PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2022-05-13
Number of transmembrane proteins: 7231 (alpha: 6680 , beta: 496 )
Content of 3l74
HEADER    OXIDOREDUCTASE                          28-DEC-09   3L74              
TITLE CYTOCHROME BC1 COMPLEX FROM CHICKEN WITH FAMOXADONE BOUND
COMPND MOL_ID: 1;
COMPND 2 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
COMPND 3 COMPLEX CORE PROTEIN I;
COMPND 4 CHAIN: A, N;
COMPND 5 EC: 1.10.2.2;
COMPND 6 MOL_ID: 2;
COMPND 7 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
COMPND 8 COMPLEX CORE PROTEIN 2;
COMPND 9 CHAIN: B, O;
COMPND 10 EC: 1.10.2.2;
COMPND 11 MOL_ID: 3;
COMPND 12 MOLECULE: CYTOCHROME B;
COMPND 13 CHAIN: C, P;
COMPND 14 SYNONYM: UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX
COMPND 15 CYTOCHROME B SUBUNIT, CYTOCHROME B-C1 COMPLEX SUBUNIT 3,
COMPND 16 COMPLEX III SUBUNIT 3, COMPLEX III SUBUNIT III;
COMPND 17 EC: 1.10.2.2;
COMPND 18 MOL_ID: 4;
COMPND 19 MOLECULE: MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN;
COMPND 20 CHAIN: D, Q;
COMPND 21 EC: 1.10.2.2;
COMPND 22 MOL_ID: 5;
COMPND 23 MOLECULE: CYTOCHROME B-C1 COMPLEX SUBUNIT 5, RIESKE
COMPND 24 IRONSULFUR PROTEIN, MITOCHONDRIAL;
COMPND 25 CHAIN: E, R;
COMPND 26 FRAGMENT: UNP RESIDUES 77-272;
COMPND 27 SYNONYM: UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR
COMPND 28 SUBUNIT, RIESKE IRON-SULFUR PROTEIN, RISP, COMPLEX III
COMPND 29 SUBUNIT 5;
COMPND 30 EC: 1.10.2.2;
COMPND 31 MOL_ID: 6;
COMPND 32 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14
COMPND 33 KDA PROTEIN;
COMPND 34 CHAIN: F, S;
COMPND 35 EC: 1.10.2.2;
COMPND 36 MOL_ID: 7;
COMPND 37 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE
COMPND 38 UBIQUINONE-BINDING PROTEIN QP-C;
COMPND 39 CHAIN: G, T;
COMPND 40 EC: 1.10.2.2;
COMPND 41 MOL_ID: 8;
COMPND 42 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11
COMPND 43 KDA PROTEIN, COMPLEX III SUBUNIT VIII;
COMPND 44 CHAIN: H, U;
COMPND 45 EC: 1.10.2.2;
COMPND 46 MOL_ID: 9;
COMPND 47 MOLECULE: CYTOCHROME B-C1 COMPLEX SUBUNIT RIESKE,
COMPND 48 MITOCHONDRIAL;
COMPND 49 CHAIN: I, V;
COMPND 50 FRAGMENT: UNP RESIDUES 45-76;
COMPND 51 SYNONYM: UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR
COMPND 52 SUBUNIT, RIESKE IRON-SULFUR PROTEIN, RISP, COMPLEX III
COMPND 53 SUBUNIT 5;
COMPND 54 EC: 1.10.2.2;
COMPND 55 MOL_ID: 10;
COMPND 56 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE
COMPND 57 7.2 KDA PROTEIN;
COMPND 58 CHAIN: J, W;
COMPND 59 EC: 1.10.2.2
SOURCE MOL_ID: 1;
SOURCE 2 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 3 ORGANISM_COMMON: CHICKEN;
SOURCE 4 ORGANISM_TAXID: 9031;
SOURCE 5 MOL_ID: 2;
SOURCE 6 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 7 ORGANISM_COMMON: CHICKEN;
SOURCE 8 ORGANISM_TAXID: 9031;
SOURCE 9 MOL_ID: 3;
SOURCE 10 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 11 ORGANISM_COMMON: CHICKEN;
SOURCE 12 ORGANISM_TAXID: 9031;
SOURCE 13 MOL_ID: 4;
SOURCE 14 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 15 ORGANISM_COMMON: CHICKEN;
SOURCE 16 ORGANISM_TAXID: 9031;
SOURCE 17 MOL_ID: 5;
SOURCE 18 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 19 ORGANISM_COMMON: CHICKEN;
SOURCE 20 ORGANISM_TAXID: 9031;
SOURCE 21 MOL_ID: 6;
SOURCE 22 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 23 ORGANISM_COMMON: CHICKEN;
SOURCE 24 ORGANISM_TAXID: 9031;
SOURCE 25 MOL_ID: 7;
SOURCE 26 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 27 ORGANISM_COMMON: CHICKEN;
SOURCE 28 ORGANISM_TAXID: 9031;
SOURCE 29 MOL_ID: 8;
SOURCE 30 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 31 ORGANISM_COMMON: CHICKEN;
SOURCE 32 ORGANISM_TAXID: 9031;
SOURCE 33 MOL_ID: 9;
SOURCE 34 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 35 ORGANISM_COMMON: CHICKEN;
SOURCE 36 ORGANISM_TAXID: 9031;
SOURCE 37 MOL_ID: 10;
SOURCE 38 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 39 ORGANISM_COMMON: CHICKEN;
SOURCE 40 ORGANISM_TAXID: 9031
REMARK 2
REMARK 2 RESOLUTION. 2.76 ANGSTROMS.
REMARK 3
REMARK 3 REFINEMENT.
REMARK 3 PROGRAM : CNS 1.1
REMARK 3 AUTHORS : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-
REMARK 3 : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,
REMARK 3 : READ,RICE,SIMONSON,WARREN
REMARK 3
REMARK 3 REFINEMENT TARGET : ENGH & HUBER
REMARK 3
REMARK 3 DATA USED IN REFINEMENT.
REMARK 3 RESOLUTION RANGE HIGH (ANGSTROMS) : 2.76
REMARK 3 RESOLUTION RANGE LOW (ANGSTROMS) : 58.66
REMARK 3 DATA CUTOFF (SIGMA(F)) : 0.000
REMARK 3 DATA CUTOFF HIGH (ABS(F)) : 3668486.030
REMARK 3 DATA CUTOFF LOW (ABS(F)) : 0.0000
REMARK 3 COMPLETENESS (WORKING+TEST) (%) : 98.0
REMARK 3 NUMBER OF REFLECTIONS : 189275
REMARK 3
REMARK 3 FIT TO DATA USED IN REFINEMENT.
REMARK 3 CROSS-VALIDATION METHOD : THROUGHOUT
REMARK 3 FREE R VALUE TEST SET SELECTION : RANDOM
REMARK 3 R VALUE (WORKING SET) : 0.259
REMARK 3 FREE R VALUE : 0.286
REMARK 3 FREE R VALUE TEST SET SIZE (%) : 2.000
REMARK 3 FREE R VALUE TEST SET COUNT : 3693
REMARK 3 ESTIMATED ERROR OF FREE R VALUE : 0.005
REMARK 3
REMARK 3 FIT IN THE HIGHEST RESOLUTION BIN.
REMARK 3 TOTAL NUMBER OF BINS USED : 7
REMARK 3 BIN RESOLUTION RANGE HIGH (A) : 2.76
REMARK 3 BIN RESOLUTION RANGE LOW (A) : 2.91
REMARK 3 BIN COMPLETENESS (WORKING+TEST) (%) : 87.70
REMARK 3 REFLECTIONS IN BIN (WORKING SET) : 23542
REMARK 3 BIN R VALUE (WORKING SET) : 0.3710
REMARK 3 BIN FREE R VALUE : 0.3750
REMARK 3 BIN FREE R VALUE TEST SET SIZE (%) : 1.90
REMARK 3 BIN FREE R VALUE TEST SET COUNT : 451
REMARK 3 ESTIMATED ERROR OF BIN FREE R VALUE : 0.018
REMARK 3
REMARK 3 NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.
REMARK 3 PROTEIN ATOMS : 31796
REMARK 3 NUCLEIC ACID ATOMS : 0
REMARK 3 HETEROGEN ATOMS : 879
REMARK 3 SOLVENT ATOMS : 28
REMARK 3
REMARK 3 B VALUES.
REMARK 3 FROM WILSON PLOT (A**2) : 71.90
REMARK 3 MEAN B VALUE (OVERALL, A**2) : 65.70
REMARK 3 OVERALL ANISOTROPIC B VALUE.
REMARK 3 B11 (A**2) : 18.79000
REMARK 3 B22 (A**2) : -18.34000
REMARK 3 B33 (A**2) : -0.45000
REMARK 3 B12 (A**2) : 0.00000
REMARK 3 B13 (A**2) : 0.00000
REMARK 3 B23 (A**2) : 0.00000
REMARK 3
REMARK 3 ESTIMATED COORDINATE ERROR.
REMARK 3 ESD FROM LUZZATI PLOT (A) : 0.44
REMARK 3 ESD FROM SIGMAA (A) : 0.56
REMARK 3 LOW RESOLUTION CUTOFF (A) : 5.00
REMARK 3
REMARK 3 CROSS-VALIDATED ESTIMATED COORDINATE ERROR.
REMARK 3 ESD FROM C-V LUZZATI PLOT (A) : 0.49
REMARK 3 ESD FROM C-V SIGMAA (A) : 0.61
REMARK 3
REMARK 3 RMS DEVIATIONS FROM IDEAL VALUES.
REMARK 3 BOND LENGTHS (A) : 0.008
REMARK 3 BOND ANGLES (DEGREES) : 1.30
REMARK 3 DIHEDRAL ANGLES (DEGREES) : 21.20
REMARK 3 IMPROPER ANGLES (DEGREES) : 0.90
REMARK 3
REMARK 3 ISOTROPIC THERMAL MODEL : RESTRAINED
REMARK 3
REMARK 3 ISOTROPIC THERMAL FACTOR RESTRAINTS. RMS SIGMA
REMARK 3 MAIN-CHAIN BOND (A**2) : 1.230 ; 1.500
REMARK 3 MAIN-CHAIN ANGLE (A**2) : 2.120 ; 2.000
REMARK 3 SIDE-CHAIN BOND (A**2) : 1.790 ; 2.000
REMARK 3 SIDE-CHAIN ANGLE (A**2) : 2.770 ; 2.500
REMARK 3
REMARK 3 BULK SOLVENT MODELING.
REMARK 3 METHOD USED : FLAT MODEL
REMARK 3 KSOL : 0.29
REMARK 3 BSOL : 26.84
REMARK 3
REMARK 3 NCS MODEL : CONSTR
REMARK 3
REMARK 3 NCS RESTRAINTS. RMS SIGMA/WEIGHT
REMARK 3 GROUP 1 POSITIONAL (A) : NULL ; NULL
REMARK 3 GROUP 1 B-FACTOR (A**2) : NULL ; NULL
REMARK 3
REMARK 3 PARAMETER FILE 1 : PROTEIN_REP.PARAM
REMARK 3 PARAMETER FILE 2 : HETERO10.PAR
REMARK 3 PARAMETER FILE 3 : FNMFMX2-STR.PAR
REMARK 3 PARAMETER FILE 4 : WATER.PARAM
REMARK 3 PARAMETER FILE 5 : PROSTH3.PAR
REMARK 3 PARAMETER FILE 6 : NULL
REMARK 3 TOPOLOGY FILE 1 : &_1_TOPOLOGY_INFILE_1
REMARK 3 TOPOLOGY FILE 2 : &_1_TOPOLOGY_INFILE_2
REMARK 3 TOPOLOGY FILE 3 : &_1_TOPOLOGY_INFILE_3
REMARK 3 TOPOLOGY FILE 4 : &_1_TOPOLOGY_INFILE_4
REMARK 3 TOPOLOGY FILE 5 : &_1_TOPOLOGY_INFILE_5
REMARK 3 TOPOLOGY FILE 6 : NULL
REMARK 3
REMARK 3 OTHER REFINEMENT REMARKS: NULL
REMARK 4
REMARK 4 3L74 COMPLIES WITH FORMAT V. 3.20, 01-DEC-08
REMARK 100
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 21-JAN-10.
REMARK 100 THE RCSB ID CODE IS RCSB056916.
REMARK 200
REMARK 200 EXPERIMENTAL DETAILS
REMARK 200 EXPERIMENT TYPE : X-RAY DIFFRACTION
REMARK 200 DATE OF DATA COLLECTION : 28-JUL-06
REMARK 200 TEMPERATURE (KELVIN) : 100.0
REMARK 200 PH : 6.77
REMARK 200 NUMBER OF CRYSTALS USED : 1
REMARK 200
REMARK 200 SYNCHROTRON (Y/N) : Y
REMARK 200 RADIATION SOURCE : ALS
REMARK 200 BEAMLINE : 5.0.2
REMARK 200 X-RAY GENERATOR MODEL : NULL
REMARK 200 MONOCHROMATIC OR LAUE (M/L) : M
REMARK 200 WAVELENGTH OR RANGE (A) : 1.00
REMARK 200 MONOCHROMATOR : NULL
REMARK 200 OPTICS : NULL
REMARK 200
REMARK 200 DETECTOR TYPE : CCD
REMARK 200 DETECTOR MANUFACTURER : ADSC QUANTUM 315
REMARK 200 INTENSITY-INTEGRATION SOFTWARE : DENZO
REMARK 200 DATA SCALING SOFTWARE : SCALEPACK
REMARK 200
REMARK 200 NUMBER OF UNIQUE REFLECTIONS : 201091
REMARK 200 RESOLUTION RANGE HIGH (A) : 2.700
REMARK 200 RESOLUTION RANGE LOW (A) : 99.000
REMARK 200 REJECTION CRITERIA (SIGMA(I)) : -3.000
REMARK 200
REMARK 200 OVERALL.
REMARK 200 COMPLETENESS FOR RANGE (%) : 95.9
REMARK 200 DATA REDUNDANCY : 3.300
REMARK 200 R MERGE (I) : NULL
REMARK 200 R SYM (I) : 0.07800
REMARK 200 <I/SIGMA(I)> FOR THE DATA SET : 17.8000
REMARK 200
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 2.70
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE LOW (A) : 2.74
REMARK 200 COMPLETENESS FOR SHELL (%) : 66.0
REMARK 200 DATA REDUNDANCY IN SHELL : 2.80
REMARK 200 R MERGE FOR SHELL (I) : NULL
REMARK 200 R SYM FOR SHELL (I) : NULL
REMARK 200 <I/SIGMA(I)> FOR SHELL : 0.891
REMARK 200
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: RIGID BODY REFINEMENT
REMARK 200 SOFTWARE USED: CNS
REMARK 200 STARTING MODEL: PDB ENTRY 3H1H
REMARK 200
REMARK 200 REMARK: NULL
REMARK 280
REMARK 280 CRYSTAL
REMARK 280 SOLVENT CONTENT, VS (%): 69.76
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 4.07
REMARK 280
REMARK 280 CRYSTALLIZATION CONDITIONS: FINAL CONCENTRATIONS BEFORE
REMARK 280 DIFFUSION: 50 MM CACODYLATE, 9.4 MM TRISHCL, 10 MM MGCL2, 50
REMARK 280 G/L GLYCEROL, 30 G/L PEG 3350DA, 0.23 MM EDTA, 0.47 G/L
REMARK 280 UNDECYL MALTOSIDE, 31 MM OCTYL GLUCOSIDE, PH 6.77 , VAPOR
REMARK 280 DIFFUSION, SITTING DROP, TEMPERATURE 273K
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21
REMARK 290
REMARK 290 SYMOP SYMMETRY
REMARK 290 NNNMMM OPERATOR
REMARK 290 1555 X,Y,Z
REMARK 290 2555 -X+1/2,-Y,Z+1/2
REMARK 290 3555 -X,Y+1/2,-Z+1/2
REMARK 290 4555 X+1/2,-Y+1/2,-Z
REMARK 290
REMARK 290 WHERE NNN -> OPERATOR NUMBER
REMARK 290 MMM -> TRANSLATION VECTOR
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY
REMARK 290 RELATED MOLECULES.
REMARK 290 SMTRY1 1 1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 1 0.000000 1.000000 0.000000 0.00000
REMARK 290 SMTRY3 1 0.000000 0.000000 1.000000 0.00000
REMARK 290 SMTRY1 2 -1.000000 0.000000 0.000000 85.94650
REMARK 290 SMTRY2 2 0.000000 -1.000000 0.000000 0.00000
REMARK 290 SMTRY3 2 0.000000 0.000000 1.000000 120.37500
REMARK 290 SMTRY1 3 -1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 3 0.000000 1.000000 0.000000 90.84350
REMARK 290 SMTRY3 3 0.000000 0.000000 -1.000000 120.37500
REMARK 290 SMTRY1 4 1.000000 0.000000 0.000000 85.94650
REMARK 290 SMTRY2 4 0.000000 -1.000000 0.000000 90.84350
REMARK 290 SMTRY3 4 0.000000 0.000000 -1.000000 0.00000
REMARK 290
REMARK 290 REMARK: NULL
REMARK 300
REMARK 300 BIOMOLECULE: 1
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON
REMARK 300 BURIED SURFACE AREA.
REMARK 350
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS
REMARK 350 GIVEN BELOW. BOTH NON-CRYSTALLOGRAPHIC AND
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.
REMARK 350
REMARK 350 BIOMOLECULE: 1
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: EICOSAMERIC
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: EICOSAMERIC
REMARK 350 SOFTWARE USED: PISA
REMARK 350 TOTAL BURIED SURFACE AREA: 108420 ANGSTROM**2
REMARK 350 SURFACE AREA OF THE COMPLEX: 151930 ANGSTROM**2
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -694.0 KCAL/MOL
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, I, N, O, V, C, D, P,
REMARK 350 AND CHAINS: Q, U, H, T, G, F, S, E, R,
REMARK 350 AND CHAINS: W, J
REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000
REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000
REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000
REMARK 465
REMARK 465 MISSING RESIDUES
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)
REMARK 465
REMARK 465 M RES C SSSEQI
REMARK 465 ALA A 1
REMARK 465 ARG A 445
REMARK 465 PHE A 446
REMARK 465 SER B -1
REMARK 465 LEU B 0
REMARK 465 LYS B 1
REMARK 465 VAL B 2
REMARK 465 ALA B 3
REMARK 465 PRO B 4
REMARK 465 LYS B 5
REMARK 465 VAL B 6
REMARK 465 ALA B 7
REMARK 465 VAL B 8
REMARK 465 SER B 9
REMARK 465 ALA B 10
REMARK 465 ALA B 11
REMARK 465 ALA B 12
REMARK 465 GLU B 13
REMARK 465 ARG B 14
REMARK 465 VAL B 15
REMARK 465 LYS B 16
REMARK 465 LEU B 17
REMARK 465 CYS B 18
REMARK 465 ALA F 1
REMARK 465 ALA F 2
REMARK 465 ARG F 3
REMARK 465 ALA F 4
REMARK 465 THR F 5
REMARK 465 VAL F 6
REMARK 465 ALA F 7
REMARK 465 GLY F 8
REMARK 465 GLY F 9
REMARK 465 LEU H 2
REMARK 465 ARG H 3
REMARK 465 GLY H 4
REMARK 465 SER H 5
REMARK 465 GLY H 6
REMARK 465 GLU H 7
REMARK 465 GLU H 8
REMARK 465 TYR I 78
REMARK 465 ALA N 1
REMARK 465 ALA N 2
REMARK 465 ARG N 445
REMARK 465 PHE N 446
REMARK 465 SER O -1
REMARK 465 LEU O 0
REMARK 465 LYS O 1
REMARK 465 VAL O 2
REMARK 465 ALA O 3
REMARK 465 PRO O 4
REMARK 465 LYS O 5
REMARK 465 VAL O 6
REMARK 465 ALA O 7
REMARK 465 VAL O 8
REMARK 465 SER O 9
REMARK 465 ALA O 10
REMARK 465 ALA O 11
REMARK 465 ALA O 12
REMARK 465 GLU O 13
REMARK 465 ARG O 14
REMARK 465 VAL O 15
REMARK 465 LYS O 16
REMARK 465 LEU O 17
REMARK 465 MET P 1
REMARK 465 ALA S 1
REMARK 465 ALA S 2
REMARK 465 ARG S 3
REMARK 465 ALA S 4
REMARK 465 THR S 5
REMARK 465 VAL S 6
REMARK 465 ALA S 7
REMARK 465 GLY S 8
REMARK 465 GLY S 9
REMARK 465 GLY T 1
REMARK 465 ASP T 80
REMARK 465 GLN T 81
REMARK 465 LEU U 2
REMARK 465 ARG U 3
REMARK 465 GLY U 4
REMARK 465 SER U 5
REMARK 465 GLY U 6
REMARK 465 GLU U 7
REMARK 465 GLU U 8
REMARK 465 GLU U 9
REMARK 465 GLU U 10
REMARK 465 GLU U 11
REMARK 465 UNK V 26
REMARK 465 UNK V 27
REMARK 465 TYR V 78
REMARK 465 GLU W 64
REMARK 470
REMARK 470 MISSING ATOM
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS(M=MODEL NUMBER;
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 470 I=INSERTION CODE):
REMARK 470 M RES CSSEQI ATOMS
REMARK 470 ILE A 444 C O CB CG1 CG2 CD1
REMARK 470 MET C 1 CG SD CE
REMARK 470 GLU H 9 N CB CG CD OE1 OE2
REMARK 470 ARG I 47 N CB CG CD NE CZ NH1
REMARK 470 ARG I 47 NH2
REMARK 470 ARG I 61 CG CD NE CZ NH1 NH2
REMARK 470 ILE N 444 O CG1 CG2 CD1
REMARK 470 GLN R 186 N
REMARK 470 ARG V 47 N CB CG CD NE CZ NH1
REMARK 470 ARG V 47 NH2
REMARK 470 ARG V 61 CG CD NE CZ NH1 NH2
REMARK 470 GLU W 63 CA C O CB CG CD OE1
REMARK 470 GLU W 63 OE2
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT
REMARK 500
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.
REMARK 500
REMARK 500 ATM1 RES C SSEQI ATM2 RES C SSEQI DISTANCE
REMARK 500 O LEU N 19 N ASN N 21 2.19
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES
REMARK 500
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)
REMARK 500
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996
REMARK 500
REMARK 500 M RES CSSEQI ATM1 ATM2 ATM3
REMARK 500 PRO O 19 C - N - CA ANGL. DEV. = 10.8 DEGREES
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: TORSION ANGLES
REMARK 500
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)
REMARK 500
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400
REMARK 500
REMARK 500 M RES CSSEQI PSI PHI
REMARK 500 ALA A 63 -8.15 -55.14
REMARK 500 CYS A 72 -76.60 -35.29
REMARK 500 SER A 91 -154.26 -123.84
REMARK 500 ASN A 119 51.08 -118.51
REMARK 500 THR A 161 -169.18 -111.60
REMARK 500 ALA A 192 -61.21 -27.61
REMARK 500 SER A 217 -92.88 -105.94
REMARK 500 TRP A 262 -72.56 -28.42
REMARK 500 ARG A 282 11.83 -55.60
REMARK 500 LYS A 288 5.60 -66.40
REMARK 500 ASP A 370 70.01 -109.07
REMARK 500 ARG A 388 150.17 176.17
REMARK 500 TRP A 443 106.67 65.53
REMARK 500 GLU B 25 173.53 -54.97
REMARK 500 ILE B 26 78.35 -178.13
REMARK 500 THR B 27 -172.02 -64.99
REMARK 500 LYS B 28 74.97 -169.70
REMARK 500 LEU B 29 157.98 -35.90
REMARK 500 LEU B 38 117.96 -174.58
REMARK 500 PHE B 41 17.39 55.77
REMARK 500 ASP B 114 5.08 -61.69
REMARK 500 PHE B 132 52.96 34.74
REMARK 500 PHE B 152 6.07 -69.80
REMARK 500 ALA B 171 -85.74 44.99
REMARK 500 ASN B 198 -32.68 -140.14
REMARK 500 ALA B 220 -74.18 -47.29
REMARK 500 ASN B 225 -89.59 -111.66
REMARK 500 ILE B 226 95.66 5.69
REMARK 500 ARG B 227 158.01 -33.33
REMARK 500 SER B 228 -170.73 -69.06
REMARK 500 SER B 266 142.74 -172.28
REMARK 500 ALA B 281 54.47 -115.49
REMARK 500 ARG B 287 1.39 59.04
REMARK 500 THR B 292 9.67 -69.08
REMARK 500 SER B 319 -173.57 177.20
REMARK 500 GLN B 349 57.32 -97.97
REMARK 500 ALA B 386 -3.16 -57.52
REMARK 500 SER B 389 24.80 173.99
REMARK 500 PRO B 395 -6.46 -55.87
REMARK 500 LEU B 430 13.63 -69.64
REMARK 500 ILE C 20 -59.70 -134.06
REMARK 500 TYR C 76 17.43 52.49
REMARK 500 TYR C 156 -70.08 71.94
REMARK 500 SER C 247 56.10 -152.75
REMARK 500 PRO C 286 16.24 -65.00
REMARK 500 ILE C 365 -58.21 -120.61
REMARK 500 ASN C 379 41.70 74.34
REMARK 500 VAL D 36 -64.22 -122.20
REMARK 500 MET D 43 59.56 -146.66
REMARK 500 VAL D 54 -60.73 -120.82
REMARK 500
REMARK 500 THIS ENTRY HAS 172 RAMACHANDRAN OUTLIERS.
