226 -45.137 1.00174.63 C
ATOM 8321 NE1 TRP C 266 -63.120 66.722 -43.568 1.00175.40 N
ATOM 8322 CE2 TRP C 266 -63.302 67.047 -44.886 1.00174.66 C
ATOM 8323 CE3 TRP C 266 -62.593 68.771 -46.423 1.00174.11 C
ATOM 8324 CZ2 TRP C 266 -64.043 66.406 -45.874 1.00173.66 C
ATOM 8325 CZ3 TRP C 266 -63.329 68.134 -47.401 1.00174.07 C
ATOM 8326 CH2 TRP C 266 -64.044 66.964 -47.122 1.00173.67 C
ATOM 8327 N SER C 267 -57.643 70.853 -44.341 1.00174.61 N
ATOM 8328 CA SER C 267 -56.718 71.966 -44.157 1.00175.02 C
ATOM 8329 C SER C 267 -55.942 72.209 -45.445 1.00174.93 C
ATOM 8330 O SER C 267 -55.921 71.355 -46.333 1.00174.49 O
ATOM 8331 CB SER C 267 -55.756 71.698 -42.995 1.00174.36 C
ATOM 8332 OG SER C 267 -55.114 70.442 -43.137 1.00174.02 O
ATOM 8333 N GLY C 268 -55.311 73.375 -45.543 1.00175.07 N
ATOM 8334 CA GLY C 268 -54.582 73.758 -46.740 1.00174.42 C
ATOM 8335 C GLY C 268 -53.463 72.798 -47.094 1.00173.87 C
ATOM 8336 O GLY C 268 -53.212 72.531 -48.269 1.00173.39 O
ATOM 8337 N GLU C 269 -52.792 72.277 -46.073 1.00173.76 N
ATOM 8338 CA GLU C 269 -51.700 71.334 -46.276 1.00173.94 C
ATOM 8339 C GLU C 269 -52.213 69.953 -46.664 1.00174.18 C
ATOM 8340 O GLU C 269 -51.690 69.325 -47.585 1.00173.96 O
ATOM 8341 CB GLU C 269 -50.838 71.237 -45.018 1.00173.43 C
ATOM 8342 CG GLU C 269 -49.448 70.687 -45.277 1.00173.87 C
ATOM 8343 CD GLU C 269 -48.544 70.822 -44.077 1.00173.20 C
ATOM 8344 OE1 GLU C 269 -47.347 70.488 -44.192 1.00173.45 O
ATOM 8345 OE2 GLU C 269 -49.037 71.258 -43.017 1.00172.99 O
ATOM 8346 N ALA C 270 -53.222 69.482 -45.937 1.00174.49 N
ATOM 8347 CA ALA C 270 -53.858 68.197 -46.211 1.00174.67 C
ATOM 8348 C ALA C 270 -54.244 68.032 -47.678 1.00174.86 C
ATOM 8349 O ALA C 270 -53.970 66.998 -48.284 1.00175.58 O
ATOM 8350 CB ALA C 270 -55.083 68.026 -45.330 1.00174.68 C
ATOM 8351 N TYR C 271 -54.872 69.057 -48.246