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: CHIRAL CENTERS
REMARK 500
REMARK 500 UNEXPECTED CONFIGURATION OF THE FOLLOWING CHIRAL
REMARK 500 CENTER(S) USING IMPROPER CA--C--CB--N CHIRALITY
REMARK 500 FOR AMINO ACIDS AND C1'--O4'--N1(N9)--C2' FOR
REMARK 500 NUCLEIC ACIDS OR EQUIVALENT ANGLE
REMARK 500 M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,6X,F5.1,6X,A1,10X,A1,3X,A16)
REMARK 500
REMARK 500 M RES CSSEQI IMPROPER EXPECTED FOUND DETAILS
REMARK 500 ARG O 227 23.4 L L OUTSIDE RANGE
REMARK 500
REMARK 500 REMARK: NULL
REMARK 610
REMARK 610 MISSING HETEROATOM
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 610 I=INSERTION CODE):
REMARK 610 M RES C SSEQI
REMARK 610 PEE A 2005
REMARK 610 UQ C 2002
REMARK 610 PEE C 2007
REMARK 610 PEE C 2008
REMARK 610 BOG C 3010
REMARK 610 CDL D 2003
REMARK 610 CDL G 2004
REMARK 610 PEE N 3005
REMARK 610 PEE N 3008
REMARK 610 BOG P 2010
REMARK 610 UQ P 3002
REMARK 610 PEE P 3007
REMARK 610 CDL Q 3003
REMARK 610 CDL T 3004
REMARK 620
REMARK 620 METAL COORDINATION
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM P 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS P 84 NE2
REMARK 620 2 HEM P 501 NA 89.7
REMARK 620 3 HEM P 501 NB 86.6 89.6
REMARK 620 4 HEM P 501 NC 94.1 176.1 91.2
REMARK 620 5 HEM P 501 ND 92.1 88.6 177.8 90.7
REMARK 620 6 HIS P 183 NE2 178.4 90.7 91.9 85.5 89.4
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM C 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS C 183 NE2
REMARK 620 2 HEM C 501 NA 89.5
REMARK 620 3 HEM C 501 NB 90.4 89.6
REMARK 620 4 HEM C 501 NC 85.9 174.8 93.0
REMARK 620 5 HEM C 501 ND 87.9 87.2 176.3 90.1
REMARK 620 6 HIS C 84 NE2 179.1 91.1 90.3 93.5 91.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEC Q 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS Q 41 NE2
REMARK 620 2 HEC Q 501 NA 91.1
REMARK 620 3 HEC Q 501 NB 93.1 89.6
REMARK 620 4 HEC Q 501 NC 93.5 175.1 88.6
REMARK 620 5 HEC Q 501 ND 90.2 88.7 176.2 92.9
REMARK 620 6 MET Q 160 SD 177.8 89.2 89.0 86.2 87.6
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEC D 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS D 41 NE2
REMARK 620 2 HEC D 501 NA 90.0
REMARK 620 3 HEC D 501 NB 90.4 90.9
REMARK 620 4 HEC D 501 NC 92.5 177.3 88.0
REMARK 620 5 HEC D 501 ND 89.9 90.0 179.1 91.2
REMARK 620 6 MET D 160 SD 178.2 91.6 88.6 85.9 91.1
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM C 502 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS C 197 NE2
REMARK 620 2 HEM C 502 NA 94.6
REMARK 620 3 HEM C 502 NB 94.6 91.8
REMARK 620 4 HEM C 502 NC 90.2 174.3 90.8
REMARK 620 5 HEM C 502 ND 86.0 88.9 179.0 88.4
REMARK 620 6 HIS C 98 NE2 173.3 90.2 89.8 84.7 89.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM P 502 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS P 197 NE2
REMARK 620 2 HEM P 502 NA 95.0
REMARK 620 3 HEM P 502 NB 93.1 89.8
REMARK 620 4 HEM P 502 NC 91.8 173.2 90.0
REMARK 620 5 HEM P 502 ND 87.3 89.9 179.5 90.2
REMARK 620 6 HIS P 98 NE2 174.6 88.8 90.8 84.4 88.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES E 501 FE2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS E 161 ND1
REMARK 620 2 FES E 501 S1 116.8
REMARK 620 3 FES E 501 S2 113.0 104.3
REMARK 620 4 HIS E 141 ND1 92.2 114.3 116.5
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES R 501 FE2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS R 141 ND1
REMARK 620 2 FES R 501 S1 115.6
REMARK 620 3 FES R 501 S2 116.5 104.5
REMARK 620 4 HIS R 161 ND1 89.5 116.4 114.5
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES E 501 FE1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 CYS E 139 SG
REMARK 620 2 FES E 501 S1 113.1
REMARK 620 3 FES E 501 S2 108.3 103.9
REMARK 620 4 CYS E 158 SG 110.4 109.1 112.0
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES R 501 FE1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 CYS R 158 SG
REMARK 620 2 FES R 501 S1 110.9
REMARK 620 3 FES R 501 S2 112.2 104.6
REMARK 620 4 CYS R 139 SG 109.0 110.5 109.6
REMARK 620 N 1 2 3
REMARK 800
REMARK 800 SITE
REMARK 800 SITE_IDENTIFIER: AC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM C 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM C 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEC D 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FES E 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM P 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM P 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEC Q 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FES R 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FMX C 2001
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE UQ C 2002
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL D 2003
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL G 2004
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE A 2005
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE C 2007
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE C 2008
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG D 2009
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG D 2091
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG P 2010
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE AZI C 2011
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FMX P 3001
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE UQ P 3002
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL Q 3003
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL T 3004
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE N 3005
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE P 3007
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE N 3008
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG Q 3009
REMARK 800
REMARK 800 SITE_IDENTIFIER: DC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG Q 3091
REMARK 800
REMARK 800 SITE_IDENTIFIER: DC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG C 3010
REMARK 800
REMARK 800 SITE_IDENTIFIER: DC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE AZI P 3011
REMARK 900
REMARK 900 RELATED ENTRIES
REMARK 900 RELATED ID: 3L70 RELATED DB: PDB
REMARK 900 RELATED ID: 3L71 RELATED DB: PDB
REMARK 900 RELATED ID: 3L72 RELATED DB: PDB
REMARK 900 RELATED ID: 3L73 RELATED DB: PDB
REMARK 900 RELATED ID: 3L75 RELATED DB: PDB
REMARK 900 RELATED ID: 1L0L RELATED DB: PDB
REMARK 900 BOVINE BC1 WITH FAMOXADONE BOUND
REMARK 999
REMARK 999 SEQUENCE
REMARK 999 THE COMPLETE SEQUENCE OF CHAIN I AND V IS
REMARK 999 MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALRAEKVVLDLKRPLLCRESMSGRSARRDLVAG
REMARK 999 ISLNAPASVRY, UNP residues 1-76. THE N-TERMINUS IS DISORDERED.
SITE 1 AC1 15 GLN C 45 ILE C 46 GLY C 49 LEU C 50
SITE 2 AC1 15 LEU C 52 ALA C 53 ARG C 81 HIS C 84
SITE 3 AC1 15 LEU C 124 GLY C 131 LEU C 134 PRO C 135
SITE 4 AC1 15 HIS C 183 PHE C 184 PRO C 187
SITE 1 AC2 17 TRP C 32 GLY C 35 LEU C 38 HIS C 98
SITE 2 AC2 17 ARG C 101 SER C 107 THR C 113 TRP C 114
SITE 3 AC2 17 GLY C 117 LEU C 120 HIS C 197 LEU C 198
SITE 4 AC2 17 SER C 206 ASN C 207 HOH C 381 HOH C 386
SITE 5 AC2 17 UQ C2002
SITE 1 AC3 15 VAL D 36 CYS D 37 CYS D 40 HIS D 41
SITE 2 AC3 15 ASN D 105 PRO D 110 PRO D 111 ARG D 120
SITE 3 AC3 15 TYR D 126 PHE D 153 ILE D 158 GLY D 159
SITE 4 AC3 15 MET D 160 PRO D 163 ILE D 164
SITE 1 AC4 8 CYS E 139 HIS E 141 LEU E 142 CYS E 144
SITE 2 AC4 8 CYS E 158 HIS E 161 GLY E 162 SER E 163
SITE 1 AC5 16 GLN P 45 ILE P 46 GLY P 49 LEU P 50
SITE 2 AC5 16 LEU P 52 ALA P 53 ARG P 81 HIS P 84
SITE 3 AC5 16 LEU P 124 ALA P 128 GLY P 131 LEU P 134
SITE 4 AC5 16 PRO P 135 HIS P 183 PHE P 184 PRO P 187
SITE 1 AC6 19 TRP P 32 GLY P 35 LEU P 38 HIS P 98
SITE 2 AC6 19 ILE P 99 ARG P 101 SER P 107 THR P 113
SITE 3 AC6 19 TRP P 114 GLY P 117 LEU P 120 HIS P 197
SITE 4 AC6 19 LEU P 198 LEU P 201 SER P 206 ASN P 207
SITE 5 AC6 19 HOH P 381 HOH P 388 UQ P3002
SITE 1 AC7 14 VAL Q 36 CYS Q 37 CYS Q 40 HIS Q 41
SITE 2 AC7 14 PRO Q 110 PRO Q 111 ARG Q 120 TYR Q 126
SITE 3 AC7 14 PHE Q 153 ILE Q 158 GLY Q 159 MET Q 160
SITE 4 AC7 14 PRO Q 163 ILE Q 164
SITE 1 AC8 8 CYS R 139 HIS R 141 LEU R 142 CYS R 144
SITE 2 AC8 8 CYS R 158 HIS R 161 GLY R 162 SER R 163
SITE 1 AC9 10 MET C 125 PHE C 129 TYR C 132 GLY C 143
SITE 2 AC9 10 ILE C 147 ILE C 269 PRO C 271 GLU C 272
SITE 3 AC9 10 TYR C 274 PHE C 275
SITE 1 BC1 10 LEU C 22 ILE C 28 ALA C 39 LEU C 198
SITE 2 BC1 10 HIS C 202 SER C 206 PHE C 221 ASP C 229
SITE 3 BC1 10 HOH C 387 HEM C 502
SITE 1 BC2 10 ALA C 30 GLY C 232 TYR D 220 LYS D 223
SITE 2 BC2 10 ARG D 224 HIS F 72 ARG F 73 ALA G 33
SITE 3 BC2 10 ARG G 40 CDL G2004
SITE 1 BC3 10 SER C 29 ALA C 30 TRP C 31 TYR C 105
SITE 2 BC3 10 PEE C2007 CDL D2003 HIS F 72 ARG G 40
SITE 3 BC3 10 PHE G 41 GLN G 44
SITE 1 BC4 10 TYR A 442 PHE C 227 ILE C 230 PEE C2008
SITE 2 BC4 10 MET D 222 LYS D 226 TYR E 37 THR E 40
SITE 3 BC4 10 CYS E 44 GLU J 32
SITE 1 BC5 13 TRP C 31 PHE C 96 TYR C 104 TYR C 105
SITE 2 BC5 13 PHE C 277 THR C 317 PHE C 326 TRP C 327
SITE 3 BC5 13 LEU C 334 TYR C 359 TYR F 29 VAL G 48
SITE 4 BC5 13 CDL G2004
SITE 1 BC6 6 SER A 439 TYR A 442 PEE A2005 HIS C 222
SITE 2 BC6 6 PHE C 227 ILE C 230
SITE 1 BC7 9 TYR C 76 GLN D 200 ARG D 203 MET D 204
SITE 2 BC7 9 LYS D 207 ILE D 211 BOG D2091 ASN E 53
SITE 3 BC7 9 GLN E 57
SITE 1 BC8 7 HIS D 23 TRP D 192 PRO D 196 ASP D 199
SITE 2 BC8 7 GLN D 200 ARG D 203 BOG D2009
SITE 1 BC9 5 MET P 14 ILE P 15 ASN P 17 SER P 18
SITE 2 BC9 5 THR P 199
SITE 1 CC1 2 ARG C 81 ASN C 256
SITE 1 CC2 9 MET P 125 PHE P 129 TYR P 132 GLY P 143
SITE 2 CC2 9 ILE P 269 PRO P 271 GLU P 272 TYR P 274
SITE 3 CC2 9 PHE P 275
SITE 1 CC3 10 LEU P 22 ILE P 28 ALA P 39 LEU P 198
SITE 2 CC3 10 LEU P 201 HIS P 202 SER P 206 PHE P 221
SITE 3 CC3 10 ASP P 229 HEM P 502
SITE 1 CC4 12 ALA P 30 GLY P 232 TYR Q 220 LYS Q 223
SITE 2 CC4 12 ARG Q 224 HIS S 72 ARG S 73 ILE T 26
SITE 3 CC4 12 ILE T 29 ALA T 33 ARG T 40 CDL T3004
SITE 1 CC5 9 SER P 29 ALA P 30 TRP P 31 TYR P 105
SITE 2 CC5 9 PEE P3007 CDL Q3003 ARG T 40 PHE T 41
SITE 3 CC5 9 GLN T 44
SITE 1 CC6 8 TYR N 442 PHE P 227 ILE P 230 MET Q 222
SITE 2 CC6 8 THR R 40 CYS R 44 THR R 47 GLU W 32
SITE 1 CC7 14 TRP P 31 PHE P 96 TYR P 104 TYR P 105
SITE 2 CC7 14 PHE P 277 THR P 317 PHE P 326 TRP P 327
SITE 3 CC7 14 LEU P 334 TYR P 359 TYR S 29 GLN T 44
SITE 4 CC7 14 VAL T 48 CDL T3004
SITE 1 CC8 2 TYR N 442 HIS P 222
SITE 1 CC9 9 TYR P 76 LEU P 241 GLN Q 200 ARG Q 203
SITE 2 CC9 9 MET Q 204 LYS Q 207 BOG Q3091 ASN R 53
SITE 3 CC9 9 GLN R 57
SITE 1 DC1 2 GLN Q 200 BOG Q3009
SITE 1 DC2 3 LEU C 198 THR C 199 HIS C 202
SITE 1 DC3 2 PHE P 64 ARG P 81
SEQRES 1 A 446 ALA ALA THR TYR ALA GLN THR LEU GLN ASN ILE PRO GLU
SEQRES 2 A 446 THR ASN VAL THR THR LEU ASP ASN GLY LEU ARG VAL ALA
SEQRES 3 A 446 SER GLU GLU SER SER GLN PRO THR CYS THR VAL GLY VAL
SEQRES 4 A 446 TRP ILE GLY ALA GLY SER ARG TYR GLU ASN GLU LYS ASN
SEQRES 5 A 446 ASN GLY ALA GLY TYR PHE VAL GLU HIS LEU ALA PHE LYS
SEQRES 6 A 446 GLY THR LYS LYS ARG PRO CYS ALA ALA PHE GLU LYS GLU
SEQRES 7 A 446 VAL GLU SER MET GLY ALA HIS PHE ASN GLY TYR THR SER
SEQRES 8 A 446 ARG GLU GLN THR ALA PHE TYR ILE LYS ALA LEU SER LYS
SEQRES 9 A 446 ASP MET PRO LYS VAL VAL GLU LEU LEU ALA ASP VAL VAL
SEQRES 10 A 446 GLN ASN CYS ALA LEU GLU GLU SER GLN ILE GLU LYS GLU
SEQRES 11 A 446 ARG GLY VAL ILE LEU GLN GLU LEU LYS GLU MET ASP ASN
SEQRES 12 A 446 ASP MET THR ASN VAL THR PHE ASP TYR LEU HIS ALA THR
SEQRES 13 A 446 ALA PHE GLN GLY THR ALA LEU ALA ARG THR VAL GLU GLY
SEQRES 14 A 446 THR THR GLU ASN ILE LYS HIS LEU THR ARG ALA ASP LEU
SEQRES 15 A 446 ALA SER TYR ILE ASP THR HIS PHE LYS ALA PRO ARG MET
SEQRES 16 A 446 VAL LEU ALA ALA ALA GLY GLY ILE SER HIS LYS GLU LEU
SEQRES 17 A 446 VAL ASP ALA ALA ARG GLN HIS PHE SER GLY VAL SER PHE
SEQRES 18 A 446 THR TYR LYS GLU ASP ALA VAL PRO ILE LEU PRO ARG CYS
SEQRES 19 A 446 ARG PHE THR GLY SER GLU ILE ARG ALA ARG ASP ASP ALA
SEQRES 20 A 446 LEU PRO VAL ALA HIS VAL ALA LEU ALA VAL GLU GLY PRO
SEQRES 21 A 446 GLY TRP ALA ASP PRO ASP ASN VAL VAL LEU HIS VAL ALA
SEQRES 22 A 446 ASN ALA ILE ILE GLY ARG TYR ASP ARG THR PHE GLY GLY
SEQRES 23 A 446 GLY LYS HIS LEU SER SER ARG LEU ALA ALA LEU ALA VAL
SEQRES 24 A 446 GLU HIS LYS LEU CYS HIS SER PHE GLN THR PHE ASN THR
SEQRES 25 A 446 SER TYR SER ASP THR GLY LEU PHE GLY PHE HIS PHE VAL
SEQRES 26 A 446 ALA ASP PRO LEU SER ILE ASP ASP MET MET PHE CYS ALA
SEQRES 27 A 446 GLN GLY GLU TRP MET ARG LEU CYS THR SER THR THR GLU
SEQRES 28 A 446 SER GLU VAL LYS ARG ALA LYS ASN HIS LEU ARG SER ALA
SEQRES 29 A 446 MET VAL ALA GLN LEU ASP GLY THR THR PRO VAL CYS GLU
SEQRES 30 A 446 THR ILE GLY SER HIS LEU LEU ASN TYR GLY ARG ARG ILE
SEQRES 31 A 446 SER LEU GLU GLU TRP ASP SER ARG ILE SER ALA VAL ASP
SEQRES 32 A 446 ALA ARG MET VAL ARG ASP VAL CYS SER LYS TYR ILE TYR
SEQRES 33 A 446 ASP LYS CYS PRO ALA LEU ALA ALA VAL GLY PRO ILE GLU
SEQRES 34 A 446 GLN LEU LEU ASP TYR ASN ARG ILE ARG SER GLY MET TYR
SEQRES 35 A 446 TRP ILE ARG PHE
SEQRES 1 B 441 SER LEU LYS VAL ALA PRO LYS VAL ALA VAL SER ALA ALA
SEQRES 2 B 441 ALA GLU ARG VAL LYS LEU CYS PRO GLY ALA GLU ASP LEU
SEQRES 3 B 441 GLU ILE THR LYS LEU PRO ASN GLY LEU ILE ILE ALA SER
SEQRES 4 B 441 LEU GLU ASN PHE SER PRO ALA SER ARG ILE GLY VAL PHE
SEQRES 5 B 441 ILE LYS ALA GLY SER ARG TYR GLU THR THR ALA ASN LEU
SEQRES 6 B 441 GLY THR ALA HIS LEU LEU ARG LEU ALA SER PRO LEU THR
SEQRES 7 B 441 THR LYS GLY ALA SER SER PHE ARG ILE THR ARG GLY ILE
SEQRES 8 B 441 GLU ALA VAL GLY GLY SER LEU SER VAL TYR SER THR ARG
SEQRES 9 B 441 GLU LYS MET THR TYR CYS VAL GLU CYS LEU ARG ASP HIS
SEQRES 10 B 441 VAL ASP THR VAL MET GLU TYR LEU LEU ASN VAL THR THR
SEQRES 11 B 441 ALA PRO GLU PHE ARG PRO TRP GLU VAL THR ASP LEU GLN
SEQRES 12 B 441 PRO GLN LEU LYS VAL ASP LYS ALA VAL ALA PHE GLN SER
SEQRES 13 B 441 PRO GLN VAL GLY VAL LEU GLU ASN LEU HIS ALA ALA ALA
SEQRES 14 B 441 TYR LYS THR ALA LEU ALA ASN PRO LEU TYR CYS PRO ASP
SEQRES 15 B 441 TYR ARG ILE GLY LYS ILE THR SER GLU GLN LEU HIS HIS
SEQRES 16 B 441 PHE VAL GLN ASN ASN PHE THR SER ALA ARG MET ALA LEU
SEQRES 17 B 441 VAL GLY ILE GLY VAL LYS HIS SER ASP LEU LYS GLN VAL
SEQRES 18 B 441 ALA GLU GLN PHE LEU ASN ILE ARG SER GLY ALA GLY THR
SEQRES 19 B 441 SER SER ALA LYS ALA THR TYR TRP GLY GLY GLU ILE ARG
SEQRES 20 B 441 GLU GLN ASN GLY HIS SER LEU VAL HIS ALA ALA VAL VAL
SEQRES 21 B 441 THR GLU GLY ALA ALA VAL GLY SER ALA GLU ALA ASN ALA
SEQRES 22 B 441 PHE SER VAL LEU GLN HIS VAL LEU GLY ALA GLY PRO LEU
SEQRES 23 B 441 ILE LYS ARG GLY SER SER VAL THR SER LYS LEU TYR GLN
SEQRES 24 B 441 GLY VAL ALA LYS ALA THR THR GLN PRO PHE ASP ALA SER
SEQRES 25 B 441 ALA PHE ASN VAL ASN TYR SER ASP SER GLY LEU PHE GLY
SEQRES 26 B 441 PHE TYR THR ILE SER GLN ALA ALA HIS ALA GLY GLU VAL
SEQRES 27 B 441 ILE ARG ALA ALA MET ASN GLN LEU LYS ALA ALA ALA GLN
SEQRES 28 B 441 GLY GLY VAL THR GLU GLU ASP VAL THR LYS ALA LYS ASN
SEQRES 29 B 441 GLN LEU LYS ALA THR TYR LEU MET SER VAL GLU THR ALA
SEQRES 30 B 441 GLN GLY LEU LEU ASN GLU ILE GLY SER GLU ALA LEU LEU
SEQRES 31 B 441 SER GLY THR HIS THR ALA PRO SER VAL VAL ALA GLN LYS
SEQRES 32 B 441 ILE ASP SER VAL THR SER ALA ASP VAL VAL ASN ALA ALA
SEQRES 33 B 441 LYS LYS PHE VAL SER GLY LYS LYS SER MET ALA ALA SER
SEQRES 34 B 441 GLY ASP LEU GLY SER THR PRO PHE LEU ASP GLU LEU
SEQRES 1 C 380 MET ALA PRO ASN ILE ARG LYS SER HIS PRO LEU LEU LYS
SEQRES 2 C 380 MET ILE ASN ASN SER LEU ILE ASP LEU PRO ALA PRO SER
SEQRES 3 C 380 ASN ILE SER ALA TRP TRP ASN PHE GLY SER LEU LEU ALA
SEQRES 4 C 380 VAL CYS LEU MET THR GLN ILE LEU THR GLY LEU LEU LEU
SEQRES 5 C 380 ALA MET HIS TYR THR ALA ASP THR SER LEU ALA PHE SER
SEQRES 6 C 380 SER VAL ALA HIS THR CYS ARG ASN VAL GLN TYR GLY TRP
SEQRES 7 C 380 LEU ILE ARG ASN LEU HIS ALA ASN GLY ALA SER PHE PHE
SEQRES 8 C 380 PHE ILE CYS ILE PHE LEU HIS ILE GLY ARG GLY LEU TYR
SEQRES 9 C 380 TYR GLY SER TYR LEU TYR LYS GLU THR TRP ASN THR GLY
SEQRES 10 C 380 VAL ILE LEU LEU LEU THR LEU MET ALA THR ALA PHE VAL
SEQRES 11 C 380 GLY TYR VAL LEU PRO TRP GLY GLN MET SER PHE TRP GLY
SEQRES 12 C 380 ALA THR VAL ILE THR ASN LEU PHE SER ALA ILE PRO TYR
SEQRES 13 C 380 ILE GLY HIS THR LEU VAL GLU TRP ALA TRP GLY GLY PHE
SEQRES 14 C 380 SER VAL ASP ASN PRO THR LEU THR ARG PHE PHE ALA LEU
SEQRES 15 C 380 HIS PHE LEU LEU PRO PHE ALA ILE ALA GLY ILE THR ILE
SEQRES 16 C 380 ILE HIS LEU THR PHE LEU HIS GLU SER GLY SER ASN ASN
SEQRES 17 C 380 PRO LEU GLY ILE SER SER ASP SER ASP LYS ILE PRO PHE
SEQRES 18 C 380 HIS PRO TYR TYR SER PHE LYS ASP ILE LEU GLY LEU THR
SEQRES 19 C 380 LEU MET LEU THR PRO PHE LEU THR LEU ALA LEU PHE SER
SEQRES 20 C 380 PRO ASN LEU LEU GLY ASP PRO GLU ASN PHE THR PRO ALA
SEQRES 21 C 380 ASN PRO LEU VAL THR PRO PRO HIS ILE LYS PRO GLU TRP
SEQRES 22 C 380 TYR PHE LEU PHE ALA TYR ALA ILE LEU ARG SER ILE PRO
SEQRES 23 C 380 ASN LYS LEU GLY GLY VAL LEU ALA LEU ALA ALA SER VAL
SEQRES 24 C 380 LEU ILE LEU PHE LEU ILE PRO PHE LEU HIS LYS SER LYS
SEQRES 25 C 380 GLN ARG THR MET THR PHE ARG PRO LEU SER GLN THR LEU
SEQRES 26 C 380 PHE TRP LEU LEU VAL ALA ASN LEU LEU ILE LEU THR TRP
SEQRES 27 C 380 ILE GLY SER GLN PRO VAL GLU HIS PRO PHE ILE ILE ILE
SEQRES 28 C 380 GLY GLN MET ALA SER LEU SER TYR PHE THR ILE LEU LEU
SEQRES 29 C 380 ILE LEU PHE PRO THR ILE GLY THR LEU GLU ASN LYS MET
SEQRES 30 C 380 LEU ASN TYR
SEQRES 1 D 241 GLY GLU LEU GLU LEU HIS PRO PRO ALA PHE PRO TRP SER
SEQRES 2 D 241 HIS GLY GLY PRO LEU SER ALA LEU ASP HIS SER SER VAL
SEQRES 3 D 241 ARG ARG GLY PHE GLN VAL TYR LYS GLN VAL CYS SER ALA
SEQRES 4 D 241 CYS HIS SER MET ASP TYR VAL ALA PHE ARG ASN LEU ILE
SEQRES 5 D 241 GLY VAL THR HIS THR GLU ALA GLU ALA LYS ALA LEU ALA
SEQRES 6 D 241 GLU GLU VAL GLU VAL GLN ASP GLY PRO ASP GLU ASN GLY
SEQRES 7 D 241 GLU LEU PHE MET ARG PRO GLY LYS ILE SER ASP TYR PHE
SEQRES 8 D 241 PRO LYS PRO TYR PRO ASN PRO GLU ALA ALA ARG ALA ALA
SEQRES 9 D 241 ASN ASN GLY ALA LEU PRO PRO ASP LEU SER TYR ILE VAL
SEQRES 10 D 241 ASN ALA ARG HIS GLY GLY GLU ASP TYR VAL PHE SER LEU
SEQRES 11 D 241 LEU THR GLY TYR CYS ASP PRO PRO ALA GLY VAL VAL VAL
SEQRES 12 D 241 ARG GLU GLY LEU HIS TYR ASN PRO TYR PHE PRO GLY GLN
SEQRES 13 D 241 ALA ILE GLY MET ALA PRO PRO ILE TYR ASN GLU ILE LEU
SEQRES 14 D 241 GLU TYR ASP ASP GLY THR PRO ALA THR MET SER GLN ILE
SEQRES 15 D 241 ALA LYS ASP VAL CYS THR PHE LEU ARG TRP ALA ALA GLU
SEQRES 16 D 241 PRO GLU HIS ASP GLN ARG LYS ARG MET GLY LEU LYS MET
SEQRES 17 D 241 LEU LEU ILE SER ALA LEU LEU THR SER LEU LEU TYR TYR
SEQRES 18 D 241 MET LYS ARG HIS LYS TRP SER VAL LEU LYS SER ARG LYS
SEQRES 19 D 241 MET ALA TYR ARG PRO PRO LYS
SEQRES 1 E 196 VAL HIS ASN ASP VAL THR VAL PRO ASP PHE SER ALA TYR
SEQRES 2 E 196 ARG ARG GLU ASP VAL MET ASP ALA THR THR SER SER GLN
SEQRES 3 E 196 THR SER SER GLU ASP ARG LYS GLY PHE SER TYR LEU VAL
SEQRES 4 E 196 THR ALA THR ALA CYS VAL ALA THR ALA TYR ALA ALA LYS
SEQRES 5 E 196 ASN VAL VAL THR GLN PHE ILE SER SER LEU SER ALA SER
SEQRES 6 E 196 ALA ASP VAL LEU ALA LEU SER LYS ILE GLU ILE LYS LEU
SEQRES 7 E 196 SER ASP ILE PRO GLU GLY LYS ASN VAL ALA PHE LYS TRP
SEQRES 8 E 196 ARG GLY LYS PRO LEU PHE VAL ARG HIS ARG THR GLN ALA
SEQRES 9 E 196 GLU ILE ASN GLN GLU ALA GLU VAL ASP VAL SER LYS LEU
SEQRES 10 E 196 ARG ASP PRO GLN HIS ASP LEU ASP ARG VAL LYS LYS PRO
SEQRES 11 E 196 GLU TRP VAL ILE LEU VAL GLY VAL CYS THR HIS LEU GLY
SEQRES 12 E 196 CYS VAL PRO ILE ALA ASN SER GLY ASP PHE GLY GLY TYR
SEQRES 13 E 196 TYR CYS PRO CYS HIS GLY SER HIS TYR ASP ALA SER GLY
SEQRES 14 E 196 ARG ILE ARG LYS GLY PRO ALA PRO TYR ASN LEU GLU VAL
SEQRES 15 E 196 PRO THR TYR GLN PHE VAL GLY ASP ASP LEU VAL VAL VAL
SEQRES 16 E 196 GLY
SEQRES 1 F 110 ALA ALA ARG ALA THR VAL ALA GLY GLY GLY ARG LEU MET
SEQRES 2 F 110 ASP ARG ILE ARG LYS TRP TYR TYR ASN ALA ALA GLY PHE
SEQRES 3 F 110 ASN LYS TYR GLY LEU MET ARG ASP ASP THR LEU TYR GLU
SEQRES 4 F 110 ASP ASP ASP VAL LYS GLU ALA LEU LYS ARG LEU PRO GLU
SEQRES 5 F 110 ASP LEU TYR ASN GLU ARG MET PHE ARG ILE LYS ARG ALA
SEQRES 6 F 110 LEU ASP LEU SER LEU LYS HIS ARG ILE LEU PRO LYS GLU
SEQRES 7 F 110 GLN TRP VAL LYS TYR GLU GLU ASP LYS PRO TYR LEU GLU
SEQRES 8 F 110 PRO TYR LEU LYS GLU VAL ILE ARG GLU ARG LEU GLU ARG
SEQRES 9 F 110 GLU ALA TRP ASN LYS LYS
SEQRES 1 G 81 GLY ILE HIS PHE GLY ASN LEU ALA ARG VAL ARG HIS ILE
SEQRES 2 G 81 ILE THR TYR SER LEU SER PRO PHE GLU GLN ARG ALA ILE
SEQRES 3 G 81 PRO ASN ILE PHE SER ASP ALA LEU PRO ASN VAL TRP ARG
SEQRES 4 G 81 ARG PHE SER SER GLN VAL PHE LYS VAL ALA PRO PRO PHE
SEQRES 5 G 81 LEU GLY ALA TYR LEU LEU TYR SER TRP GLY THR GLN GLU
SEQRES 6 G 81 PHE GLU ARG LEU LYS ARG LYS ASN PRO ALA ASP TYR GLU
SEQRES 7 G 81 ASN ASP GLN
SEQRES 1 H 77 LEU ARG GLY SER GLY GLU GLU GLU GLU GLU GLU LEU VAL
SEQRES 2 H 77 ASP PRO LEU THR THR ILE ARG GLU HIS CYS GLU GLN THR
SEQRES 3 H 77 GLU LYS CYS VAL LYS ALA ARG GLU ARG LEU GLU LEU CYS
SEQRES 4 H 77 ASP ALA ARG VAL SER SER ARG SER HIS THR GLU GLU GLN
SEQRES 5 H 77 CYS THR GLU GLU LEU PHE ASP PHE LEU HIS ALA ARG ASP
SEQRES 6 H 77 HIS CYS VAL ALA HIS LYS LEU PHE ASN LYS LEU LYS
SEQRES 1 I 47 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 I 47 UNK UNK ARG PRO LEU LEU CYS ARG GLU SER MET SER GLY
SEQRES 3 I 47 ARG SER ALA ARG ARG ASP LEU VAL ALA GLY ILE SER LEU
SEQRES 4 I 47 ASN ALA PRO ALA SER VAL ARG TYR
SEQRES 1 J 61 ALA LEU LEU ARG GLN ALA TYR SER ALA LEU PHE ARG ARG
SEQRES 2 J 61 THR SER THR PHE ALA LEU THR VAL VAL LEU GLY ALA VAL
SEQRES 3 J 61 LEU PHE GLU ARG ALA PHE ASP GLN GLY ALA ASP ALA ILE
SEQRES 4 J 61 PHE GLU HIS LEU ASN GLU GLY LYS LEU TRP LYS HIS ILE
SEQRES 5 J 61 LYS HIS LYS TYR GLU ALA SER GLU GLU
SEQRES 1 N 446 ALA ALA THR TYR ALA GLN THR LEU GLN ASN ILE PRO GLU
SEQRES 2 N 446 THR ASN VAL THR THR LEU ASP ASN GLY LEU ARG VAL ALA
SEQRES 3 N 446 SER GLU GLU SER SER GLN PRO THR CYS THR VAL GLY VAL
SEQRES 4 N 446 TRP ILE GLY ALA GLY SER ARG TYR GLU ASN GLU LYS ASN
SEQRES 5 N 446 ASN GLY ALA GLY TYR PHE VAL GLU HIS LEU ALA PHE LYS
SEQRES 6 N 446 GLY THR LYS LYS ARG PRO CYS ALA ALA PHE GLU LYS GLU
SEQRES 7 N 446 VAL GLU SER MET GLY ALA HIS PHE ASN GLY TYR THR SER
SEQRES 8 N 446 ARG GLU GLN THR ALA PHE TYR ILE LYS ALA LEU SER LYS
SEQRES 9 N 446 ASP MET PRO LYS VAL VAL GLU LEU LEU ALA ASP VAL VAL
SEQRES 10 N 446 GLN ASN CYS ALA LEU GLU GLU SER GLN ILE GLU LYS GLU
SEQRES 11 N 446 ARG GLY VAL ILE LEU GLN GLU LEU LYS GLU MET ASP ASN
SEQRES 12 N 446 ASP MET THR ASN VAL THR PHE ASP TYR LEU HIS ALA THR
SEQRES 13 N 446 ALA PHE GLN GLY THR ALA LEU ALA ARG THR VAL GLU GLY
SEQRES 14 N 446 THR THR GLU ASN ILE LYS HIS LEU THR ARG ALA ASP LEU
SEQRES 15 N 446 ALA SER TYR ILE ASP THR HIS PHE LYS ALA PRO ARG MET
SEQRES 16 N 446 VAL LEU ALA ALA ALA GLY GLY ILE SER HIS LYS GLU LEU
SEQRES 17 N 446 VAL ASP ALA ALA ARG GLN HIS PHE SER GLY VAL SER PHE
SEQRES 18 N 446 THR TYR LYS GLU ASP ALA VAL PRO ILE LEU PRO ARG CYS
SEQRES 19 N 446 ARG PHE THR GLY SER GLU ILE ARG ALA ARG ASP ASP ALA
SEQRES 20 N 446 LEU PRO VAL ALA HIS VAL ALA LEU ALA VAL GLU GLY PRO
SEQRES 21 N 446 GLY TRP ALA ASP PRO ASP ASN VAL VAL LEU HIS VAL ALA
SEQRES 22 N 446 ASN ALA ILE ILE GLY ARG TYR ASP ARG THR PHE GLY GLY
SEQRES 23 N 446 GLY LYS HIS LEU SER SER ARG LEU ALA ALA LEU ALA VAL
SEQRES 24 N 446 GLU HIS LYS LEU CYS HIS SER PHE GLN THR PHE ASN THR
SEQRES 25 N 446 SER TYR SER ASP THR GLY LEU PHE GLY PHE HIS PHE VAL
SEQRES 26 N 446 ALA ASP PRO LEU SER ILE ASP ASP MET MET PHE CYS ALA
SEQRES 27 N 446 GLN GLY GLU TRP MET ARG LEU CYS THR SER THR THR GLU
SEQRES 28 N 446 SER GLU VAL LYS ARG ALA LYS ASN HIS LEU ARG SER ALA
SEQRES 29 N 446 MET VAL ALA GLN LEU ASP GLY THR THR PRO VAL CYS GLU
SEQRES 30 N 446 THR ILE GLY SER HIS LEU LEU ASN TYR GLY ARG ARG ILE
SEQRES 31 N 446 SER LEU GLU GLU TRP ASP SER ARG ILE SER ALA VAL ASP
SEQRES 32 N 446 ALA ARG MET VAL ARG ASP VAL CYS SER LYS TYR ILE TYR
SEQRES 33 N 446 ASP LYS CYS PRO ALA LEU ALA ALA VAL GLY PRO ILE GLU
SEQRES 34 N 446 GLN LEU LEU ASP TYR ASN ARG ILE ARG SER GLY MET TYR
SEQRES 35 N 446 TRP ILE ARG PHE
SEQRES 1 O 441 SER LEU LYS VAL ALA PRO LYS VAL ALA VAL SER ALA ALA
SEQRES 2 O 441 ALA GLU ARG VAL LYS LEU CYS PRO GLY ALA GLU ASP LEU
SEQRES 3 O 441 GLU ILE THR LYS LEU PRO ASN GLY LEU ILE ILE ALA SER
SEQRES 4 O 441 LEU GLU ASN PHE SER PRO ALA SER ARG ILE GLY VAL PHE
SEQRES 5 O 441 ILE LYS ALA GLY SER ARG TYR GLU THR THR ALA ASN LEU
SEQRES 6 O 441 GLY THR ALA HIS LEU LEU ARG LEU ALA SER PRO LEU THR
SEQRES 7 O 441 THR LYS GLY ALA SER SER PHE ARG ILE THR ARG GLY ILE
SEQRES 8 O 441 GLU ALA VAL GLY GLY SER LEU SER VAL TYR SER THR ARG
SEQRES 9 O 441 GLU LYS MET THR TYR CYS VAL GLU CYS LEU ARG ASP HIS
SEQRES 10 O 441 VAL ASP THR VAL MET GLU TYR LEU LEU ASN VAL THR THR
SEQRES 11 O 441 ALA PRO GLU PHE ARG PRO TRP GLU VAL THR ASP LEU GLN
SEQRES 12 O 441 PRO GLN LEU LYS VAL ASP LYS ALA VAL ALA PHE GLN SER
SEQRES 13 O 441 PRO GLN VAL GLY VAL LEU GLU ASN LEU HIS ALA ALA ALA
SEQRES 14 O 441 TYR LYS THR ALA LEU ALA ASN PRO LEU TYR CYS PRO ASP
SEQRES 15 O 441 TYR ARG ILE GLY LYS ILE THR SER GLU GLN LEU HIS HIS
SEQRES 16 O 441 PHE VAL GLN ASN ASN PHE THR SER ALA ARG MET ALA LEU
SEQRES 17 O 441 VAL GLY ILE GLY VAL LYS HIS SER ASP LEU LYS GLN VAL
SEQRES 18 O 441 ALA GLU GLN PHE LEU ASN ILE ARG SER GLY ALA GLY THR
SEQRES 19 O 441 SER SER ALA LYS ALA THR TYR TRP GLY GLY GLU ILE ARG
SEQRES 20 O 441 GLU GLN ASN GLY HIS SER LEU VAL HIS ALA ALA VAL VAL
SEQRES 21 O 441 THR GLU GLY ALA ALA VAL GLY SER ALA GLU ALA ASN ALA
SEQRES 22 O 441 PHE SER VAL LEU GLN HIS VAL LEU GLY ALA GLY PRO LEU
SEQRES 23 O 441 ILE LYS ARG GLY SER SER VAL THR SER LYS LEU TYR GLN
SEQRES 24 O 441 GLY VAL ALA LYS ALA THR THR GLN PRO PHE ASP ALA SER
SEQRES 25 O 441 ALA PHE ASN VAL ASN TYR SER ASP SER GLY LEU PHE GLY
SEQRES 26 O 441 PHE TYR THR ILE SER GLN ALA ALA HIS ALA GLY GLU VAL
SEQRES 27 O 441 ILE ARG ALA ALA MET ASN GLN LEU LYS ALA ALA ALA GLN
SEQRES 28 O 441 GLY GLY VAL THR GLU GLU ASP VAL THR LYS ALA LYS ASN
SEQRES 29 O 441 GLN LEU LYS ALA THR TYR LEU MET SER VAL GLU THR ALA
SEQRES 30 O 441 GLN GLY LEU LEU ASN GLU ILE GLY SER GLU ALA LEU LEU
SEQRES 31 O 441 SER GLY THR HIS THR ALA PRO SER VAL VAL ALA GLN LYS
SEQRES 32 O 441 ILE ASP SER VAL THR SER ALA ASP VAL VAL ASN ALA ALA
SEQRES 33 O 441 LYS LYS PHE VAL SER GLY LYS LYS SER MET ALA ALA SER
SEQRES 34 O 441 GLY ASP LEU GLY SER THR PRO PHE LEU ASP GLU LEU
SEQRES 1 P 380 MET ALA PRO ASN ILE ARG LYS SER HIS PRO LEU LEU LYS
SEQRES 2 P 380 MET ILE ASN ASN SER LEU ILE ASP LEU PRO ALA PRO SER
SEQRES 3 P 380 ASN ILE SER ALA TRP TRP ASN PHE GLY SER LEU LEU ALA
SEQRES 4 P 380 VAL CYS LEU MET THR GLN ILE LEU THR GLY LEU LEU LEU
SEQRES 5 P 380 ALA MET HIS TYR THR ALA ASP THR SER LEU ALA PHE SER
SEQRES 6 P 380 SER VAL ALA HIS THR CYS ARG ASN VAL GLN TYR GLY TRP
SEQRES 7 P 380 LEU ILE ARG ASN LEU HIS ALA ASN GLY ALA SER PHE PHE
SEQRES 8 P 380 PHE ILE CYS ILE PHE LEU HIS ILE GLY ARG GLY LEU TYR
SEQRES 9 P 380 TYR GLY SER TYR LEU TYR LYS GLU THR TRP ASN THR GLY
SEQRES 10 P 380 VAL ILE LEU LEU LEU THR LEU MET ALA THR ALA PHE VAL
SEQRES 11 P 380 GLY TYR VAL LEU PRO TRP GLY GLN MET SER PHE TRP GLY
SEQRES 12 P 380 ALA THR VAL ILE THR ASN LEU PHE SER ALA ILE PRO TYR
SEQRES 13 P 380 ILE GLY HIS THR LEU VAL GLU TRP ALA TRP GLY GLY PHE
SEQRES 14 P 380 SER VAL ASP ASN PRO THR LEU THR ARG PHE PHE ALA LEU
SEQRES 15 P 380 HIS PHE LEU LEU PRO PHE ALA ILE ALA GLY ILE THR ILE
SEQRES 16 P 380 ILE HIS LEU THR PHE LEU HIS GLU SER GLY SER ASN ASN
SEQRES 17 P 380 PRO LEU GLY ILE SER SER ASP SER ASP LYS ILE PRO PHE
SEQRES 18 P 380 HIS PRO TYR TYR SER PHE LYS ASP ILE LEU GLY LEU THR
SEQRES 19 P 380 LEU MET LEU THR PRO PHE LEU THR LEU ALA LEU PHE SER
SEQRES 20 P 380 PRO ASN LEU LEU GLY ASP PRO GLU ASN PHE THR PRO ALA
SEQRES 21 P 380 ASN PRO LEU VAL THR PRO PRO HIS ILE LYS PRO GLU TRP
SEQRES 22 P 380 TYR PHE LEU PHE ALA TYR ALA ILE LEU ARG SER ILE PRO
SEQRES 23 P 380 ASN LYS LEU GLY GLY VAL LEU ALA LEU ALA ALA SER VAL
SEQRES 24 P 380 LEU ILE LEU PHE LEU ILE PRO PHE LEU HIS LYS SER LYS
SEQRES 25 P 380 GLN ARG THR MET THR PHE ARG PRO LEU SER GLN THR LEU
SEQRES 26 P 380 PHE TRP LEU LEU VAL ALA ASN LEU LEU ILE LEU THR TRP
SEQRES 27 P 380 ILE GLY SER GLN PRO VAL GLU HIS PRO PHE ILE ILE ILE
SEQRES 28 P 380 GLY GLN MET ALA SER LEU SER TYR PHE THR ILE LEU LEU
SEQRES 29 P 380 ILE LEU PHE PRO THR ILE GLY THR LEU GLU ASN LYS MET
SEQRES 30 P 380 LEU ASN TYR
SEQRES 1 Q 241 GLY GLU LEU GLU LEU HIS PRO PRO ALA PHE PRO TRP SER
SEQRES 2 Q 241 HIS GLY GLY PRO LEU SER ALA LEU ASP HIS SER SER VAL
SEQRES 3 Q 241 ARG ARG GLY PHE GLN VAL TYR LYS GLN VAL CYS SER ALA
SEQRES 4 Q 241 CYS HIS SER MET ASP TYR VAL ALA PHE ARG ASN LEU ILE
SEQRES 5 Q 241 GLY VAL THR HIS THR GLU ALA GLU ALA LYS ALA LEU ALA
SEQRES 6 Q 241 GLU GLU VAL GLU VAL GLN ASP GLY PRO ASP GLU ASN GLY
SEQRES 7 Q 241 GLU LEU PHE MET ARG PRO GLY LYS ILE SER ASP TYR PHE
SEQRES 8 Q 241 PRO LYS PRO TYR PRO ASN PRO GLU ALA ALA ARG ALA ALA
SEQRES 9 Q 241 ASN ASN GLY ALA LEU PRO PRO ASP LEU SER TYR ILE VAL
SEQRES 10 Q 241 ASN ALA ARG HIS GLY GLY GLU ASP TYR VAL PHE SER LEU
SEQRES 11 Q 241 LEU THR GLY TYR CYS ASP PRO PRO ALA GLY VAL VAL VAL
SEQRES 12 Q 241 ARG GLU GLY LEU HIS TYR ASN PRO TYR PHE PRO GLY GLN
SEQRES 13 Q 241 ALA ILE GLY MET ALA PRO PRO ILE TYR ASN GLU ILE LEU
SEQRES 14 Q 241 GLU TYR ASP ASP GLY THR PRO ALA THR MET SER GLN ILE
SEQRES 15 Q 241 ALA LYS ASP VAL CYS THR PHE LEU ARG TRP ALA ALA GLU
SEQRES 16 Q 241 PRO GLU HIS ASP GLN ARG LYS ARG MET GLY LEU LYS MET
SEQRES 17 Q 241 LEU LEU ILE SER ALA LEU LEU THR SER LEU LEU TYR TYR
SEQRES 18 Q 241 MET LYS ARG HIS LYS TRP SER VAL LEU LYS SER ARG LYS
SEQRES 19 Q 241 MET ALA TYR ARG PRO PRO LYS
SEQRES 1 R 196 VAL HIS ASN ASP VAL THR VAL PRO ASP PHE SER ALA TYR
SEQRES 2 R 196 ARG ARG GLU ASP VAL MET ASP ALA THR THR SER SER GLN
SEQRES 3 R 196 THR SER SER GLU ASP ARG LYS GLY PHE SER TYR LEU VAL
SEQRES 4 R 196 THR ALA THR ALA CYS VAL ALA THR ALA TYR ALA ALA LYS
SEQRES 5 R 196 ASN VAL VAL THR GLN PHE ILE SER SER LEU SER ALA SER
SEQRES 6 R 196 ALA ASP VAL LEU ALA LEU SER LYS ILE GLU ILE LYS LEU
SEQRES 7 R 196 SER ASP ILE PRO GLU GLY LYS ASN VAL ALA PHE LYS TRP
SEQRES 8 R 196 ARG GLY LYS PRO LEU PHE VAL ARG HIS ARG THR GLN ALA
SEQRES 9 R 196 GLU ILE ASN GLN GLU ALA GLU VAL ASP VAL SER LYS LEU
SEQRES 10 R 196 ARG ASP PRO GLN HIS ASP LEU ASP ARG VAL LYS LYS PRO
SEQRES 11 R 196 GLU TRP VAL ILE LEU VAL GLY VAL CYS THR HIS LEU GLY
SEQRES 12 R 196 CYS VAL PRO ILE ALA ASN SER GLY ASP PHE GLY GLY TYR
SEQRES 13 R 196 TYR CYS PRO CYS HIS GLY SER HIS TYR ASP ALA SER GLY
SEQRES 14 R 196 ARG ILE ARG LYS GLY PRO ALA PRO TYR ASN LEU GLU VAL
SEQRES 15 R 196 PRO THR TYR GLN PHE VAL GLY ASP ASP LEU VAL VAL VAL
SEQRES 16 R 196 GLY
SEQRES 1 S 110 ALA ALA ARG ALA THR VAL ALA GLY GLY GLY ARG LEU MET
SEQRES 2 S 110 ASP ARG ILE ARG LYS TRP TYR TYR ASN ALA ALA GLY PHE
SEQRES 3 S 110 ASN LYS TYR GLY LEU MET ARG ASP ASP THR LEU TYR GLU
SEQRES 4 S 110 ASP ASP ASP VAL LYS GLU ALA LEU LYS ARG LEU PRO GLU
SEQRES 5 S 110 ASP LEU TYR ASN GLU ARG MET PHE ARG ILE LYS ARG ALA
SEQRES 6 S 110 LEU ASP LEU SER LEU LYS HIS ARG ILE LEU PRO LYS GLU
SEQRES 7 S 110 GLN TRP VAL LYS TYR GLU GLU ASP LYS PRO TYR LEU GLU
SEQRES 8 S 110 PRO TYR LEU LYS GLU VAL ILE ARG GLU ARG LEU GLU ARG
SEQRES 9 S 110 GLU ALA TRP ASN LYS LYS
SEQRES 1 T 81 GLY ILE HIS PHE GLY ASN LEU ALA ARG VAL ARG HIS ILE
SEQRES 2 T 81 ILE THR TYR SER LEU SER PRO PHE GLU GLN ARG ALA ILE
SEQRES 3 T 81 PRO ASN ILE PHE SER ASP ALA LEU PRO ASN VAL TRP ARG
SEQRES 4 T 81 ARG PHE SER SER GLN VAL PHE LYS VAL ALA PRO PRO PHE
SEQRES 5 T 81 LEU GLY ALA TYR LEU LEU TYR SER TRP GLY THR GLN GLU
SEQRES 6 T 81 PHE GLU ARG LEU LYS ARG LYS ASN PRO ALA ASP TYR GLU
SEQRES 7 T 81 ASN ASP GLN
SEQRES 1 U 77 LEU ARG GLY SER GLY GLU GLU GLU GLU GLU GLU LEU VAL
SEQRES 2 U 77 ASP PRO LEU THR THR ILE ARG GLU HIS CYS GLU GLN THR
SEQRES 3 U 77 GLU LYS CYS VAL LYS ALA ARG GLU ARG LEU GLU LEU CYS
SEQRES 4 U 77 ASP ALA ARG VAL SER SER ARG SER HIS THR GLU GLU GLN
SEQRES 5 U 77 CYS THR GLU GLU LEU PHE ASP PHE LEU HIS ALA ARG ASP
SEQRES 6 U 77 HIS CYS VAL ALA HIS LYS LEU PHE ASN LYS LEU LYS
SEQRES 1 V 47 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 V 47 UNK UNK ARG PRO LEU LEU CYS ARG GLU SER MET SER GLY
SEQRES 3 V 47 ARG SER ALA ARG ARG ASP LEU VAL ALA GLY ILE SER LEU
SEQRES 4 V 47 ASN ALA PRO ALA SER VAL ARG TYR
SEQRES 1 W 61 ALA LEU LEU ARG GLN ALA TYR SER ALA LEU PHE ARG ARG
SEQRES 2 W 61 THR SER THR PHE ALA LEU THR VAL VAL LEU GLY ALA VAL
SEQRES 3 W 61 LEU PHE GLU ARG ALA PHE ASP GLN GLY ALA ASP ALA ILE
SEQRES 4 W 61 PHE GLU HIS LEU ASN GLU GLY LYS LEU TRP LYS HIS ILE
SEQRES 5 W 61 LYS HIS LYS TYR GLU ALA SER GLU GLU
ATOM 1 N ALA A 2 42.321 34.440 -58.970 1.00 83.86 N
ATOM 2 CA ALA A 2 41.014 35.097 -58.678 1.00 83.02 C
ATOM 3 C ALA A 2 40.380 34.491 -57.426 1.00 82.91 C
ATOM 4 O ALA A 2 39.931 33.340 -57.426 1.00 82.20 O
ATOM 5 CB ALA A 2 40.074 34.949 -59.876 1.00 82.39 C
ATOM 6 N THR A 3 40.363 35.271 -56.350 1.00 83.08 N
ATOM 7 CA THR A 3 39.784 34.818 -55.096 1.00 82.50 C
ATOM 8 C THR A 3 38.371 35.350 -54.957 1.00 82.68 C
ATOM 9 O THR A 3 38.006 36.350 -55.585 1.00 81.57 O
ATOM 10 CB THR A 3 40.605 35.292 -53.872 1.00 81.86 C
ATOM 11 OG1 THR A 3 40.667 36.727 -53.848 1.00 80.68 O
ATOM 12 CG2 THR A 3 42.001 34.700 -53.914 1.00 80.17 C
ATOM 13 N TYR A 4 37.582 34.667 -54.135 1.00 83.10 N
ATOM 14 CA TYR A 4 36.205 35.056 -53.894 1.00 83.74 C
ATOM 15 C TYR A 4 36.134 36.567 -53.654 1.00 83.85 C
ATOM 16 O TYR A 4 35.297 37.264 -54.241 1.00 83.18 O
ATOM 17 CB TYR A 4 35.657 34.276 -52.688 1.00 84.54 C
ATOM 18 CG TYR A 4 34.272 34.696 -52.229 1.00 84.98 C
ATOM 19 CD1 TYR A 4 33.177 34.653 -53.091 1.00 85.12 C
ATOM 20 CD2 TYR A 4 34.069 35.165 -50.934 1.00 84.59 C
ATOM 21 CE1 TYR A 4 31.918 35.073 -52.667 1.00 84.99 C
ATOM 22 CE2 TYR A 4 32.822 35.581 -50.506 1.00 84.20 C
ATOM 23 CZ TYR A 4 31.751 35.538 -51.370 1.00 84.61 C
ATOM 24 OH TYR A 4 30.518 35.967 -50.929 1.00 85.09 O
ATOM 25 N ALA A 5 37.027 37.076 -52.810 1.00 83.52 N
ATOM 26 CA ALA A 5 37.040 38.503 -52.520 1.00 83.35 C
ATOM 27 C ALA A 5 37.190 39.315 -53.806 1.00 83.43 C
ATOM 28 O ALA A 5 36.311 40.098 -54.175 1.00 82.38 O
ATOM 29 CB ALA A 5 38.171 38.827 -51.562 1.00 83.74 C
ATOM 30 N GLN A 6 38.311 39.112 -54.489 1.00 83.65 N
ATOM 31 CA GLN A 6 38.594 39.825 -55.727 1.00 83.60 C
ATOM 32 C GLN A 6 37.419 39.804 -56.700 1.00 83.13 C
ATOM 33 O GLN A 6 37.080 40.829 -57.298 1.00 83.31 O
ATOM 34 CB GLN A 6 39.838 39.233 -56.388 1.00 83.40 C
ATOM 35 CG GLN A 6 41.070 39.331 -55.518 1.00 83.70 C
ATOM 36 CD GLN A 6 42.231 38.557 -56.080 1.00 83.87 C
ATOM 37 OE1 GLN A 6 42.120 37.363 -56.349 1.00 84.57 O
ATOM 38 NE2 GLN A 6 43.358 39.228 -56.258 1.00 84.41 N
ATOM 39 N THR A 7 36.790 38.644 -56.856 1.00 82.41 N
ATOM 40 CA THR A 7 35.656 38.530 -57.770 1.00 81.31 C
ATOM 41 C THR A 7 34.486 39.392 -57.312 1.00 80.85 C
ATOM 42 O THR A 7 33.717 39.903 -58.125 1.00 80.42 O
ATOM 43 CB THR A 7 35.186 37.081 -57.892 1.00 80.28 C
ATOM 44 OG1 THR A 7 34.813 36.597 -56.599 1.00 80.15 O
ATOM 45 CG2 THR A 7 36.292 36.214 -58.454 1.00 79.41 C
ATOM 46 N LEU A 8 34.357 39.558 -56.004 1.00 80.72 N
ATOM 47 CA LEU A 8 33.283 40.372 -55.469 1.00 81.23 C
ATOM 48 C LEU A 8 33.530 41.850 -55.719 1.00 81.57 C
ATOM 49 O LEU A 8 32.596 42.599 -55.983 1.00 81.49 O
ATOM 50 CB LEU A 8 33.123 40.136 -53.967 1.00 81.64 C
ATOM 51 CG LEU A 8 32.550 38.790 -53.521 1.00 81.34 C
ATOM 52 CD1 LEU A 8 32.375 38.804 -52.009 1.00 80.15 C
ATOM 53 CD2 LEU A 8 31.214 38.535 -54.212 1.00 80.70 C
ATOM 54 N GLN A 9 34.789 42.265 -55.629 1.00 82.32 N
ATOM 55 CA GLN A 9 35.151 43.662 -55.843 1.00 82.89 C
ATOM 56 C GLN A 9 35.124 44.045 -57.320 1.00 83.19 C
ATOM 57 O GLN A 9 34.759 45.171 -57.671 1.00 81.91 O
ATOM 58 CB GLN A 9 36.535 43.919 -55.262 1.00 83.86 C
ATOM 59 CG GLN A 9 36.624 43.538 -53.800 1.00 86.28 C
ATOM 60 CD GLN A 9 38.034 43.596 -53.253 1.00 87.90 C
ATOM 61 OE1 GLN A 9 38.927 42.885 -53.726 1.00 89.10 O
ATOM 62 NE2 GLN A 9 38.244 44.440 -52.246 1.00 87.80 N
ATOM 63 N ASN A 10 35.495 43.103 -58.187 1.00 84.02 N
ATOM 64 CA ASN A 10 35.520 43.361 -59.629 1.00 84.62 C
ATOM 65 C ASN A 10 34.167 43.323 -60.330 1.00 83.02 C
ATOM 66 O ASN A 10 34.092 43.437 -61.555 1.00 82.56 O
ATOM 67 CB ASN A 10 36.486 42.398 -60.332 1.00 86.18 C
ATOM 68 CG ASN A 10 37.869 43.007 -60.529 1.00 88.42 C
ATOM 69 OD1 ASN A 10 38.503 43.459 -59.566 1.00 88.96 O
ATOM 70 ND2 ASN A 10 38.343 43.028 -61.780 1.00 89.31 N
ATOM 71 N ILE A 11 33.097 43.164 -59.565 1.00 81.33 N
ATOM 72 CA ILE A 11 31.783 43.137 -60.176 1.00 80.09 C
ATOM 73 C ILE A 11 31.370 44.550 -60.546 1.00 79.16 C
ATOM 74 O ILE A 11 31.466 45.471 -59.737 1.00 79.57 O
ATOM 75 CB ILE A 11 30.720 42.532 -59.240 1.00 79.37 C
ATOM 76 CG1 ILE A 11 30.957 41.025 -59.096 1.00 78.57 C
ATOM 77 CG2 ILE A 11 29.324 42.821 -59.788 1.00 78.43 C
ATOM 78 CD1 ILE A 11 29.848 40.291 -58.359 1.00 77.75 C
ATOM 79 N PRO A 12 30.915 44.741 -61.785 1.00 78.00 N
ATOM 80 CA PRO A 12 30.493 46.070 -62.218 1.00 77.90 C
ATOM 81 C PRO A 12 29.524 46.684 -61.231 1.00 77.83 C
ATOM 82 O PRO A 12 28.633 46.016 -60.719 1.00 78.37 O
ATOM 83 CB PRO A 12 29.856 45.809 -63.581 1.00 77.82 C
ATOM 84 CG PRO A 12 29.441 44.362 -63.502 1.00 77.99 C
ATOM 85 CD PRO A 12 30.613 43.735 -62.812 1.00 77.58 C
ATOM 86 N GLU A 13 29.712 47.966 -60.962 1.00 77.93 N
ATOM 87 CA GLU A 13 28.863 48.686 -60.029 1.00 78.15 C
ATOM 88 C GLU A 13 27.474 48.923 -60.618 1.00 76.62 C
ATOM 89 O GLU A 13 27.278 48.835 -61.831 1.00 76.08 O
ATOM 90 CB GLU A 13 29.531 50.014 -59.674 1.00 80.81 C
ATOM 91 CG GLU A 13 28.900 50.757 -58.524 1.00 83.87 C
ATOM 92 CD GLU A 13 29.852 51.765 -57.909 1.00 86.01 C
ATOM 93 OE1 GLU A 13 30.245 52.731 -58.607 1.00 86.60 O
ATOM 94 OE2 GLU A 13 30.211 51.580 -56.723 1.00 87.41 O
ATOM 95 N THR A 14 26.507 49.212 -59.752 1.00 74.85 N
ATOM 96 CA THR A 14 25.140 49.457 -60.198 1.00 73.38 C
ATOM 97 C THR A 14 24.886 50.962 -60.288 1.00 72.95 C
ATOM 98 O THR A 14 24.962 51.680 -59.290 1.00 73.16 O
ATOM 99 CB THR A 14 24.129 48.794 -59.237 1.00 72.16 C
ATOM 100 OG1 THR A 14 24.396 47.387 -59.173 1.00 71.54 O
ATOM 101 CG2 THR A 14 22.704 49.012 -59.716 1.00 70.25 C
ATOM 102 N ASN A 15 24.587 51.434 -61.494 1.00 72.31 N
ATOM 103 CA ASN A 15 24.355 52.859 -61.724 1.00 71.48 C
ATOM 104 C ASN A 15 22.920 53.268 -61.499 1.00 70.25 C
ATOM 105 O ASN A 15 21.992 52.578 -61.908 1.00 69.67 O
ATOM 106 CB ASN A 15 24.758 53.252 -63.152 1.00 72.58 C
ATOM 107 CG ASN A 15 26.157 52.811 -63.503 1.00 73.06 C
ATOM 108 OD1 ASN A 15 27.126 53.175 -62.824 1.00 72.18 O
ATOM 109 ND2 ASN A 15 26.276 52.013 -64.565 1.00 73.38 N
ATOM 110 N VAL A 16 22.755 54.419 -60.867 1.00 70.03 N
ATOM 111 CA VAL A 16 21.442 54.951 -60.572 1.00 70.40 C
ATOM 112 C VAL A 16 21.378 56.425 -60.945 1.00 71.30 C
ATOM 113 O VAL A 16 22.320 57.181 -60.716 1.00 72.33 O
ATOM 114 CB VAL A 16 21.125 54.827 -59.068 1.00 69.85 C
ATOM 115 CG1 VAL A 16 19.714 55.327 -58.790 1.00 69.47 C
ATOM 116 CG2 VAL A 16 21.307 53.387 -58.613 1.00 68.75 C
ATOM 117 N THR A 17 20.265 56.834 -61.529 1.00 71.37 N
ATOM 118 CA THR A 17 20.076 58.222 -61.900 1.00 71.88 C
ATOM 119 C THR A 17 18.577 58.499 -61.793 1.00 72.14 C
ATOM 120 O THR A 17 17.748 57.670 -62.174 1.00 72.65 O
ATOM 121 CB THR A 17 20.604 58.496 -63.338 1.00 72.03 C
ATOM 122 OG1 THR A 17 19.954 57.624 -64.267 1.00 73.16 O
ATOM 123 CG2 THR A 17 22.107 58.241 -63.416 1.00 71.75 C
ATOM 124 N THR A 18 18.223 59.654 -61.252 1.00 71.73 N
ATOM 125 CA THR A 18 16.814 59.983 -61.084 1.00 71.64 C
ATOM 126 C THR A 18 16.353 61.041 -62.083 1.00 71.68 C
ATOM 127 O THR A 18 17.079 61.987 -62.373 1.00 72.01 O
ATOM 128 CB THR A 18 16.543 60.484 -59.635 1.00 71.62 C
ATOM 129 OG1 THR A 18 17.075 59.539 -58.692 1.00 69.24 O
ATOM 130 CG2 THR A 18 15.041 60.661 -59.394 1.00 69.87 C
ATOM 131 N LEU A 19 15.149 60.871 -62.617 1.00 71.50 N
ATOM 132 CA LEU A 19 14.606 61.829 -63.568 1.00 71.97 C
ATOM 133 C LEU A 19 13.900 62.929 -62.781 1.00 73.53 C
ATOM 134 O LEU A 19 13.772 62.834 -61.564 1.00 73.95 O
ATOM 135 CB LEU A 19 13.623 61.138 -64.516 1.00 69.32 C
ATOM 136 CG LEU A 19 14.091 59.846 -65.198 1.00 67.42 C
ATOM 137 CD1 LEU A 19 13.175 59.551 -66.388 1.00 64.74 C
ATOM 138 CD2 LEU A 19 15.546 59.972 -65.653 1.00 65.18 C
ATOM 139 N ASP A 20 13.455 63.979 -63.461 1.00 75.63 N
ATOM 140 CA ASP A 20 12.775 65.069 -62.765 1.00 77.60 C
ATOM 141 C ASP A 20 11.412 64.630 -62.239 1.00 77.99 C
ATOM 142 O ASP A 20 10.938 65.131 -61.216 1.00 78.19 O
ATOM 143 CB ASP A 20 12.571 66.281 -63.687 1.00 79.89 C
ATOM 144 CG ASP A 20 13.878 66.840 -64.238 1.00 82.19 C
ATOM 145 OD1 ASP A 20 14.877 66.944 -63.481 1.00 81.88 O
ATOM 146 OD2 ASP A 20 13.889 67.197 -65.439 1.00 83.06 O
ATOM 147 N ASN A 21 10.780 63.699 -62.948 1.00 77.75 N
ATOM 148 CA ASN A 21 9.463 63.213 -62.555 1.00 76.78 C
ATOM 149 C ASN A 21 9.532 62.354 -61.296 1.00 76.57 C
ATOM 150 O ASN A 21 8.496 61.978 -60.734 1.00 76.76 O
ATOM 151 CB ASN A 21 8.814 62.429 -63.703 1.00 75.76 C
ATOM 152 CG ASN A 21 9.661 61.263 -64.169 1.00 75.29 C
ATOM 153 OD1 ASN A 21 10.758 61.026 -63.653 1.00 74.85 O
ATOM 154 ND2 ASN A 21 9.155 60.526 -65.157 1.00 74.30 N
ATOM 155 N GLY A 22 10.751 62.051 -60.856 1.00 75.07 N
ATOM 156 CA GLY A 22 10.922 61.262 -59.651 1.00 75.11 C
ATOM 157 C GLY A 22 11.258 59.796 -59.851 1.00 75.24 C
ATOM 158 O GLY A 22 11.593 59.093 -58.886 1.00 75.61 O
ATOM 159 N LEU A 23 11.164 59.318 -61.090 1.00 74.44 N
ATOM 160 CA LEU A 23 11.472 57.921 -61.365 1.00 72.86 C
ATOM 161 C LEU A 23 12.966 57.676 -61.238 1.00 71.40 C
ATOM 162 O LEU A 23 13.770 58.571 -61.473 1.00 70.85 O
ATOM 163 CB LEU A 23 10.987 57.530 -62.757 1.00 72.60 C
ATOM 164 CG LEU A 23 11.255 56.079 -63.146 1.00 72.86 C
ATOM 165 CD1 LEU A 23 10.193 55.636 -64.127 1.00 73.26 C
ATOM 166 CD2 LEU A 23 12.656 55.933 -63.738 1.00 72.99 C
ATOM 167 N ARG A 24 13.327 56.461 -60.845 1.00 70.48 N
ATOM 168 CA ARG A 24 14.725 56.090 -60.685 1.00 69.86 C
ATOM 169 C ARG A 24 15.123 55.042 -61.703 1.00 69.54 C
ATOM 170 O ARG A 24 14.400 54.068 -61.917 1.00 70.48 O
ATOM 171 CB ARG A 24 14.969 55.547 -59.283 1.00 69.88 C
ATOM 172 CG ARG A 24 15.231 56.609 -58.248 1.00 68.88 C
ATOM 173 CD ARG A 24 15.175 55.997 -56.880 1.00 68.30 C
ATOM 174 NE ARG A 24 13.821 55.534 -56.606 1.00 68.88 N
ATOM 175 CZ ARG A 24 13.455 54.883 -55.508 1.00 67.10 C
ATOM 176 NH1 ARG A 24 14.352 54.610 -54.570 1.00 66.80 N
ATOM 177 NH2 ARG A 24 12.186 54.517 -55.351 1.00 64.48 N
ATOM 178 N VAL A 25 16.273 55.244 -62.336 1.00 68.00 N
ATOM 179 CA VAL A 25 16.746 54.307 -63.339 1.00 65.71 C
ATOM 180 C VAL A 25 18.063 53.732 -62.880 1.00 65.03 C
ATOM 181 O VAL A 25 19.022 54.464 -62.641 1.00 64.68 O
ATOM 182 CB VAL A 25 16.919 54.995 -64.719 1.00 64.42 C
ATOM 183 CG1 VAL A 25 17.387 53.979 -65.754 1.00 63.96 C
ATOM 184 CG2 VAL A 25 15.605 55.619 -65.159 1.00 62.29 C
ATOM 185 N ALA A 26 18.097 52.412 -62.738 1.00 65.61 N
ATOM 186 CA ALA A 26 19.307 51.728 -62.297 1.00 66.40 C
ATOM 187 C ALA A 26 19.559 50.518 -63.163 1.00 66.42 C
ATOM 188 O ALA A 26 18.624 49.934 -63.712 1.00 66.40 O
ATOM 189 CB ALA A 26 19.181 51.303 -60.837 1.00 66.66 C
ATOM 190 N SER A 27 20.825 50.139 -63.278 1.00 67.02 N
ATOM 191 CA SER A 27 21.186 48.995 -64.097 1.00 68.40 C
ATOM 192 C SER A 27 22.596 48.535 -63.805 1.00 68.95 C
ATOM 193 O SER A 27 23.423 49.320 -63.352 1.00 68.70 O
ATOM 194 CB SER A 27 21.076 49.371 -65.570 1.00 68.89 C
ATOM 195 OG SER A 27 21.839 50.537 -65.843 1.00 69.90 O
ATOM 196 N GLU A 28 22.856 47.254 -64.051 1.00 70.58 N
ATOM 197 CA GLU A 28 24.180 46.687 -63.849 1.00 73.28 C
ATOM 198 C GLU A 28 24.615 46.197 -65.212 1.00 75.04 C
ATOM 199 O GLU A 28 23.903 45.425 -65.856 1.00 75.14 O
ATOM 200 CB GLU A 28 24.147 45.528 -62.857 1.00 73.84 C
ATOM 201 CG GLU A 28 25.510 44.875 -62.666 1.00 77.17 C
ATOM 202 CD GLU A 28 25.568 43.910 -61.480 1.00 79.70 C
ATOM 203 OE1 GLU A 28 25.444 44.376 -60.319 1.00 79.61 O
ATOM 204 OE2 GLU A 28 25.741 42.686 -61.711 1.00 79.69 O
ATOM 205 N GLU A 29 25.788 46.651 -65.643 1.00 77.07 N
ATOM 206 CA GLU A 29 26.322 46.311 -66.956 1.00 79.12 C
ATOM 207 C GLU A 29 27.201 45.066 -67.038 1.00 79.13 C
ATOM 208 O GLU A 29 28.056 44.837 -66.189 1.00 78.99 O
ATOM 209 CB GLU A 29 27.095 47.523 -67.503 1.00 81.04 C
ATOM 210 CG GLU A 29 27.782 47.322 -68.859 1.00 81.99 C
ATOM 211 CD GLU A 29 27.193 48.197 -69.953 1.00 82.41 C
ATOM 212 OE1 GLU A 29 27.123 49.430 -69.760 1.00 81.98 O
ATOM 213 OE2 GLU A 29 26.803 47.647 -71.007 1.00 83.23 O
ATOM 214 N SER A 30 26.971 44.267 -68.074 1.00 79.42 N
ATOM 215 CA SER A 30 27.753 43.064 -68.326 1.00 80.96 C
ATOM 216 C SER A 30 28.000 43.036 -69.829 1.00 82.73 C
ATOM 217 O SER A 30 27.639 43.980 -70.544 1.00 82.89 O
ATOM 218 CB SER A 30 26.990 41.807 -67.917 1.00 80.32 C
ATOM 219 OG SER A 30 25.949 41.509 -68.836 1.00 79.34 O
ATOM 220 N SER A 31 28.606 41.957 -70.313 1.00 83.63 N
ATOM 221 CA SER A 31 28.881 41.831 -71.741 1.00 84.31 C
ATOM 222 C SER A 31 27.978 40.782 -72.391 1.00 83.61 C
ATOM 223 O SER A 31 28.414 40.021 -73.257 1.00 83.36 O
ATOM 224 CB SER A 31 30.352 41.469 -71.948 1.00 85.55 C
ATOM 225 OG SER A 31 30.720 40.371 -71.127 1.00 87.47 O
ATOM 226 N GLN A 32 26.711 40.762 -71.978 1.00 82.94 N
ATOM 227 CA GLN A 32 25.749 39.798 -72.507 1.00 81.88 C
ATOM 228 C GLN A 32 24.821 40.298 -73.602 1.00 79.39 C
ATOM 229 O GLN A 32 24.096 41.274 -73.424 1.00 78.30 O
ATOM 230 CB GLN A 32 24.904 39.230 -71.379 1.00 83.70 C
ATOM 231 CG GLN A 32 25.677 38.345 -70.446 1.00 86.28 C
ATOM 232 CD GLN A 32 24.763 37.571 -69.548 1.00 87.10 C
ATOM 233 OE1 GLN A 32 23.977 38.154 -68.802 1.00 88.34 O
ATOM 234 NE2 GLN A 32 24.847 36.247 -69.615 1.00 86.99 N
ATOM 235 N PRO A 33 24.810 39.594 -74.743 1.00 77.75 N
ATOM 236 CA PRO A 33 23.990 39.910 -75.917 1.00 77.01 C
ATOM 237 C PRO A 33 22.517 39.923 -75.569 1.00 76.86 C
ATOM 238 O PRO A 33 21.676 40.455 -76.299 1.00 76.62 O
ATOM 239 CB PRO A 33 24.328 38.779 -76.875 1.00 77.16 C
ATOM 240 CG PRO A 33 24.597 37.626 -75.941 1.00 76.14 C
ATOM 241 CD PRO A 33 25.458 38.277 -74.895 1.00 76.44 C
ATOM 242 N THR A 34 22.217 39.317 -74.433 1.00 77.18 N
ATOM 243 CA THR A 34 20.853 39.220 -73.958 1.00 76.21 C
ATOM 244 C THR A 34 20.710 40.028 -72.670 1.00 74.29 C
ATOM 245 O THR A 34 21.674 40.198 -71.927 1.00 73.82 O
ATOM 246 CB THR A 34 20.494 37.730 -73.733 1.00 76.84 C
ATOM 247 OG1 THR A 34 19.154 37.631 -73.248 1.00 78.61 O
ATOM 248 CG2 THR A 34 21.471 37.074 -72.750 1.00 75.60 C
ATOM 249 N CYS A 35 19.511 40.543 -72.418 1.00 73.33 N
ATOM 250 CA CYS A 35 19.275 41.340 -71.209 1.00 72.34 C
ATOM 251 C CYS A 35 17.834 41.267 -70.686 1.00 70.89 C
ATOM 252 O CYS A 35 16.945 40.687 -71.317 1.00 70.49 O
ATOM 253 CB CYS A 35 19.613 42.813 -71.473 1.00 72.22 C
ATOM 254 SG CYS A 35 18.305 43.724 -72.385 1.00 69.91 S
ATOM 255 N THR A 36 17.623 41.867 -69.520 1.00 68.73 N
ATOM 256 CA THR A 36 16.307 41.929 -68.912 1.00 67.40 C
ATOM 257 C THR A 36 16.131 43.345 -68.415 1.00 66.51 C
ATOM 258 O THR A 36 17.051 43.926 -67.840 1.00 65.92 O
ATOM 259 CB THR A 36 16.173 40.995 -67.682 1.00 67.75 C
ATOM 260 OG1 THR A 36 16.405 39.639 -68.069 1.00 69.42 O
ATOM 261 CG2 THR A 36 14.783 41.109 -67.079 1.00 66.11 C
ATOM 262 N VAL A 37 14.961 43.916 -68.662 1.00 66.04 N
ATOM 263 CA VAL A 37 14.675 45.254 -68.166 1.00 67.48 C
ATOM 264 C VAL A 37 13.202 45.273 -67.778 1.00 66.75 C
ATOM 265 O VAL A 37 12.374 44.609 -68.409 1.00 65.31 O
ATOM 266 CB VAL A 37 14.969 46.393 -69.223 1.00 68.45 C
ATOM 267 CG1 VAL A 37 16.306 46.160 -69.885 1.00 67.89 C
ATOM 268 CG2 VAL A 37 13.862 46.482 -70.254 1.00 69.34 C
ATOM 269 N GLY A 38 12.887 46.019 -66.725 1.00 66.55 N
ATOM 270 CA GLY A 38 11.512 46.101 -66.271 1.00 66.06 C
ATOM 271 C GLY A 38 11.329 47.185 -65.236 1.00 64.82 C
ATOM 272 O GLY A 38 12.301 47.772 -64.757 1.00 64.23 O
ATOM 273 N VAL A 39 10.078 47.460 -64.896 1.00 63.81 N
ATOM 274 CA VAL A 39 9.784 48.482 -63.911 1.00 63.55 C
ATOM 275 C VAL A 39 9.211 47.860 -62.636 1.00 62.60 C
ATOM 276 O VAL A 39 8.181 47.180 -62.663 1.00 62.33 O
ATOM 277 CB VAL A 39 8.805 49.552 -64.495 1.00 64.38 C
ATOM 278 CG1 VAL A 39 7.577 48.894 -65.058 1.00 65.37 C
ATOM 279 CG2 VAL A 39 8.409 50.550 -63.419 1.00 66.04 C
ATOM 280 N TRP A 40 9.912 48.077 -61.527 1.00 61.16 N
ATOM 281 CA TRP A 40 9.502 47.568 -60.227 1.00 60.03 C
ATOM 282 C TRP A 40 8.737 48.655 -59.481 1.00 58.64 C
ATOM 283 O TRP A 40 9.297 49.667 -59.083 1.00 57.98 O
ATOM 284 CB TRP A 40 10.729 47.119 -59.429 1.00 61.50 C
ATOM 285 CG TRP A 40 11.103 45.675 -59.677 1.00 63.30 C
ATOM 286 CD1 TRP A 40 10.815 44.610 -58.872 1.00 63.12 C
ATOM 287 CD2 TRP A 40 11.779 45.137 -60.825 1.00 63.41 C
ATOM 288 NE1 TRP A 40 11.264 43.444 -59.443 1.00 62.63 N
ATOM 289 CE2 TRP A 40 11.862 43.736 -60.642 1.00 63.74 C
ATOM 290 CE3 TRP A 40 12.320 45.697 -61.987 1.00 63.83 C
ATOM 291 CZ2 TRP A 40 12.465 42.886 -61.582 1.00 63.01 C
ATOM 292 CZ3 TRP A 40 12.921 44.849 -62.924 1.00 64.29 C
ATOM 293 CH2 TRP A 40 12.986 43.457 -62.710 1.00 63.35 C
ATOM 294 N ILE A 41 7.440 48.435 -59.313 1.00 58.25 N
ATOM 295 CA ILE A 41 6.575 49.390 -58.640 1.00 57.48 C
ATOM 296 C ILE A 41 6.373 49.044 -57.163 1.00 58.20 C
ATOM 297 O ILE A 41 6.233 47.875 -56.794 1.00 59.45 O
ATOM 298 CB ILE A 41 5.187 49.450 -59.328 1.00 55.62 C
ATOM 299 CG1 ILE A 41 5.360 49.636 -60.834 1.00 53.45 C
ATOM 300 CG2 ILE A 41 4.367 50.604 -58.759 1.00 55.28 C
ATOM 301 CD1 ILE A 41 4.063 49.733 -61.586 1.00 51.66 C
ATOM 302 N GLY A 42 6.378 50.069 -56.318 1.00 57.98 N
ATOM 303 CA GLY A 42 6.159 49.862 -54.902 1.00 56.50 C
ATOM 304 C GLY A 42 4.663 49.919 -54.690 1.00 57.50 C
ATOM 305 O GLY A 42 4.138 50.893 -54.154 1.00 56.80 O
ATOM 306 N ALA A 43 3.967 48.888 -55.164 1.00 58.74 N
ATOM 307 CA ALA A 43 2.513 48.796 -55.020 1.00 59.46 C
ATOM 308 C ALA A 43 2.141 47.337 -54.772 1.00 60.06 C
ATOM 309 O ALA A 43 2.964 46.435 -54.982 1.00 60.95 O
ATOM 310 CB ALA A 43 1.819 49.313 -56.265 1.00 59.20 C
ATOM 311 N GLY A 44 0.908 47.112 -54.322 1.00 59.34 N
ATOM 312 CA GLY A 44 0.458 45.763 -54.026 1.00 57.48 C
ATOM 313 C GLY A 44 -0.784 45.741 -53.151 1.00 55.87 C
ATOM 314 O GLY A 44 -1.332 46.790 -52.798 1.00 56.50 O
ATOM 315 N SER A 45 -1.225 44.541 -52.789 1.00 53.48 N
ATOM 316 CA SER A 45 -2.425 44.366 -51.974 1.00 49.17 C
ATOM 317 C SER A 45 -2.440 45.205 -50.694 1.00 46.29 C
ATOM 318 O SER A 45 -3.496 45.698 -50.281 1.00 43.52 O
ATOM 319 CB SER A 45 -2.586 42.893 -51.627 1.00 49.11 C
ATOM 320 OG SER A 45 -1.388 42.409 -51.046 1.00 49.21 O
ATOM 321 N ARG A 46 -1.277 45.382 -50.069 1.00 43.41 N
ATOM 322 CA ARG A 46 -1.240 46.164 -48.844 1.00 42.01 C
ATOM 323 C ARG A 46 -1.745 47.588 -49.073 1.00 44.31 C
ATOM 324 O ARG A 46 -2.281 48.204 -48.158 1.00 46.46 O
ATOM 325 CB ARG A 46 0.168 46.199 -48.248 1.00 37.85 C
ATOM 326 CG ARG A 46 0.210 46.935 -46.907 1.00 36.93 C
ATOM 327 CD ARG A 46 1.594 46.917 -46.230 1.00 36.74 C
ATOM 328 NE ARG A 46 1.588 47.754 -45.027 1.00 37.39 N
ATOM 329 CZ ARG A 46 2.598 47.862 -44.163 1.00 38.46 C
ATOM 330 NH1 ARG A 46 3.724 47.180 -44.352 1.00 36.21 N
ATOM 331 NH2 ARG A 46 2.484 48.670 -43.108 1.00 37.04 N
ATOM 332 N TYR A 47 -1.575 48.102 -50.291 1.00 44.83 N
ATOM 333 CA TYR A 47 -2.019 49.448 -50.630 1.00 44.94 C
ATOM 334 C TYR A 47 -3.518 49.485 -50.919 1.00 47.20 C
ATOM 335 O TYR A 47 -4.120 50.558 -50.959 1.00 47.04 O
ATOM 336 CB TYR A 47 -1.264 49.983 -51.864 1.00 43.37 C
ATOM 337 CG TYR A 47 0.213 50.208 -51.642 1.00 39.93 C
ATOM 338 CD1 TYR A 47 1.120 49.150 -51.704 1.00 38.54 C
ATOM 339 CD2 TYR A 47 0.696 51.473 -51.304 1.00 37.77 C
ATOM 340 CE1 TYR A 47 2.474 49.346 -51.426 1.00 37.80 C
ATOM 341 CE2 TYR A 47 2.041 51.679 -51.022 1.00 36.74 C
ATOM 342 CZ TYR A 47 2.920 50.615 -51.080 1.00 37.78 C
ATOM 343 OH TYR A 47 4.234 50.821 -50.745 1.00 40.32 O
ATOM 344 N GLU A 48 -4.121 48.319 -51.133 1.00 49.13 N
ATOM 345 CA GLU A 48 -5.541 48.270 -51.427 1.00 51.08 C
ATOM 346 C GLU A 48 -6.315 48.304 -50.121 1.00 52.19 C
ATOM 347 O GLU A 48 -5.730 48.317 -49.043 1.00 49.69 O
ATOM 348 CB GLU A 48 -5.882 46.992 -52.194 1.00 53.75 C
ATOM 349 CG GLU A 48 -4.868 46.614 -53.266 1.00 59.04 C
ATOM 350 CD GLU A 48 -5.176 45.277 -53.923 1.00 62.93 C
ATOM 351 OE1 GLU A 48 -5.574 44.335 -53.203 1.00 64.67 O
ATOM 352 OE2 GLU A 48 -5.004 45.162 -55.157 1.00 66.18 O
ATOM 353 N ASN A 49 -7.638 48.344 -50.229 1.00 54.90 N
ATOM 354 CA ASN A 49 -8.503 48.341 -49.064 1.00 56.42 C
ATOM 355 C ASN A 49 -9.649 47.365 -49.293 1.00 58.98 C
ATOM 356 O ASN A 49 -9.656 46.617 -50.275 1.00 59.49 O
ATOM 357 CB ASN A 49 -9.044 49.736 -48.797 1.00 56.29 C
ATOM 358 CG ASN A 49 -9.803 50.296 -49.965 1.00 57.48 C
ATOM 359 OD1 ASN A 49 -9.504 51.395 -50.424 1.00 59.30 O
ATOM 360 ND2 ASN A 49 -10.804 49.556 -50.450 1.00 56.13 N
ATOM 361 N GLU A 50 -10.615 47.377 -48.385 1.00 62.09 N
ATOM 362 CA GLU A 50 -11.766 46.481 -48.451 1.00 64.44 C
ATOM 363 C GLU A 50 -12.532 46.505 -49.775 1.00 63.54 C
ATOM 364 O GLU A 50 -13.024 45.471 -50.225 1.00 63.21 O
ATOM 365 CB GLU A 50 -12.725 46.805 -47.304 1.00 68.86 C
ATOM 366 CG GLU A 50 -13.916 45.873 -47.196 1.00 76.73 C
ATOM 367 CD GLU A 50 -14.906 46.313 -46.118 1.00 82.22 C
ATOM 368 OE1 GLU A 50 -14.493 46.442 -44.937 1.00 84.37 O
ATOM 369 OE2 GLU A 50 -16.097 46.529 -46.452 1.00 84.18 O
ATOM 370 N LYS A 51 -12.621 47.670 -50.406 1.00 62.57 N
ATOM 371 CA LYS A 51 -13.364 47.791 -51.660 1.00 62.38 C
ATOM 372 C LYS A 51 -12.603 47.434 -52.944 1.00 60.62 C
ATOM 373 O LYS A 51 -13.191 46.903 -53.887 1.00 59.14 O
ATOM 374 CB LYS A 51 -13.913 49.211 -51.779 1.00 65.12 C
ATOM 375 CG LYS A 51 -14.605 49.700 -50.514 1.00 68.87 C
ATOM 376 CD LYS A 51 -14.910 51.187 -50.594 1.00 71.98 C
ATOM 377 CE LYS A 51 -15.329 51.738 -49.240 1.00 73.91 C
ATOM 378 NZ LYS A 51 -15.522 53.218 -49.296 1.00 76.41 N
ATOM 379 N ASN A 52 -11.302 47.718 -52.980 1.00 59.51 N
ATOM 380 CA ASN A 52 -10.489 47.440 -54.164 1.00 57.89 C
ATOM 381 C ASN A 52 -9.436 46.353 -53.968 1.00 56.47 C
ATOM 382 O ASN A 52 -8.396 46.369 -54.617 1.00 55.49 O
ATOM 383 CB ASN A 52 -9.795 48.723 -54.629 1.00 57.41 C
ATOM 384 CG ASN A 52 -8.675 49.142 -53.704 1.00 58.11 C
ATOM 385 OD1 ASN A 52 -8.722 48.886 -52.496 1.00 59.01 O
ATOM 386 ND2 ASN A 52 -7.665 49.805 -54.258 1.00 56.86 N
ATOM 387 N ASN A 53 -9.693 45.414 -53.068 1.00 56.28 N
ATOM 388 CA ASN A 53 -8.749 44.324 -52.834 1.00 54.50 C
ATOM 389 C ASN A 53 -8.798 43.431 -54.074 1.00 52.97 C
ATOM 390 O ASN A 53 -9.871 43.020 -54.508 1.00 51.21 O
ATOM 391 CB ASN A 53 -9.161 43.524 -51.596 1.00 55.46 C
ATOM 392 CG ASN A 53 -8.124 42.483 -51.188 1.00 55.90 C
ATOM 393 OD1 ASN A 53 -8.419 41.578 -50.408 1.00 57.85 O
ATOM 394 ND2 ASN A 53 -6.906 42.614 -51.700 1.00 54.25 N
ATOM 395 N GLY A 54 -7.635 43.141 -54.645 1.00 52.27 N
ATOM 396 CA GLY A 54 -7.590 42.312 -55.832 1.00 51.53 C
ATOM 397 C GLY A 54 -7.595 43.148 -57.099 1.00 51.71 C
ATOM 398 O GLY A 54 -7.776 42.636 -58.207 1.00 50.80 O
ATOM 399 N ALA A 55 -7.423 44.452 -56.943 1.00 51.80 N
ATOM 400 CA ALA A 55 -7.380 45.323 -58.097 1.00 52.14 C
ATOM 401 C ALA A 55 -5.976 45.189 -58.724 1.00 52.07 C
ATOM 402 O ALA A 55 -5.838 44.816 -59.897 1.00 52.47 O
ATOM 403 CB ALA A 55 -7.664 46.760 -57.683 1.00 51.40 C
ATOM 404 N GLY A 56 -4.937 45.467 -57.943 1.00 49.80 N
ATOM 405 CA GLY A 56 -3.596 45.351 -58.476 1.00 49.76 C
ATOM 406 C GLY A 56 -3.378 44.043 -59.223 1.00 50.03 C
ATOM 407 O GLY A 56 -2.550 43.965 -60.140 1.00 51.07 O
ATOM 408 N TYR A 57 -4.118 43.013 -58.824 1.00 48.76 N
ATOM 409 CA TYR A 57 -4.006 41.698 -59.442 1.00 48.00 C
ATOM 410 C TYR A 57 -4.775 41.713 -60.738 1.00 48.75 C
ATOM 411 O TYR A 57 -4.319 41.197 -61.758 1.00 50.24 O
ATOM 412 CB TYR A 57 -4.602 40.623 -58.532 1.00 45.41 C
ATOM 413 CG TYR A 57 -4.320 39.211 -58.990 1.00 44.39 C
ATOM 414 CD1 TYR A 57 -3.012 38.728 -59.048 1.00 44.86 C
ATOM 415 CD2 TYR A 57 -5.355 38.346 -59.343 1.00 43.12 C
ATOM 416 CE1 TYR A 57 -2.735 37.419 -59.442 1.00 42.24 C
ATOM 417 CE2 TYR A 57 -5.089 37.029 -59.737 1.00 41.05 C
ATOM 418 CZ TYR A 57 -3.772 36.580 -59.784 1.00 41.67 C
ATOM 419 OH TYR A 57 -3.470 35.303 -60.194 1.00 41.96 O
ATOM 420 N PHE A 58 -5.961 42.303 -60.680 1.00 49.32 N
ATOM 421 CA PHE A 58 -6.827 42.396 -61.838 1.00 49.09 C
ATOM 422 C PHE A 58 -6.057 43.159 -62.905 1.00 50.85 C
ATOM 423 O PHE A 58 -6.084 42.806 -64.082 1.00 50.52 O
ATOM 424 CB PHE A 58 -8.114 43.126 -61.458 1.00 46.05 C
ATOM 425 CG PHE A 58 -9.306 42.686 -62.244 1.00 45.49 C
ATOM 426 CD1 PHE A 58 -10.509 42.410 -61.606 1.00 45.97 C
ATOM 427 CD2 PHE A 58 -9.234 42.557 -63.621 1.00 45.41 C
ATOM 428 CE1 PHE A 58 -11.625 42.014 -62.326 1.00 46.71 C
ATOM 429 CE2 PHE A 58 -10.347 42.161 -64.355 1.00 46.94 C
ATOM 430 CZ PHE A 58 -11.545 41.889 -63.707 1.00 47.24 C
ATOM 431 N VAL A 59 -5.358 44.202 -62.471 1.00 52.52 N
ATOM 432 CA VAL A 59 -4.548 45.013 -63.365 1.00 54.02 C
ATOM 433 C VAL A 59 -3.442 44.155 -63.965 1.00 55.12 C
ATOM 434 O VAL A 59 -3.260 44.162 -65.179 1.00 56.51 O
ATOM 435 CB VAL A 59 -3.920 46.210 -62.615 1.00 53.91 C
ATOM 436 CG1 VAL A 59 -2.758 46.772 -63.405 1.00 52.92 C
ATOM 437 CG2 VAL A 59 -4.979 47.282 -62.378 1.00 54.26 C
ATOM 438 N GLU A 60 -2.717 43.420 -63.120 1.00 55.59 N
ATOM 439 CA GLU A 60 -1.637 42.551 -63.584 1.00 57.34 C
ATOM 440 C GLU A 60 -2.087 41.667 -64.743 1.00 57.42 C
ATOM 441 O GLU A 60 -1.264 41.211 -65.538 1.00 56.86 O
ATOM 442 CB GLU A 60 -1.142 41.640 -62.462 1.00 60.41 C
ATOM 443 CG GLU A 60 0.116 40.859 -62.841 1.00 64.88 C
ATOM 444 CD GLU A 60 0.162 39.456 -62.253 1.00 67.07 C
ATOM 445 OE1 GLU A 60 -0.655 38.613 -62.672 1.00 68.60 O
ATOM 446 OE2 GLU A 60 1.017 39.192 -61.378 1.00 69.65 O
ATOM 447 N HIS A 61 -3.391 41.414 -64.822 1.00 56.80 N
ATOM 448 CA HIS A 61 -3.948 40.602 -65.895 1.00 58.14 C
ATOM 449 C HIS A 61 -4.154 41.379 -67.194 1.00 58.83 C
ATOM 450 O HIS A 61 -4.105 40.805 -68.280 1.00 59.60 O
ATOM 451 CB HIS A 61 -5.289 39.998 -65.471 1.00 58.16 C
ATOM 452 CG HIS A 61 -5.161 38.719 -64.704 1.00 57.72 C
ATOM 453 ND1 HIS A 61 -5.812 37.565 -65.080 1.00 57.46 N
ATOM 454 CD2 HIS A 61 -4.462 38.412 -63.586 1.00 56.57 C
ATOM 455 CE1 HIS A 61 -5.520 36.601 -64.225 1.00 57.26 C
ATOM 456 NE2 HIS A 61 -4.702 37.088 -63.311 1.00 55.80 N
ATOM 457 N LEU A 62 -4.396 42.679 -67.087 1.00 59.73 N
ATOM 458 CA LEU A 62 -4.619 43.495 -68.274 1.00 60.84 C
ATOM 459 C LEU A 62 -3.341 44.172 -68.767 1.00 61.51 C
ATOM 460 O LEU A 62 -3.249 44.562 -69.930 1.00 61.80 O
ATOM 461 CB LEU A 62 -5.700 44.545 -67.993 1.00 59.91 C
ATOM 462 CG LEU A 62 -7.099 43.986 -67.691 1.00 60.55 C
ATOM 463 CD1 LEU A 62 -7.979 45.060 -67.107 1.00 59.95 C
ATOM 464 CD2 LEU A 62 -7.721 43.434 -68.951 1.00 61.07 C
ATOM 465 N ALA A 63 -2.349 44.286 -67.892 1.00 61.29 N
ATOM 466 CA ALA A 63 -1.097 44.930 -68.247 1.00 63.03 C
ATOM 467 C ALA A 63 -0.433 44.322 -69.479 1.00 64.87 C
ATOM 468 O ALA A 63 0.553 44.858 -69.992 1.00 66.89 O
ATOM 469 CB ALA A 63 -0.145 44.876 -67.077 1.00 62.31 C
ATOM 470 N PHE A 64 -0.964 43.210 -69.964 1.00 65.32 N
ATOM 471 CA PHE A 64 -0.372 42.563 -71.128 1.00 65.65 C
ATOM 472 C PHE A 64 -1.352 42.371 -72.269 1.00 64.71 C
ATOM 473 O PHE A 64 -0.987 41.845 -73.312 1.00 64.23 O
ATOM 474 CB PHE A 64 0.204 41.205 -70.718 1.00 68.31 C
ATOM 475 CG PHE A 64 1.408 41.300 -69.824 1.00 70.01 C
ATOM 476 CD1 PHE A 64 1.716 40.273 -68.943 1.00 69.52 C
ATOM 477 CD2 PHE A 64 2.241 42.419 -69.871 1.00 71.72 C
ATOM 478 CE1 PHE A 64 2.837 40.352 -68.114 1.00 71.10 C
ATOM 479 CE2 PHE A 64 3.359 42.505 -69.047 1.00 72.37 C
ATOM 480 CZ PHE A 64 3.660 41.467 -68.164 1.00 72.22 C
ATOM 481 N LYS A 65 -2.592 42.800 -72.068 1.00 64.30 N
ATOM 482 CA LYS A 65 -3.623 42.645 -73.081 1.00 63.68 C
ATOM 483 C LYS A 65 -3.747 43.879 -73.967 1.00 64.11 C
ATOM 484 O LYS A 65 -4.785 44.092 -74.597 1.00 63.43 O
ATOM 485 CB LYS A 65 -4.973 42.350 -72.418 1.00 64.38 C
ATOM 486 CG LYS A 65 -4.974 41.190 -71.421 1.00 64.21 C
ATOM 487 CD LYS A 65 -4.893 39.828 -72.078 1.00 64.30 C
ATOM 488 CE LYS A 65 -4.846 38.736 -71.018 1.00 66.68 C
ATOM 489 NZ LYS A 65 -4.995 37.358 -71.579 1.00 68.33 N
ATOM 490 N GLY A 66 -2.704 44.705 -74.002 1.00 64.72 N
ATOM 491 CA GLY A 66 -2.747 45.871 -74.866 1.00 66.14 C
ATOM 492 C GLY A 66 -2.914 47.268 -74.293 1.00 66.38 C
ATOM 493 O GLY A 66 -3.578 47.479 -73.274 1.00 65.50 O
ATOM 494 N THR A 67 -2.317 48.229 -75.003 1.00 67.03 N
ATOM 495 CA THR A 67 -2.337 49.645 -74.635 1.00 66.77 C
ATOM 496 C THR A 67 -3.197 50.485 -75.593 1.00 67.34 C
ATOM 497 O THR A 67 -3.885 49.953 -76.459 1.00 66.55 O
ATOM 498 CB THR A 67 -0.909 50.211 -74.642 1.00 65.55 C
ATOM 499 OG1 THR A 67 -0.465 50.350 -75.994 1.00 63.61 O
ATOM 500 CG2 THR A 67 0.045 49.268 -73.915 1.00 63.57 C
ATOM 501 N LYS A 68 -3.167 51.802 -75.430 1.00 70.04 N
ATOM 502 CA LYS A 68 -3.946 52.680 -76.304 1.00 73.40 C
ATOM 503 C LYS A 68 -3.255 52.776 -77.664 1.00 74.38 C
ATOM 504 O LYS A 68 -3.893 52.628 -78.711 1.00 74.17 O
ATOM 505 CB LYS A 68 -4.062 54.077 -75.698 1.00 74.48 C
ATOM 506 CG LYS A 68 -4.731 54.133 -74.342 1.00 75.67 C
ATOM 507 CD LYS A 68 -4.367 55.440 -73.666 1.00 77.90 C
ATOM 508 CE LYS A 68 -4.913 55.530 -72.259 1.00 80.04 C
ATOM 509 NZ LYS A 68 -4.278 56.676 -71.534 1.00 81.12 N
ATOM 510 N LYS A 69 -1.948 53.032 -77.642 1.00 74.85 N
ATOM 511 CA LYS A 69 -1.184 53.127 -78.877 1.00 75.33 C
ATOM 512 C LYS A 69 -1.259 51.821 -79.668 1.00 74.55 C
ATOM 513 O LYS A 69 -1.237 51.837 -80.899 1.00 75.76 O
ATOM 514 CB LYS A 69 0.289 53.447 -78.596 1.00 77.20 C
ATOM 515 CG LYS A 69 0.558 54.849 -78.053 1.00 81.06 C
ATOM 516 CD LYS A 69 2.043 55.236 -78.185 1.00 82.84 C
ATOM 517 CE LYS A 69 2.978 54.207 -77.531 1.00 84.96 C
ATOM 518 NZ LYS A 69 4.428 54.575 -77.587 1.00 83.89 N
ATOM 519 N ARG A 70 -1.352 50.688 -78.975 1.00 72.49 N
ATOM 520 CA ARG A 70 -1.399 49.409 -79.675 1.00 70.44 C
ATOM 521 C ARG A 70 -2.261 48.319 -79.049 1.00 69.91 C
ATOM 522 O ARG A 70 -1.886 47.710 -78.046 1.00 68.74 O
ATOM 523 CB ARG A 70 0.024 48.887 -79.865 1.00 68.56 C
ATOM 524 CG ARG A 70 0.771 48.641 -78.596 1.00 66.46 C
ATOM 525 CD ARG A 70 2.252 48.596 -78.857 1.00 65.22 C
ATOM 526 NE ARG A 70 2.840 49.922 -78.739 1.00 66.53 N
ATOM 527 CZ ARG A 70 4.128 50.188 -78.938 1.00 67.67 C
ATOM 528 NH1 ARG A 70 4.960 49.208 -79.269 1.00 66.40 N
ATOM 529 NH2 ARG A 70 4.586 51.432 -78.796 1.00 66.69 N
ATOM 530 N PRO A 71 -3.427 48.047 -79.656 1.00 69.96 N
ATOM 531 CA PRO A 71 -4.353 47.022 -79.165 1.00 70.86 C
ATOM 532 C PRO A 71 -3.697 45.657 -78.968 1.00 71.50 C
ATOM 533 O PRO A 71 -2.576 45.413 -79.420 1.00 71.16 O
ATOM 534 CB PRO A 71 -5.451 47.003 -80.230 1.00 71.08 C
ATOM 535 CG PRO A 71 -4.747 47.487 -81.463 1.00 70.73 C
ATOM 536 CD PRO A 71 -3.903 48.610 -80.929 1.00 69.39 C
ATOM 537 N CYS A 72 -4.419 44.773 -78.289 1.00 72.21 N
ATOM 538 CA CYS A 72 -3.947 43.429 -77.964 1.00 72.82 C
ATOM 539 C CYS A 72 -3.061 42.721 -78.998 1.00 72.12 C
ATOM 540 O CYS A 72 -1.842 42.624 -78.821 1.00 71.09 O
ATOM 541 CB CYS A 72 -5.149 42.540 -77.624 1.00 73.90 C
ATOM 542 SG CYS A 72 -4.741 41.079 -76.621 1.00 77.73 S
ATOM 543 N ALA A 73 -3.680 42.215 -80.061 1.00 71.95 N
ATOM 544 CA ALA A 73 -2.959 41.492 -81.107 1.00 72.24 C
ATOM 545 C ALA A 73 -1.667 42.190 -81.514 1.00 72.05 C
ATOM 546 O ALA A 73 -0.600 41.567 -81.589 1.00 70.69 O
ATOM 547 CB ALA A 73 -3.861 41.305 -82.317 1.00 72.15 C
ATOM 548 N ALA A 74 -1.773 43.490 -81.769 1.00 72.76 N
ATOM 549 CA ALA A 74 -0.622 44.292 -82.168 1.00 72.77 C
ATOM 550 C ALA A 74 0.461 44.246 -81.097 1.00 72.65 C
ATOM 551 O ALA A 74 1.634 43.991 -81.389 1.00 72.39 O
ATOM 552 CB ALA A 74 -1.055 45.735 -82.415 1.00 73.16 C
ATOM 553 N PHE A 75 0.056 44.487 -79.854 1.00 72.32 N
ATOM 554 CA PHE A 75 0.987 44.475 -78.740 1.00 72.24 C
ATOM 555 C PHE A 75 1.723 43.141 -78.625 1.00 71.88 C
ATOM 556 O PHE A 75 2.956 43.092 -78.507 1.00 69.76 O
ATOM 557 CB PHE A 75 0.247 44.756 -77.431 1.00 73.29 C
ATOM 558 CG PHE A 75 1.152 44.792 -76.232 1.00 75.20 C
ATOM 559 CD1 PHE A 75 2.022 45.864 -76.037 1.00 74.95 C
ATOM 560 CD2 PHE A 75 1.199 43.718 -75.345 1.00 75.42 C
ATOM 561 CE1 PHE A 75 2.931 45.866 -74.985 1.00 74.56 C
ATOM 562 CE2 PHE A 75 2.107 43.711 -74.289 1.00 76.36 C
ATOM 563 CZ PHE A 75 2.976 44.790 -74.112 1.00 75.55 C
ATOM 564 N GLU A 76 0.956 42.059 -78.661 1.00 72.39 N
ATOM 565 CA GLU A 76 1.525 40.726 -78.533 1.00 73.71 C
ATOM 566 C GLU A 76 2.472 40.371 -79.668 1.00 73.41 C
ATOM 567 O GLU A 76 3.626 39.972 -79.436 1.00 71.17 O
ATOM 568 CB GLU A 76 0.406 39.688 -78.456 1.00 75.39 C
ATOM 569 CG GLU A 76 -0.510 39.855 -77.258 1.00 76.58 C
ATOM 570 CD GLU A 76 -1.371 38.635 -77.029 1.00 77.48 C
ATOM 571 OE1 GLU A 76 -2.205 38.322 -77.906 1.00 78.04 O
ATOM 572 OE2 GLU A 76 -1.206 37.985 -75.974 1.00 78.40 O
ATOM 573 N LYS A 77 1.971 40.510 -80.896 1.00 73.13 N
ATOM 574 CA LYS A 77 2.759 40.204 -82.083 1.00 72.28 C
ATOM 575 C LYS A 77 4.124 40.895 -82.025 1.00 70.07 C
ATOM 576 O LYS A 77 5.165 40.256 -82.189 1.00 68.87 O
ATOM 577 CB LYS A 77 2.004 40.639 -83.343 1.00 74.23 C
ATOM 578 CG LYS A 77 2.784 40.426 -84.644 1.00 76.54 C
ATOM 579 CD LYS A 77 1.995 40.904 -85.860 1.00 78.22 C
ATOM 580 CE LYS A 77 2.854 40.886 -87.131 1.00 78.57 C
ATOM 581 NZ LYS A 77 2.099 41.329 -88.338 1.00 78.01 N
ATOM 582 N GLU A 78 4.109 42.199 -81.776 1.00 67.52 N
ATOM 583 CA GLU A 78 5.337 42.966 -81.707 1.00 65.87 C
ATOM 584 C GLU A 78 6.361 42.396 -80.733 1.00 66.40 C
ATOM 585 O GLU A 78 7.549 42.325 -81.038 1.00 64.34 O
ATOM 586 CB GLU A 78 5.025 44.408 -81.333 1.00 64.21 C
ATOM 587 CG GLU A 78 6.267 45.260 -81.223 1.00 62.50 C
ATOM 588 CD GLU A 78 5.950 46.699 -80.947 1.00 61.67 C
ATOM 589 OE1 GLU A 78 6.911 47.481 -80.742 1.00 61.85 O
ATOM 590 OE2 GLU A 78 4.742 47.040 -80.936 1.00 59.48 O
ATOM 591 N VAL A 79 5.899 42.003 -79.551 1.00 68.89 N
ATOM 592 CA VAL A 79 6.783 41.441 -78.535 1.00 69.97 C
ATOM 593 C VAL A 79 7.191 40.018 -78.891 1.00 70.45 C
ATOM 594 O VAL A 79 8.362 39.654 -78.776 1.00 69.13 O
ATOM 595 CB VAL A 79 6.111 41.420 -77.146 1.00 70.70 C
ATOM 596 CG1 VAL A 79 6.992 40.648 -76.161 1.00 70.35 C
ATOM 597 CG2 VAL A 79 5.867 42.854 -76.650 1.00 70.65 C
ATOM 598 N GLU A 80 6.219 39.215 -79.313 1.00 71.51 N
ATOM 599 CA GLU A 80 6.503 37.833 -79.677 1.00 73.55 C
ATOM 600 C GLU A 80 7.510 37.781 -80.813 1.00 73.76 C
ATOM 601 O GLU A 80 8.546 37.115 -80.712 1.00 74.11 O
ATOM 602 CB GLU A 80 5.230 37.106 -80.119 1.00 74.77 C
ATOM 603 CG GLU A 80 4.277 36.726 -79.014 1.00 76.83 C
ATOM 604 CD GLU A 80 3.090 35.929 -79.535 1.00 80.21 C
ATOM 605 OE1 GLU A 80 3.315 34.885 -80.188 1.00 81.30 O
ATOM 606 OE2 GLU A 80 1.932 36.340 -79.290 1.00 82.29 O
ATOM 607 N SER A 81 7.203 38.500 -81.889 1.00 73.30 N
ATOM 608 CA SER A 81 8.050 38.522 -83.073 1.00 72.87 C
ATOM 609 C SER A 81 9.484 38.994 -82.861 1.00 71.94 C
ATOM 610 O SER A 81 10.309 38.862 -83.762 1.00 72.11 O
ATOM 611 CB SER A 81 7.388 39.348 -84.170 1.00 72.62 C
ATOM 612 OG SER A 81 7.210 40.673 -83.739 1.00 76.34 O
ATOM 613 N MET A 82 9.796 39.544 -81.694 1.00 71.62 N
ATOM 614 CA MET A 82 11.171 39.960 -81.446 1.00 72.00 C
ATOM 615 C MET A 82 11.872 39.004 -80.476 1.00 71.82 C
ATOM 616 O MET A 82 13.003 39.251 -80.035 1.00 71.53 O
ATOM 617 CB MET A 82 11.227 41.408 -80.944 1.00 72.60 C
ATOM 618 CG MET A 82 10.413 41.719 -79.724 1.00 76.74 C
ATOM 619 SD MET A 82 10.351 43.518 -79.475 1.00 81.80 S
ATOM 620 CE MET A 82 12.063 43.872 -78.990 1.00 80.38 C
ATOM 621 N GLY A 83 11.190 37.900 -80.169 1.00 71.22 N
ATOM 622 CA GLY A 83 11.732 36.888 -79.276 1.00 71.47 C
ATOM 623 C GLY A 83 11.840 37.294 -77.818 1.00 71.10 C
ATOM 624 O GLY A 83 12.518 36.631 -77.031 1.00 70.45 O
ATOM 625 N ALA A 84 11.165 38.379 -77.455 1.00 71.21 N
ATOM 626 CA ALA A 84 11.186 38.885 -76.088 1.00 71.18 C
ATOM 627 C ALA A 84 10.150 38.184 -75.218 1.00 70.85 C
ATOM 628 O ALA A 84 9.107 37.743 -75.696 1.00 70.49 O
ATOM 629 CB ALA A 84 10.938 40.396 -76.080 1.00 70.94 C
ATOM 630 N HIS A 85 10.452 38.101 -73.930 1.00 70.88 N
ATOM 631 CA HIS A 85 9.577 37.457 -72.965 1.00 69.44 C
ATOM 632 C HIS A 85 8.964 38.482 -72.046 1.00 68.44 C
ATOM 633 O HIS A 85 9.668 39.275 -71.426 1.00 67.76 O
ATOM 634 CB HIS A 85 10.377 36.460 -72.140 1.00 69.72 C
ATOM 635 CG HIS A 85 10.860 35.287 -72.927 1.00 70.53 C
ATOM 636 ND1 HIS A 85 11.728 34.352 -72.409 1.00 70.68 N
ATOM 637 CD2 HIS A 85 10.579 34.884 -74.188 1.00 71.06 C
ATOM 638 CE1 HIS A 85 11.962 33.423 -73.317 1.00 70.93 C
ATOM 639 NE2 HIS A 85 11.276 33.721 -74.405 1.00 71.09 N
ATOM 640 N PHE A 86 7.645 38.466 -71.949 1.00 68.50 N
ATOM 641 CA PHE A 86 6.982 39.414 -71.081 1.00 68.34 C
ATOM 642 C PHE A 86 6.334 38.769 -69.867 1.00 66.87 C
ATOM 643 O PHE A 86 5.314 38.088 -69.969 1.00 65.62 O
ATOM 644 CB PHE A 86 5.936 40.212 -71.843 1.00 69.76 C
ATOM 645 CG PHE A 86 5.783 41.603 -71.333 1.00 74.14 C
ATOM 646 CD1 PHE A 86 6.374 41.971 -70.123 1.00 75.67 C
ATOM 647 CD2 PHE A 86 5.082 42.554 -72.057 1.00 76.26 C
ATOM 648 CE1 PHE A 86 6.277 43.267 -69.641 1.00 77.87 C
ATOM 649 CE2 PHE A 86 4.975 43.860 -71.587 1.00 79.39 C
ATOM 650 CZ PHE A 86 5.575 44.220 -70.373 1.00 79.68 C
ATOM 651 N ASN A 87 6.939 38.986 -68.710 1.00 65.88 N
ATOM 652 CA ASN A 87 6.396 38.426 -67.492 1.00 65.94 C
ATOM 653 C ASN A 87 6.231 39.497 -66.428 1.00 64.04 C
ATOM 654 O ASN A 87 6.509 40.669 -66.660 1.00 63.66 O
ATOM 655 CB ASN A 87 7.292 37.298 -66.976 1.00 67.86 C
ATOM 656 CG ASN A 87 6.597 36.437 -65.938 1.00 68.97 C
ATOM 657 OD1 ASN A 87 5.568 35.813 -66.207 1.00 68.88 O
ATOM 658 ND2 ASN A 87 7.155 36.406 -64.741 1.00 71.72 N
ATOM 659 N GLY A 88 5.769 39.084 -65.259 1.00 63.07 N
ATOM 660 CA GLY A 88 5.558 40.027 -64.178 1.00 61.56 C
ATOM 661 C GLY A 88 4.736 39.436 -63.049 1.00 58.88 C
ATOM 662 O GLY A 88 4.169 38.357 -63.161 1.00 58.52 O
ATOM 663 N TYR A 89 4.648 40.169 -61.955 1.00 57.68 N
ATOM 664 CA TYR A 89 3.927 39.675 -60.806 1.00 55.19 C
ATOM 665 C TYR A 89 3.485 40.817 -59.914 1.00 56.03 C
ATOM 666 O TYR A 89 3.976 41.946 -60.021 1.00 55.30 O
ATOM 667 CB TYR A 89 4.837 38.746 -60.017 1.00 50.83 C
ATOM 668 CG TYR A 89 5.991 39.466 -59.373 1.00 48.70 C
ATOM 669 CD1 TYR A 89 5.810 40.197 -58.204 1.00 49.34 C
ATOM 670 CD2 TYR A 89 7.266 39.432 -59.938 1.00 49.39 C
ATOM 671 CE1 TYR A 89 6.866 40.884 -57.600 1.00 50.46 C
ATOM 672 CE2 TYR A 89 8.342 40.115 -59.343 1.00 50.56 C
ATOM 673 CZ TYR A 89 8.129 40.840 -58.169 1.00 51.42 C
ATOM 674 OH TYR A 89 9.162 41.510 -57.550 1.00 51.48 O
ATOM 675 N THR A 90 2.561 40.502 -59.016 1.00 56.95 N
ATOM 676 CA THR A 90 2.046 41.464 -58.058 1.00 56.47 C
ATOM 677 C THR A 90 2.025 40.744 -56.704 1.00 55.14 C
ATOM 678 O THR A 90 1.574 39.611 -56.616 1.00 55.29 O
ATOM 679 CB THR A 90 0.626 41.958 -58.500 1.00 57.64 C
ATOM 680 OG1 THR A 90 -0.125 42.393 -57.361 1.00 60.13 O
ATOM 681 CG2 THR A 90 -0.123 40.866 -59.230 1.00 57.58 C
ATOM 682 N SER A 91 2.564 41.382 -55.667 1.00 54.66 N
ATOM 683 CA SER A 91 2.592 40.800 -54.327 1.00 53.06 C
ATOM 684 C SER A 91 1.921 41.736 -53.313 1.00 53.73 C
ATOM 685 O SER A 91 1.072 42.546 -53.683 1.00 53.66 O
ATOM 686 CB SER A 91 4.031 40.495 -53.900 1.00 52.00 C
ATOM 687 OG SER A 91 4.727 41.668 -53.525 1.00 54.92 O
ATOM 688 N ARG A 92 2.302 41.638 -52.040 1.00 54.70 N
ATOM 689 CA ARG A 92 1.680 42.461 -51.006 1.00 54.34 C
ATOM 690 C ARG A 92 2.195 43.885 -50.905 1.00 55.78 C
ATOM 691 O ARG A 92 1.426 44.803 -50.578 1.00 56.14 O
ATOM 692 CB ARG A 92 1.787 41.776 -49.639 1.00 53.08 C
ATOM 693 CG ARG A 92 0.869 40.571 -49.512 1.00 53.79 C
ATOM 694 CD ARG A 92 0.485 40.242 -48.063 1.00 51.67 C
ATOM 695 NE ARG A 92 -0.571 39.229 -48.010 1.00 47.03 N
ATOM 696 CZ ARG A 92 -0.372 37.940 -48.265 1.00 46.98 C
ATOM 697 NH1 ARG A 92 0.843 37.515 -48.577 1.00 43.99 N
ATOM 698 NH2 ARG A 92 -1.384 37.080 -48.229 1.00 47.61 N
ATOM 699 N GLU A 93 3.489 44.067 -51.167 1.00 55.40 N
ATOM 700 CA GLU A 93 4.092 45.394 -51.115 1.00 54.73 C
ATOM 701 C GLU A 93 4.858 45.733 -52.392 1.00 55.46 C
ATOM 702 O GLU A 93 5.390 46.848 -52.522 1.00 57.13 O
ATOM 703 CB GLU A 93 5.066 45.508 -49.940 1.00 52.86 C
ATOM 704 CG GLU A 93 4.442 45.848 -48.609 1.00 51.39 C
ATOM 705 CD GLU A 93 5.427 46.537 -47.663 1.00 51.19 C
ATOM 706 OE1 GLU A 93 6.655 46.254 -47.742 1.00 48.91 O
ATOM 707 OE2 GLU A 93 4.959 47.353 -46.837 1.00 49.51 O
ATOM 708 N GLN A 94 4.899 44.798 -53.339 1.00 53.89 N
ATOM 709 CA GLN A 94 5.679 45.019 -54.548 1.00 52.23 C
ATOM 710 C GLN A 94 5.117 44.423 -55.817 1.00 51.15 C
ATOM 711 O GLN A 94 4.678 43.289 -55.822 1.00 52.54 O
ATOM 712 CB GLN A 94 7.070 44.457 -54.305 1.00 51.40 C
ATOM 713 CG GLN A 94 8.037 44.603 -55.426 1.00 49.83 C
ATOM 714 CD GLN A 94 9.409 44.170 -54.982 1.00 49.87 C
ATOM 715 OE1 GLN A 94 9.879 44.586 -53.915 1.00 50.88 O
ATOM 716 NE2 GLN A 94 10.065 43.333 -55.785 1.00 46.04 N
ATOM 717 N THR A 95 5.156 45.187 -56.900 1.00 50.89 N
ATOM 718 CA THR A 95 4.656 44.719 -58.188 1.00 50.31 C
ATOM 719 C THR A 95 5.794 44.817 -59.197 1.00 50.33 C
ATOM 720 O THR A 95 6.752 45.552 -58.975 1.00 50.92 O
ATOM 721 CB THR A 95 3.486 45.590 -58.687 1.00 50.21 C
ATOM 722 OG1 THR A 95 2.457 45.641 -57.692 1.00 49.96 O
ATOM 723 CG2 THR A 95 2.903 45.008 -59.971 1.00 50.52 C
ATOM 724 N ALA A 96 5.704 44.069 -60.293 1.00 50.14 N
ATOM 725 CA ALA A 96 6.746 44.119 -61.314 1.00 50.54 C
ATOM 726 C ALA A 96 6.302 43.665 -62.713 1.00 51.11 C
ATOM 727 O ALA A 96 5.488 42.752 -62.877 1.00 51.03 O
ATOM 728 CB ALA A 96 7.968 43.299 -60.858 1.00 47.84 C
ATOM 729 N PHE A 97 6.830 44.340 -63.726 1.00 51.93 N
ATOM 730 CA PHE A 97 6.562 43.993 -65.114 1.00 52.17 C
ATOM 731 C PHE A 97 7.915 44.057 -65.789 1.00 52.99 C
ATOM 732 O PHE A 97 8.531 45.120 -65.856 1.00 54.27 O
ATOM 733 CB PHE A 97 5.621 44.995 -65.754 1.00 50.43 C
ATOM 734 CG PHE A 97 4.310 45.125 -65.049 1.00 50.16 C
ATOM 735 CD1 PHE A 97 4.091 46.161 -64.148 1.00 50.16 C
ATOM 736 CD2 PHE A 97 3.290 44.221 -65.293 1.00 48.68 C
ATOM 737 CE1 PHE A 97 2.866 46.296 -63.505 1.00 50.86 C
ATOM 738 CE2 PHE A 97 2.067 44.344 -64.655 1.00 49.15 C
ATOM 739 CZ PHE A 97 1.849 45.380 -63.763 1.00 49.71 C
ATOM 740 N TYR A 98 8.401 42.924 -66.264 1.00 53.61 N
ATOM 741 CA TYR A 98 9.695 42.921 -66.899 1.00 55.68 C
ATOM 742 C TYR A 98 9.764 42.130 -68.205 1.00 57.25 C
ATOM 743 O TYR A 98 8.949 41.239 -68.469 1.00 56.63 O
ATOM 744 CB TYR A 98 10.734 42.419 -65.909 1.00 55.74 C
ATOM 745 CG TYR A 98 10.478 41.026 -65.419 1.00 57.36 C
ATOM 746 CD1 TYR A 98 10.696 39.928 -66.242 1.00 58.35 C
ATOM 747 CD2 TYR A 98 10.048 40.799 -64.117 1.00 58.29 C
ATOM 748 CE1 TYR A 98 10.501 38.637 -65.776 1.00 60.22 C
ATOM 749 CE2 TYR A 98 9.847 39.515 -63.641 1.00 58.86 C
ATOM 750 CZ TYR A 98 10.080 38.437 -64.471 1.00 60.21 C
ATOM 751 OH TYR A 98 9.920 37.154 -63.990 1.00 62.92 O
ATOM 752 N ILE A 99 10.755 42.479 -69.021 1.00 58.61 N
ATOM 753 CA ILE A 99 10.962 41.846 -70.311 1.00 58.42 C
ATOM 754 C ILE A 99 12.378 41.316 -70.489 1.00 59.08 C
ATOM 755 O ILE A 99 13.357 41.958 -70.104 1.00 59.47 O
ATOM 756 CB ILE A 99 10.655 42.841 -71.454 1.00 57.68 C
ATOM 757 CG1 ILE A 99 9.152 43.125 -71.498 1.00 58.32 C
ATOM 758 CG2 ILE A 99 11.142 42.292 -72.777 1.00 58.16 C
ATOM 759 CD1 ILE A 99 8.704 44.073 -72.603 1.00 56.47 C
ATOM 760 N LYS A 100 12.466 40.117 -71.052 1.00 60.15 N
ATOM 761 CA LYS A 100 13.747 39.503 -71.347 1.00 61.64 C
ATOM 762 C LYS A 100 13.889 39.653 -72.858 1.00 63.06 C
ATOM 763 O LYS A 100 12.980 39.291 -73.611 1.00 62.75 O
ATOM 764 CB LYS A 100 13.745 38.024 -70.962 1.00 61.12 C
ATOM 765 CG LYS A 100 13.670 37.771 -69.473 1.00 60.94 C
ATOM 766 CD LYS A 100 13.695 36.282 -69.160 1.00 60.79 C
ATOM 767 CE LYS A 100 14.972 35.611 -69.654 1.00 60.25 C
ATOM 768 NZ LYS A 100 16.171 36.183 -68.996 1.00 61.36 N
ATOM 769 N ALA A 101 15.016 40.208 -73.300 1.00 64.63 N
ATOM 770 CA ALA A 101 15.245 40.409 -74.723 1.00 64.82 C
ATOM 771 C ALA A 101 16.717 40.595 -75.054 1.00 65.50 C
ATOM 772 O ALA A 101 17.594 40.467 -74.192 1.00 63.77 O
ATOM 773 CB ALA A 101 14.449 41.614 -75.208 1.00 64.67 C
ATOM 774 N LEU A 102 16.967 40.891 -76.328 1.00 67.39 N
ATOM 775 CA LEU A 102 18.314 41.122 -76.848 1.00 67.52 C
ATOM 776 C LEU A 102 18.719 42.537 -76.473 1.00 67.96 C
ATOM 777 O LEU A 102 17.972 43.483 -76.732 1.00 67.60 O
ATOM 778 CB LEU A 102 18.315 40.981 -78.369 1.00 66.51 C
ATOM 779 CG LEU A 102 17.892 39.619 -78.918 1.00 65.48 C
ATOM 780 CD1 LEU A 102 17.522 39.735 -80.384 1.00 65.54 C
ATOM 781 CD2 LEU A 102 19.020 38.636 -78.719 1.00 64.23 C
ATOM 782 N SER A 103 19.892 42.683 -75.865 1.00 68.66 N
ATOM 783 CA SER A 103 20.380 44.000 -75.460 1.00 70.37 C
ATOM 784 C SER A 103 20.145 44.994 -76.595 1.00 71.16 C
ATOM 785 O SER A 103 19.896 46.182 -76.379 1.00 71.26 O
ATOM 786 CB SER A 103 21.869 43.921 -75.148 1.00 71.06 C
ATOM 787 OG SER A 103 22.146 42.835 -74.282 1.00 73.01 O
ATOM 788 N LYS A 104 20.230 44.467 -77.809 1.00 72.21 N
ATOM 789 CA LYS A 104 20.033 45.220 -79.030 1.00 72.57 C
ATOM 790 C LYS A 104 18.662 45.899 -79.063 1.00 72.30 C
ATOM 791 O LYS A 104 18.423 46.787 -79.882 1.00 73.26 O
ATOM 792 CB LYS A 104 20.188 44.263 -80.223 1.00 74.43 C
ATOM 793 CG LYS A 104 19.734 44.816 -81.575 1.00 76.86 C
ATOM 794 CD LYS A 104 20.069 43.865 -82.726 1.00 77.99 C
ATOM 795 CE LYS A 104 19.380 42.516 -82.585 1.00 78.08 C
ATOM 796 NZ LYS A 104 19.824 41.573 -83.654 1.00 76.57 N
ATOM 797 N ASP A 105 17.755 45.497 -78.178 1.00 71.06 N
ATOM 798 CA ASP A 105 16.428 46.100 -78.188 1.00 70.16 C
ATOM 799 C ASP A 105 16.056 46.825 -76.903 1.00 68.68 C
ATOM 800 O ASP A 105 14.926 47.294 -76.753 1.00 67.20 O
ATOM 801 CB ASP A 105 15.371 45.041 -78.514 1.00 72.03 C
ATOM 802 CG ASP A 105 15.651 44.326 -79.824 1.00 74.03 C
ATOM 803 OD1 ASP A 105 16.135 44.990 -80.767 1.00 74.85 O
ATOM 804 OD2 ASP A 105 15.382 43.107 -79.917 1.00 75.51 O
ATOM 805 N MET A 106 17.016 46.928 -75.989 1.00 67.55 N
ATOM 806 CA MET A 106 16.792 47.599 -74.719 1.00 67.20 C
ATOM 807 C MET A 106 15.926 48.854 -74.871 1.00 68.21 C
ATOM 808 O MET A 106 14.995 49.069 -74.095 1.00 69.03 O
ATOM 809 CB MET A 106 18.136 47.931 -74.067 1.00 66.13 C
ATOM 810 CG MET A 106 18.072 48.934 -72.924 1.00 66.07 C
ATOM 811 SD MET A 106 18.294 50.651 -73.488 1.00 66.64 S
ATOM 812 CE MET A 106 16.754 51.338 -73.195 1.00 66.06 C
ATOM 813 N PRO A 107 16.215 49.698 -75.876 1.00 69.15 N
ATOM 814 CA PRO A 107 15.419 50.917 -76.075 1.00 69.01 C
ATOM 815 C PRO A 107 13.955 50.707 -76.470 1.00 68.33 C
ATOM 816 O PRO A 107 13.073 51.361 -75.922 1.00 68.76 O
ATOM 817 CB PRO A 107 16.213 51.682 -77.139 1.00 69.03 C
ATOM 818 CG PRO A 107 16.930 50.581 -77.889 1.00 69.16 C
ATOM 819 CD PRO A 107 17.391 49.695 -76.766 1.00 69.23 C
ATOM 820 N LYS A 108 13.689 49.816 -77.422 1.00 68.08 N
ATOM 821 CA LYS A 108 12.306 49.567 -77.841 1.00 68.42 C
ATOM 822 C LYS A 108 11.519 49.001 -76.657 1.00 69.12 C
ATOM 823 O LYS A 108 10.344 49.322 -76.456 1.00 69.36 O
ATOM 824 CB LYS A 108 12.271 48.576 -79.011 1.00 67.64 C
ATOM 825 CG LYS A 108 10.898 47.960 -79.287 1.00 67.15 C
ATOM 826 CD LYS A 108 10.159 48.586 -80.468 1.00 66.79 C
ATOM 827 CE LYS A 108 9.766 50.037 -80.212 1.00 67.61 C
ATOM 828 NZ LYS A 108 8.991 50.613 -81.356 1.00 64.71 N
ATOM 829 N VAL A 109 12.187 48.151 -75.881 1.00 68.62 N
ATOM 830 CA VAL A 109 11.591 47.532 -74.707 1.00 67.59 C
ATOM 831 C VAL A 109 11.153 48.615 -73.718 1.00 67.23 C
ATOM 832 O VAL A 109 9.994 48.648 -73.289 1.00 66.88 O
ATOM 833 CB VAL A 109 12.602 46.585 -74.019 1.00 67.21 C
ATOM 834 CG1 VAL A 109 12.006 46.026 -72.742 1.00 67.14 C
ATOM 835 CG2 VAL A 109 12.985 45.460 -74.966 1.00 65.29 C
ATOM 836 N VAL A 110 12.087 49.496 -73.361 1.00 65.92 N
ATOM 837 CA VAL A 110 11.795 50.587 -72.438 1.00 65.41 C
ATOM 838 C VAL A 110 10.555 51.349 -72.882 1.00 65.89 C
ATOM 839 O VAL A 110 9.749 51.782 -72.056 1.00 67.09 O
ATOM 840 CB VAL A 110 12.958 51.582 -72.344 1.00 64.14 C
ATOM 841 CG1 VAL A 110 12.508 52.820 -71.590 1.00 62.80 C
ATOM 842 CG2 VAL A 110 14.145 50.936 -71.638 1.00 62.54 C
ATOM 843 N GLU A 111 10.405 51.517 -74.187 1.00 65.55 N
ATOM 844 CA GLU A 111 9.243 52.206 -74.720 1.00 65.67 C
ATOM 845 C GLU A 111 8.004 51.365 -74.421 1.00 64.79 C
ATOM 846 O GLU A 111 6.964 51.877 -74.002 1.00 64.71 O
ATOM 847 CB GLU A 111 9.378 52.370 -76.228 1.00 67.24 C
ATOM 848 CG GLU A 111 8.192 53.076 -76.863 1.00 69.18 C
ATOM 849 CD GLU A 111 8.174 52.905 -78.360 1.00 70.49 C
ATOM 850 OE1 GLU A 111 9.260 53.019 -78.971 1.00 70.24 O
ATOM 851 OE2 GLU A 111 7.078 52.660 -78.919 1.00 71.86 O
ATOM 852 N LEU A 112 8.130 50.063 -74.653 1.00 62.51 N
ATOM 853 CA LEU A 112 7.044 49.135 -74.414 1.00 60.64 C
ATOM 854 C LEU A 112 6.628 49.140 -72.945 1.00 60.35 C
ATOM 855 O LEU A 112 5.435 49.214 -72.628 1.00 58.97 O
ATOM 856 CB LEU A 112 7.473 47.731 -74.846 1.00 59.33 C
ATOM 857 CG LEU A 112 7.577 47.557 -76.360 1.00 58.04 C
ATOM 858 CD1 LEU A 112 8.306 46.275 -76.678 1.00 58.58 C
ATOM 859 CD2 LEU A 112 6.189 47.557 -76.972 1.00 56.13 C
ATOM 860 N LEU A 113 7.614 49.063 -72.053 1.00 59.40 N
ATOM 861 CA LEU A 113 7.330 49.063 -70.628 1.00 58.97 C
ATOM 862 C LEU A 113 6.509 50.285 -70.268 1.00 59.44 C
ATOM 863 O LEU A 113 5.404 50.168 -69.730 1.00 60.14 O
ATOM 864 CB LEU A 113 8.619 49.067 -69.826 1.00 57.80 C
ATOM 865 CG LEU A 113 9.428 47.776 -69.890 1.00 59.94 C
ATOM 866 CD1 LEU A 113 10.690 47.925 -69.021 1.00 60.01 C
ATOM 867 CD2 LEU A 113 8.573 46.602 -69.421 1.00 57.39 C
ATOM 868 N ALA A 114 7.057 51.456 -70.574 1.00 59.29 N
ATOM 869 CA ALA A 114 6.387 52.718 -70.290 1.00 59.27 C
ATOM 870 C ALA A 114 4.955 52.736 -70.817 1.00 59.45 C
ATOM 871 O ALA A 114 4.039 53.222 -70.151 1.00 59.00 O
ATOM 872 CB ALA A 114 7.167 53.860 -70.895 1.00 58.50 C
ATOM 873 N ASP A 115 4.761 52.199 -72.010 1.00 59.86 N
ATOM 874 CA ASP A 115 3.438 52.180 -72.615 1.00 62.01 C
ATOM 875 C ASP A 115 2.463 51.307 -71.809 1.00 62.05 C
ATOM 876 O ASP A 115 1.267 51.619 -71.706 1.00 59.92 O
ATOM 877 CB ASP A 115 3.558 51.696 -74.074 1.00 63.87 C
ATOM 878 CG ASP A 115 2.257 51.835 -74.857 1.00 65.50 C
ATOM 879 OD1 ASP A 115 1.569 52.881 -74.730 1.00 65.82 O
ATOM 880 OD2 ASP A 115 1.930 50.895 -75.615 1.00 67.08 O
ATOM 881 N VAL A 116 2.993 50.226 -71.227 1.00 62.65 N
ATOM 882 CA VAL A 116 2.200 49.288 -70.426 1.00 62.11 C
ATOM 883 C VAL A 116 1.773 49.893 -69.099 1.00 61.22 C
ATOM 884 O VAL A 116 0.597 49.838 -68.732 1.00 60.34 O
ATOM 885 CB VAL A 116 2.992 48.003 -70.123 1.00 62.93 C
ATOM 886 CG1 VAL A 116 2.173 47.078 -69.251 1.00 63.36 C
ATOM 887 CG2 VAL A 116 3.351 47.307 -71.412 1.00 64.04 C
ATOM 888 N VAL A 117 2.737 50.463 -68.384 1.00 60.79 N
ATOM 889 CA VAL A 117 2.470 51.080 -67.095 1.00 62.08 C
ATOM 890 C VAL A 117 1.689 52.388 -67.179 1.00 62.67 C
ATOM 891 O VAL A 117 1.031 52.774 -66.222 1.00 63.01 O
ATOM 892 CB VAL A 117 3.779 51.361 -66.330 1.00 62.63 C
ATOM 893 CG1 VAL A 117 4.518 50.061 -66.050 1.00 61.91 C
ATOM 894 CG2 VAL A 117 4.644 52.300 -67.131 1.00 63.10 C
ATOM 895 N GLN A 118 1.752 53.070 -68.318 1.00 64.25 N
ATOM 896 CA GLN A 118 1.056 54.348 -68.469 1.00 64.76 C
ATOM 897 C GLN A 118 -0.245 54.328 -69.261 1.00 65.70 C
ATOM 898 O GLN A 118 -1.221 54.967 -68.864 1.00 66.11 O
ATOM 899 CB GLN A 118 1.974 55.373 -69.128 1.00 65.36 C
ATOM 900 CG GLN A 118 3.209 55.761 -68.337 1.00 65.87 C
ATOM 901 CD GLN A 118 4.230 56.501 -69.194 1.00 65.05 C
ATOM 902 OE1 GLN A 118 5.123 57.167 -68.678 1.00 66.02 O
ATOM 903 NE2 GLN A 118 4.103 56.374 -70.507 1.00 64.43 N
ATOM 904 N ASN A 119 -0.268 53.606 -70.378 1.00 66.28 N
ATOM 905 CA ASN A 119 -1.458 53.597 -71.230 1.00 67.21 C
ATOM 906 C ASN A 119 -2.144 52.264 -71.426 1.00 66.87 C
ATOM 907 O ASN A 119 -2.411 51.871 -72.559 1.00 67.36 O
ATOM 908 CB ASN A 119 -1.093 54.161 -72.603 1.00 68.56 C
ATOM 909 CG ASN A 119 -0.248 55.407 -72.496 1.00 69.73 C
ATOM 910 OD1 ASN A 119 -0.739 56.468 -72.092 1.00 70.40 O
ATOM 911 ND2 ASN A 119 1.039 55.284 -72.832 1.00 68.71 N
ATOM 912 N CYS A 120 -2.441 51.567 -70.338 1.00 66.69 N
ATOM 913 CA CYS A 120 -3.112 50.281 -70.458 1.00 65.06 C
ATOM 914 C CYS A 120 -4.523 50.518 -71.003 1.00 63.23 C
ATOM 915 O CYS A 120 -5.277 51.335 -70.484 1.00 62.97 O
ATOM 916 CB CYS A 120 -3.163 49.580 -69.099 1.00 65.29 C
ATOM 917 SG CYS A 120 -4.196 48.105 -69.091 1.00 65.03 S
ATOM 918 N ALA A 121 -4.867 49.803 -72.061 1.00 61.61 N
ATOM 919 CA ALA A 121 -6.172 49.947 -72.688 1.00 62.27 C
ATOM 920 C ALA A 121 -7.362 49.691 -71.769 1.00 63.07 C
ATOM 921 O ALA A 121 -8.414 50.314 -71.929 1.00 63.46 O
ATOM 922 CB ALA A 121 -6.259 49.023 -73.900 1.00 62.53 C
ATOM 923 N LEU A 122 -7.205 48.774 -70.815 1.00 63.11 N
ATOM 924 CA LEU A 122 -8.292 48.432 -69.909 1.00 62.40 C
ATOM 925 C LEU A 122 -9.557 48.241 -70.723 1.00 62.76 C
ATOM 926 O LEU A 122 -10.602 48.822 -70.428 1.00 61.68 O
ATOM 927 CB LEU A 122 -8.512 49.532 -68.872 1.00 62.98 C
ATOM 928 CG LEU A 122 -7.395 49.717 -67.848 1.00 62.38 C
ATOM 929 CD1 LEU A 122 -7.851 50.701 -66.789 1.00 60.53 C
ATOM 930 CD2 LEU A 122 -7.050 48.376 -67.223 1.00 61.50 C
ATOM 931 N GLU A 123 -9.446 47.422 -71.758 1.00 64.28 N
ATOM 932 CA GLU A 123 -10.576 47.152 -72.622 1.00 66.38 C
ATOM 933 C GLU A 123 -11.776 46.702 -71.800 1.00 66.48 C
ATOM 934 O GLU A 123 -11.722 45.701 -71.096 1.00 66.68 O
ATOM 935 CB GLU A 123 -10.196 46.082 -73.643 1.00 68.55 C
ATOM 936 CG GLU A 123 -10.797 46.325 -75.016 1.00 71.51 C
ATOM 937 CD GLU A 123 -10.587 47.759 -75.486 1.00 72.96 C
ATOM 938 OE1 GLU A 123 -11.445 48.625 -75.188 1.00 72.85 O
ATOM 939 OE2 GLU A 123 -9.550 48.022 -76.138 1.00 74.26 O
ATOM 940 N GLU A 124 -12.863 47.453 -71.896 1.00 67.97 N
ATOM 941 CA GLU A 124 -14.080 47.146 -71.159 1.00 69.62 C
ATOM 942 C GLU A 124 -14.507 45.688 -71.289 1.00 68.91 C
ATOM 943 O GLU A 124 -14.978 45.090 -70.325 1.00 70.09 O
ATOM 944 CB GLU A 124 -15.214 48.049 -71.642 1.00 72.51 C
ATOM 945 CG GLU A 124 -16.422 48.037 -70.742 1.00 76.96 C
ATOM 946 CD GLU A 124 -16.067 48.457 -69.334 1.00 80.55 C
ATOM 947 OE1 GLU A 124 -15.421 49.523 -69.197 1.00 80.79 O
ATOM 948 OE2 GLU A 124 -16.428 47.727 -68.373 1.00 83.51 O
ATOM 949 N SER A 125 -14.341 45.125 -72.481 1.00 67.82 N
ATOM 950 CA SER A 125 -14.717 43.741 -72.761 1.00 66.39 C
ATOM 951 C SER A 125 -13.691 42.734 -72.257 1.00 65.86 C
ATOM 952 O SER A 125 -14.032 41.593 -71.935 1.00 65.81 O
ATOM 953 CB SER A 125 -14.899 43.562 -74.263 1.00 65.80 C
ATOM 954 OG SER A 125 -13.792 44.116 -74.951 1.00 66.64 O
ATOM 955 N GLN A 126 -12.430 43.154 -72.217 1.00 64.92 N
ATOM 956 CA GLN A 126 -11.346 42.297 -71.749 1.00 63.69 C
ATOM 957 C GLN A 126 -11.514 42.117 -70.242 1.00 62.59 C
ATOM 958 O GLN A 126 -11.278 41.038 -69.698 1.00 61.86 O
ATOM 959 CB GLN A 126 -9.990 42.946 -72.051 1.00 63.86 C
ATOM 960 CG GLN A 126 -8.804 42.033 -71.824 1.00 65.18 C
ATOM 961 CD GLN A 126 -8.716 40.929 -72.862 1.00 66.84 C
ATOM 962 OE1 GLN A 126 -8.491 41.195 -74.038 1.00 70.20 O
ATOM 963 NE2 GLN A 126 -8.894 39.685 -72.432 1.00 66.99 N
ATOM 964 N ILE A 127 -11.926 43.192 -69.579 1.00 61.56 N
ATOM 965 CA ILE A 127 -12.148 43.177 -68.144 1.00 60.48 C
ATOM 966 C ILE A 127 -13.132 42.082 -67.729 1.00 61.46 C
ATOM 967 O ILE A 127 -12.850 41.316 -66.807 1.00 62.01 O
ATOM 968 CB ILE A 127 -12.655 44.550 -67.662 1.00 58.76 C
ATOM 969 CG1 ILE A 127 -11.475 45.518 -67.604 1.00 58.03 C
ATOM 970 CG2 ILE A 127 -13.344 44.434 -66.309 1.00 56.81 C
ATOM 971 CD1 ILE A 127 -11.850 46.921 -67.190 1.00 55.71 C
ATOM 972 N GLU A 128 -14.275 41.996 -68.405 1.00 61.00 N
ATOM 973 CA GLU A 128 -15.260 40.980 -68.072 1.00 60.99 C
ATOM 974 C GLU A 128 -14.714 39.596 -68.387 1.00 61.45 C
ATOM 975 O GLU A 128 -15.074 38.606 -67.749 1.00 62.19 O
ATOM 976 CB GLU A 128 -16.547 41.205 -68.855 1.00 61.51 C
ATOM 977 CG GLU A 128 -17.215 42.544 -68.587 1.00 64.52 C
ATOM 978 CD GLU A 128 -17.569 42.756 -67.122 1.00 66.86 C
ATOM 979 OE1 GLU A 128 -18.348 41.946 -66.559 1.00 67.13 O
ATOM 980 OE2 GLU A 128 -17.067 43.744 -66.536 1.00 68.25 O
ATOM 981 N LYS A 129 -13.832 39.532 -69.371 1.00 61.53 N
ATOM 982 CA LYS A 129 -13.248 38.267 -69.777 1.00 61.70 C
ATOM 983 C LYS A 129 -12.246 37.773 -68.731 1.00 60.89 C
ATOM 984 O LYS A 129 -12.271 36.603 -68.355 1.00 61.07 O
ATOM 985 CB LYS A 129 -12.596 38.432 -71.163 1.00 62.67 C
ATOM 986 CG LYS A 129 -12.126 37.154 -71.845 1.00 63.47 C
ATOM 987 CD LYS A 129 -10.663 36.890 -71.525 1.00 66.20 C
ATOM 988 CE LYS A 129 -10.119 35.655 -72.233 1.00 66.75 C
ATOM 989 NZ LYS A 129 -8.697 35.419 -71.841 1.00 67.40 N
ATOM 990 N GLU A 130 -11.387 38.666 -68.247 1.00 60.09 N
ATOM 991 CA GLU A 130 -10.388 38.305 -67.243 1.00 60.15 C
ATOM 992 C GLU A 130 -11.031 38.040 -65.879 1.00 59.56 C
ATOM 993 O GLU A 130 -10.475 37.335 -65.030 1.00 59.29 O
ATOM 994 CB GLU A 130 -9.359 39.423 -67.110 1.00 61.89 C
ATOM 995 CG GLU A 130 -8.590 39.693 -68.384 1.00 66.70 C
ATOM 996 CD GLU A 130 -7.830 38.473 -68.874 1.00 69.99 C
ATOM 997 OE1 GLU A 130 -6.921 37.990 -68.158 1.00 72.18 O
ATOM 998 OE2 GLU A 130 -8.143 37.989 -69.981 1.00 72.94 O
ATOM 999 N ARG A 131 -12.208 38.617 -65.680 1.00 57.89 N
ATOM 1000 CA ARG A 131 -12.964 38.468 -64.445 1.00 54.68 C
ATOM 1001 C ARG A 131 -13.240 36.985 -64.238 1.00 53.04 C
ATOM 1002 O ARG A 131 -13.213 36.497 -63.119 1.00 54.07 O
ATOM 1003 CB ARG A 131 -14.276 39.248 -64.570 1.00 55.06 C
ATOM 1004 CG ARG A 131 -15.058 39.435 -63.297 1.00 55.37 C
ATOM 1005 CD ARG A 131 -16.373 40.154 -63.593 1.00 55.76 C
ATOM 1006 NE ARG A 131 -16.176 41.511 -64.098 1.00 55.66 N
ATOM 1007 CZ ARG A 131 -15.880 42.568 -63.342 1.00 57.55 C
ATOM 1008 NH1 ARG A 131 -15.744 42.453 -62.024 1.00 57.21 N
ATOM 1009 NH2 ARG A 131 -15.708 43.754 -63.907 1.00 57.94 N
ATOM 1010 N GLY A 132 -13.491 36.271 -65.327 1.00 52.06 N
ATOM 1011 CA GLY A 132 -13.770 34.849 -65.247 1.00 51.24 C
ATOM 1012 C GLY A 132 -12.506 34.018 -65.136 1.00 51.42 C
ATOM 1013 O GLY A 132 -12.503 32.958 -64.506 1.00 52.54 O
ATOM 1014 N VAL A 133 -11.431 34.498 -65.754 1.00 50.20 N
ATOM 1015 CA VAL A 133 -10.136 33.825 -65.712 1.00 49.40 C
ATOM 1016 C VAL A 133 -9.610 33.876 -64.285 1.00 49.57 C
ATOM 1017 O VAL A 133 -9.172 32.865 -63.729 1.00 49.46 O
ATOM 1018 CB VAL A 133 -9.116 34.529 -66.632 1.00 49.53 C
ATOM 1019 CG1 VAL A 133 -7.693 34.123 -66.266 1.00 47.76 C
ATOM 1020 CG2 VAL A 133 -9.406 34.177 -68.077 1.00 48.63 C
ATOM 1021 N ILE A 134 -9.638 35.068 -63.699 1.00 49.13 N
ATOM 1022 CA ILE A 134 -9.183 35.241 -62.329 1.00 47.82 C
ATOM 1023 C ILE A 134 -9.997 34.329 -61.413 1.00 48.21 C
ATOM 1024 O ILE A 134 -9.431 33.665 -60.545 1.00 49.16 O
ATOM 1025 CB ILE A 134 -9.336 36.705 -61.863 1.00 46.10 C
ATOM 1026 CG1 ILE A 134 -8.421 37.602 -62.692 1.00 44.67 C
ATOM 1027 CG2 ILE A 134 -8.993 36.835 -60.395 1.00 43.12 C
ATOM 1028 CD1 ILE A 134 -8.649 39.071 -62.468 1.00 43.92 C
ATOM 1029 N LEU A 135 -11.311 34.270 -61.607 1.00 46.59 N
ATOM 1030 CA LEU A 135 -12.110 33.409 -60.746 1.00 47.13 C
ATOM 1031 C LEU A 135 -11.684 31.950 -60.843 1.00 47.73 C
ATOM 1032 O LEU A 135 -11.832 31.193 -59.879 1.00 49.14 O
ATOM 1033 CB LEU A 135 -13.607 33.536 -61.049 1.00 44.17 C
ATOM 1034 CG LEU A 135 -14.335 34.773 -60.516 1.00 40.79 C
ATOM 1035 CD1 LEU A 135 -15.795 34.692 -60.919 1.00 39.20 C
ATOM 1036 CD2 LEU A 135 -14.201 34.871 -59.025 1.00 36.61 C
ATOM 1037 N GLN A 136 -11.157 31.549 -61.992 1.00 48.28 N
ATOM 1038 CA GLN A 136 -10.711 30.173 -62.141 1.00 50.00 C
ATOM 1039 C GLN A 136 -9.367 30.007 -61.460 1.00 48.90 C
ATOM 1040 O GLN A 136 -9.075 28.951 -60.894 1.00 49.32 O
ATOM 1041 CB GLN A 136 -10.589 29.774 -63.617 1.00 53.41 C
ATOM 1042 CG GLN A 136 -11.906 29.445 -64.304 1.00 61.09 C
ATOM 1043 CD GLN A 136 -12.647 28.245 -63.679 1.00 67.45 C
ATOM 1044 OE1 GLN A 136 -12.222 27.087 -63.820 1.00 69.78 O
ATOM 1045 NE2 GLN A 136 -13.762 28.524 -62.983 1.00 68.01 N
ATOM 1046 N GLU A 137 -8.546 31.045 -61.504 1.00 47.67 N
ATOM 1047 CA GLU A 137 -7.242 30.955 -60.874 1.00 48.84 C
ATOM 1048 C GLU A 137 -7.356 30.881 -59.356 1.00 48.11 C
ATOM 1049 O GLU A 137 -6.468 30.358 -58.695 1.00 46.89 O
ATOM 1050 CB GLU A 137 -6.365 32.136 -61.276 1.00 50.81 C
ATOM 1051 CG GLU A 137 -6.089 32.227 -62.763 1.00 54.63 C
ATOM 1052 CD GLU A 137 -5.080 33.318 -63.094 1.00 57.51 C
ATOM 1053 OE1 GLU A 137 -5.162 34.399 -62.470 1.00 57.49 O
ATOM 1054 OE2 GLU A 137 -4.216 33.101 -63.978 1.00 59.27 O
ATOM 1055 N LEU A 138 -8.447 31.407 -58.804 1.00 48.76 N
ATOM 1056 CA LEU A 138 -8.648 31.358 -57.362 1.00 48.73 C
ATOM 1057 C LEU A 138 -8.988 29.939 -56.932 1.00 50.00 C
ATOM 1058 O LEU A 138 -8.627 29.521 -55.842 1.00 51.67 O
ATOM 1059 CB LEU A 138 -9.761 32.306 -56.918 1.00 47.36 C
ATOM 1060 CG LEU A 138 -9.482 33.811 -56.880 1.00 47.03 C
ATOM 1061 CD1 LEU A 138 -10.717 34.530 -56.395 1.00 46.24 C
ATOM 1062 CD2 LEU A 138 -8.323 34.118 -55.970 1.00 46.50 C
ATOM 1063 N LYS A 139 -9.688 29.198 -57.783 1.00 51.33 N
ATOM 1064 CA LYS A 139 -10.036 27.821 -57.467 1.00 52.43 C
ATOM 1065 C LYS A 139 -8.815 26.929 -57.655 1.00 52.73 C
ATOM 1066 O LYS A 139 -8.664 25.908 -56.982 1.00 52.16 O
ATOM 1067 CB LYS A 139 -11.176 27.348 -58.364 1.00 53.67 C
ATOM 1068 CG LYS A 139 -12.408 28.206 -58.219 1.00 58.39 C
ATOM 1069 CD LYS A 139 -13.505 27.834 -59.200 1.00 62.53 C
ATOM 1070 CE LYS A 139 -14.675 28.826 -59.114 1.00 65.23 C
ATOM 1071 NZ LYS A 139 -15.586 28.724 -60.301 1.00 67.59 N
ATOM 1072 N GLU A 140 -7.933 27.316 -58.569 1.00 53.15 N
ATOM 1073 CA GLU A 140 -6.740 26.528 -58.802 1.00 54.66 C
ATOM 1074 C GLU A 140 -5.830 26.672 -57.593 1.00 53.67 C
ATOM 1075 O GLU A 140 -5.300 25.692 -57.082 1.00 54.44 O
ATOM 1076 CB GLU A 140 -6.002 27.014 -60.049 1.00 59.11 C
ATOM 1077 CG GLU A 140 -6.776 26.913 -61.367 1.00 64.61 C
ATOM 1078 CD GLU A 140 -5.969 27.453 -62.553 1.00 67.82 C
ATOM 1079 OE1 GLU A 140 -5.473 28.601 -62.462 1.00 68.72 O
ATOM 1080 OE2 GLU A 140 -5.830 26.737 -63.574 1.00 71.02 O
ATOM 1081 N MET A 141 -5.668 27.904 -57.125 1.00 52.44 N
ATOM 1082 CA MET A 141 -4.800 28.188 -55.992 1.00 51.47 C
ATOM 1083 C MET A 141 -5.349 27.708 -54.671 1.00 51.41 C
ATOM 1084 O MET A 141 -4.606 27.560 -53.714 1.00 52.24 O
ATOM 1085 CB MET A 141 -4.528 29.686 -55.910 1.00 51.52 C
ATOM 1086 CG MET A 141 -3.919 30.244 -57.184 1.00 54.38 C
ATOM 1087 SD MET A 141 -3.858 32.046 -57.263 1.00 56.49 S
ATOM 1088 CE MET A 141 -2.151 32.288 -56.679 1.00 57.35 C
ATOM 1089 N ASP A 142 -6.651 27.463 -54.619 1.00 51.38 N
ATOM 1090 CA ASP A 142 -7.296 27.015 -53.395 1.00 50.41 C
ATOM 1091 C ASP A 142 -6.872 25.594 -53.093 1.00 50.88 C
ATOM 1092 O ASP A 142 -7.112 25.084 -52.006 1.00 50.84 O
ATOM 1093 CB ASP A 142 -8.810 27.089 -53.555 1.00 50.77 C
ATOM 1094 CG ASP A 142 -9.512 27.491 -52.279 1.00 51.90 C
ATOM 1095 OD1 ASP A 142 -8.982 28.359 -51.560 1.00 51.39 O
ATOM 1096 OD2 ASP A 142 -10.606 26.959 -52.001 1.00 54.88 O
ATOM 1097 N ASN A 143 -6.237 24.952 -54.065 1.00 51.70 N
ATOM 1098 CA ASN A 143 -5.781 23.589 -53.876 1.00 52.07 C
ATOM 1099 C ASN A 143 -4.301 23.566 -53.584 1.00 52.45 C
ATOM 1100 O ASN A 143 -3.712 22.509 -53.412 1.00 53.56 O
ATOM 1101 CB ASN A 143 -6.099 22.745 -55.106 1.00 51.81 C
ATOM 1102 CG ASN A 143 -7.593 22.641 -55.357 1.00 53.75 C
ATOM 1103 OD1 ASN A 143 -8.350 22.212 -54.487 1.00 53.27 O
ATOM 1104 ND2 ASN A 143 -8.027 23.040 -56.549 1.00 55.06 N
ATOM 1105 N ASP A 144 -3.700 24.745 -53.522 1.00 53.59 N
ATOM 1106 CA ASP A 144 -2.278 24.857 -53.234 1.00 54.31 C
ATOM 1107 C ASP A 144 -2.117 25.100 -51.733 1.00 53.30 C
ATOM 1108 O ASP A 144 -1.979 26.242 -51.291 1.00 52.71 O
ATOM 1109 CB ASP A 144 -1.676 26.021 -54.019 1.00 57.94 C
ATOM 1110 CG ASP A 144 -0.160 26.078 -53.914 1.00 62.32 C
ATOM 1111 OD1 ASP A 144 0.392 25.617 -52.888 1.00 65.40 O
ATOM 1112 OD2 ASP A 144 0.482 26.601 -54.854 1.00 64.02 O
ATOM 1113 N MET A 145 -2.146 24.016 -50.961 1.00 52.56 N
ATOM 1114 CA MET A 145 -2.024 24.065 -49.507 1.00 51.44 C
ATOM 1115 C MET A 145 -0.979 25.045 -49.019 1.00 50.36 C
ATOM 1116 O MET A 145 -1.237 25.865 -48.135 1.00 49.35 O
ATOM 1117 CB MET A 145 -1.647 22.695 -48.969 1.00 54.29 C
ATOM 1118 CG MET A 145 -2.526 21.568 -49.422 1.00 59.00 C
ATOM 1119 SD MET A 145 -4.050 21.583 -48.555 1.00 67.00 S
ATOM 1120 CE MET A 145 -5.031 22.847 -49.566 1.00 62.34 C
ATOM 1121 N THR A 146 0.219 24.941 -49.578 1.00 49.26 N
ATOM 1122 CA THR A 146 1.300 25.818 -49.164 1.00 49.16 C
ATOM 1123 C THR A 146 0.912 27.287 -49.250 1.00 48.51 C
ATOM 1124 O THR A 146 1.216 28.071 -48.346 1.00 48.78 O
ATOM 1125 CB THR A 146 2.569 25.587 -49.995 1.00 48.87 C
ATOM 1126 OG1 THR A 146 2.996 24.228 -49.843 1.00 50.20 O
ATOM 1127 CG2 THR A 146 3.681 26.503 -49.512 1.00 47.77 C
ATOM 1128 N ASN A 147 0.230 27.663 -50.324 1.00 46.48 N
ATOM 1129 CA ASN A 147 -0.178 29.042 -50.465 1.00 46.04 C
ATOM 1130 C ASN A 147 -1.418 29.389 -49.671 1.00 43.22 C
ATOM 1131 O ASN A 147 -1.577 30.526 -49.237 1.00 43.63 O
ATOM 1132 CB ASN A 147 -0.316 29.395 -51.940 1.00 51.25 C
ATOM 1133 CG ASN A 147 1.059 29.499 -52.622 1.00 57.23 C
ATOM 1134 OD1 ASN A 147 1.973 30.189 -52.111 1.00 56.36 O
ATOM 1135 ND2 ASN A 147 1.223 28.809 -53.763 1.00 58.02 N
ATOM 1136 N VAL A 148 -2.288 28.410 -49.459 1.00 40.65 N
ATOM 1137 CA VAL A 148 -3.483 28.626 -48.649 1.00 37.21 C
ATOM 1138 C VAL A 148 -2.977 28.858 -47.224 1.00 37.07 C
ATOM 1139 O VAL A 148 -3.484 29.715 -46.493 1.00 35.79 O
ATOM 1140 CB VAL A 148 -4.397 27.380 -48.639 1.00 34.70 C
ATOM 1141 CG1 VAL A 148 -5.584 27.610 -47.728 1.00 33.33 C
ATOM 1142 CG2 VAL A 148 -4.863 27.075 -50.032 1.00 33.05 C
ATOM 1143 N THR A 149 -1.961 28.084 -46.848 1.00 36.82 N
ATOM 1144 CA THR A 149 -1.383 28.172 -45.521 1.00 37.72 C
ATOM 1145 C THR A 149 -0.677 29.497 -45.281 1.00 38.44 C
ATOM 1146 O THR A 149 -0.797 30.077 -44.194 1.00 39.09 O
ATOM 1147 CB THR A 149 -0.413 27.016 -45.256 1.00 38.57 C
ATOM 1148 OG1 THR A 149 -1.136 25.779 -45.240 1.00 39.36 O
ATOM 1149 CG2 THR A 149 0.264 27.197 -43.914 1.00 38.06 C
ATOM 1150 N PHE A 150 0.054 29.997 -46.273 1.00 38.21 N
ATOM 1151 CA PHE A 150 0.711 31.275 -46.067 1.00 36.45 C
ATOM 1152 C PHE A 150 -0.288 32.420 -46.049 1.00 35.19 C
ATOM 1153 O PHE A 150 -0.111 33.394 -45.297 1.00 32.87 O
ATOM 1154 CB PHE A 150 1.791 31.501 -47.096 1.00 35.75 C
ATOM 1155 CG PHE A 150 3.065 30.816 -46.753 1.00 39.63 C
ATOM 1156 CD1 PHE A 150 3.341 29.538 -47.244 1.00 40.14 C
ATOM 1157 CD2 PHE A 150 3.981 31.421 -45.890 1.00 40.01 C
ATOM 1158 CE1 PHE A 150 4.511 28.862 -46.884 1.00 40.65 C
ATOM 1159 CE2 PHE A 150 5.159 30.755 -45.522 1.00 41.82 C
ATOM 1160 CZ PHE A 150 5.423 29.470 -46.021 1.00 41.41 C
ATOM 1161 N ASP A 151 -1.346 32.300 -46.846 1.00 34.02 N
ATOM 1162 CA ASP A 151 -2.369 33.336 -46.851 1.00 36.17 C
ATOM 1163 C ASP A 151 -2.978 33.395 -45.455 1.00 36.66 C
ATOM 1164 O ASP A 151 -3.066 34.474 -44.845 1.00 37.21 O
ATOM 1165 CB ASP A 151 -3.452 33.050 -47.901 1.00 37.55 C
ATOM 1166 CG ASP A 151 -3.040 33.511 -49.314 1.00 41.48 C
ATOM 1167 OD1 ASP A 151 -2.203 34.439 -49.418 1.00 41.65 O
ATOM 1168 OD2 ASP A 151 -3.557 32.968 -50.322 1.00 42.53 O
ATOM 1169 N TYR A 152 -3.366 32.226 -44.939 1.00 35.74 N
ATOM 1170 CA TYR A 152 -3.943 32.139 -43.605 1.00 31.87 C
ATOM 1171 C TYR A 152 -2.970 32.669 -42.583 1.00 32.52 C
ATOM 1172 O TYR A 152 -3.377 33.375 -41.660 1.00 33.42 O
ATOM 1173 CB TYR A 152 -4.316 30.701 -43.288 1.00 29.56 C
ATOM 1174 CG TYR A 152 -5.599 30.256 -43.953 1.00 27.34 C
ATOM 1175 CD1 TYR A 152 -5.950 28.913 -44.001 1.00 25.51 C
ATOM 1176 CD2 TYR A 152 -6.483 31.187 -44.494 1.00 26.35 C
ATOM 1177 CE1 TYR A 152 -7.149 28.507 -44.569 1.00 27.64 C
ATOM 1178 CE2 TYR A 152 -7.689 30.799 -45.065 1.00 26.31 C
ATOM 1179 CZ TYR A 152 -8.017 29.458 -45.100 1.00 28.64 C
ATOM 1180 OH TYR A 152 -9.207 29.073 -45.666 1.00 29.21 O
ATOM 1181 N LEU A 153 -1.682 32.358 -42.745 1.00 33.20 N
ATOM 1182 CA LEU A 153 -0.677 32.848 -41.796 1.00 32.93 C
ATOM 1183 C LEU A 153 -0.731 34.383 -41.716 1.00 35.14 C
ATOM 1184 O LEU A 153 -0.661 34.959 -40.633 1.00 35.05 O
ATOM 1185 CB LEU A 153 0.720 32.393 -42.203 1.00 30.55 C
ATOM 1186 CG LEU A 153 1.823 32.818 -41.227 1.00 31.92 C
ATOM 1187 CD1 LEU A 153 1.551 32.235 -39.863 1.00 32.83 C
ATOM 1188 CD2 LEU A 153 3.176 32.353 -41.723 1.00 32.20 C
ATOM 1189 N HIS A 154 -0.858 35.045 -42.866 1.00 35.74 N
ATOM 1190 CA HIS A 154 -0.952 36.499 -42.889 1.00 35.69 C
ATOM 1191 C HIS A 154 -2.340 36.928 -42.393 1.00 35.01 C
ATOM 1192 O HIS A 154 -2.491 37.935 -41.693 1.00 36.16 O
ATOM 1193 CB HIS A 154 -0.788 37.050 -44.309 1.00 39.04 C
ATOM 1194 CG HIS A 154 0.617 37.063 -44.815 1.00 41.99 C
ATOM 1195 ND1 HIS A 154 1.247 35.939 -45.304 1.00 44.43 N
ATOM 1196 CD2 HIS A 154 1.503 38.079 -44.949 1.00 45.16 C
ATOM 1197 CE1 HIS A 154 2.461 36.261 -45.718 1.00 45.45 C
ATOM 1198 NE2 HIS A 154 2.641 37.554 -45.515 1.00 46.14 N
ATOM 1199 N ALA A 155 -3.360 36.177 -42.781 1.00 31.65 N
ATOM 1200 CA ALA A 155 -4.702 36.520 -42.374 1.00 30.23 C
ATOM 1201 C ALA A 155 -4.844 36.657 -40.844 1.00 31.58 C
ATOM 1202 O ALA A 155 -5.594 37.527 -40.360 1.00 32.94 O
ATOM 1203 CB ALA A 155 -5.686 35.492 -42.926 1.00 26.19 C
ATOM 1204 N THR A 156 -4.119 35.834 -40.086 1.00 29.83 N
ATOM 1205 CA THR A 156 -4.214 35.887 -38.630 1.00 30.34 C
ATOM 1206 C THR A 156 -3.076 36.686 -37.979 1.00 30.91 C
ATOM 1207 O THR A 156 -3.311 37.457 -37.033 1.00 30.46 O
ATOM 1208 CB THR A 156 -4.258 34.428 -37.998 1.00 31.89 C
ATOM 1209 OG1 THR A 156 -4.724 34.494 -36.636 1.00 30.58 O
ATOM 1210 CG2 THR A 156 -2.855 33.766 -38.006 1.00 26.57 C
ATOM 1211 N ALA A 157 -1.852 36.494 -38.468 1.00 30.57 N
ATOM 1212 CA ALA A 157 -0.690 37.193 -37.930 1.00 31.59 C
ATOM 1213 C ALA A 157 -0.881 38.706 -38.011 1.00 34.23 C
ATOM 1214 O ALA A 157 -0.416 39.449 -37.139 1.00 34.98 O
ATOM 1215 CB ALA A 157 0.539 36.801 -38.690 1.00 31.65 C
ATOM 1216 N PHE A 158 -1.562 39.155 -39.065 1.00 34.78 N
ATOM 1217 CA PHE A 158 -1.828 40.570 -39.272 1.00 36.17 C
ATOM 1218 C PHE A 158 -3.323 40.837 -39.345 1.00 37.75 C
ATOM 1219 O PHE A 158 -3.758 41.731 -40.071 1.00 39.35 O
ATOM 1220 CB PHE A 158 -1.168 41.059 -40.576 1.00 35.11 C
ATOM 1221 CG PHE A 158 0.328 40.917 -40.592 1.00 33.39 C
ATOM 1222 CD1 PHE A 158 0.945 40.079 -41.507 1.00 33.85 C
ATOM 1223 CD2 PHE A 158 1.118 41.590 -39.666 1.00 33.33 C
ATOM 1224 CE1 PHE A 158 2.326 39.905 -41.504 1.00 31.46 C
ATOM 1225 CE2 PHE A 158 2.499 41.423 -39.654 1.00 30.98 C
ATOM 1226 CZ PHE A 158 3.102 40.578 -40.576 1.00 31.56 C
ATOM 1227 N GLN A 159 -4.114 40.067 -38.600 1.00 38.93 N
ATOM 1228 CA GLN A 159 -5.571 40.241 -38.606 1.00 38.83 C
ATOM 1229 C GLN A 159 -5.956 41.685 -38.297 1.00 39.31 C
ATOM 1230 O GLN A 159 -5.289 42.376 -37.530 1.00 40.48 O
ATOM 1231 CB GLN A 159 -6.228 39.324 -37.578 1.00 37.52 C
ATOM 1232 CG GLN A 159 -5.698 39.549 -36.175 1.00 38.04 C
ATOM 1233 CD GLN A 159 -6.312 38.638 -35.145 1.00 35.42 C
ATOM 1234 OE1 GLN A 159 -7.262 39.007 -34.458 1.00 34.02 O
ATOM 1235 NE2 GLN A 159 -5.770 37.435 -35.037 1.00 34.54 N
ATOM 1236 N GLY A 160 -7.037 42.140 -38.907 1.00 39.66 N
ATOM 1237 CA GLY A 160 -7.473 43.495 -38.669 1.00 39.15 C
ATOM 1238 C GLY A 160 -6.748 44.539 -39.494 1.00 38.92 C
ATOM 1239 O GLY A 160 -7.215 45.666 -39.603 1.00 40.49 O
ATOM 1240 N THR A 161 -5.610 44.178 -40.076 1.00 39.04 N
ATOM 1241 CA THR A 161 -4.847 45.130 -40.865 1.00 37.67 C
ATOM 1242 C THR A 161 -4.830 44.815 -42.349 1.00 39.15 C
ATOM 1243 O THR A 161 -5.568 43.949 -42.825 1.00 38.10 O
ATOM 1244 CB THR A 161 -3.403 45.215 -40.400 1.00 35.82 C
ATOM 1245 OG1 THR A 161 -2.688 44.095 -40.916 1.00 35.81 O
ATOM 1246 CG2 THR A 161 -3.326 45.215 -38.888 1.00 35.65 C
ATOM 1247 N ALA A 162 -3.962 45.529 -43.073 1.00 42.15 N
ATOM 1248 CA ALA A 162 -3.838 45.408 -44.533 1.00 40.82 C
ATOM 1249 C ALA A 162 -3.051 44.208 -45.012 1.00 37.89 C
ATOM 1250 O ALA A 162 -3.348 43.664 -46.073 1.00 38.06 O
ATOM 1251 CB ALA A 162 -3.233 46.691 -45.117 1.00 41.26 C
ATOM 1252 N LEU A 163 -2.043 43.800 -44.257 1.00 34.66 N
ATOM 1253 CA LEU A 163 -1.273 42.645 -44.676 1.00 35.07 C
ATOM 1254 C LEU A 163 -2.072 41.354 -44.499 1.00 35.27 C
ATOM 1255 O LEU A 163 -1.647 40.282 -44.916 1.00 35.48 O
ATOM 1256 CB LEU A 163 0.027 42.574 -43.890 1.00 35.47 C
ATOM 1257 CG LEU A 163 1.053 43.620 -44.310 1.00 34.27 C
ATOM 1258 CD1 LEU A 163 2.227 43.659 -43.327 1.00 30.86 C
ATOM 1259 CD2 LEU A 163 1.511 43.274 -45.726 1.00 34.10 C
ATOM 1260 N ALA A 164 -3.243 41.464 -43.885 1.00 35.68 N
ATOM 1261 CA ALA A 164 -4.093 40.307 -43.657 1.00 35.91 C
ATOM 1262 C ALA A 164 -4.709 39.851 -44.975 1.00 38.08 C
ATOM 1263 O ALA A 164 -4.944 38.664 -45.186 1.00 40.68 O
ATOM 1264 CB ALA A 164 -5.182 40.658 -42.653 1.00 33.00 C
ATOM 1265 N ARG A 165 -4.957 40.799 -45.873 1.00 39.49 N
ATOM 1266 CA ARG A 165 -5.542 40.490 -47.168 1.00 40.45 C
ATOM 1267 C ARG A 165 -4.591 39.698 -48.065 1.00 42.66 C
ATOM 1268 O ARG A 165 -3.363 39.771 -47.919 1.00 45.40 O
ATOM 1269 CB ARG A 165 -5.953 41.781 -47.881 1.00 40.99 C
ATOM 1270 CG ARG A 165 -6.837 42.682 -47.062 1.00 42.69 C
ATOM 1271 CD ARG A 165 -7.818 43.475 -47.935 1.00 46.08 C
ATOM 1272 NE ARG A 165 -8.725 44.275 -47.112 1.00 46.99 N
ATOM 1273 CZ ARG A 165 -8.344 45.334 -46.398 1.00 48.54 C
ATOM 1274 NH1 ARG A 165 -7.070 45.736 -46.410 1.00 46.51 N
ATOM 1275 NH2 ARG A 165 -9.236 45.971 -45.646 1.00 49.02 N
ATOM 1276 N THR A 166 -5.169 38.942 -48.993 1.00 43.42 N
ATOM 1277 CA THR A 166 -4.402 38.148 -49.935 1.00 44.95 C
ATOM 1278 C THR A 166 -4.101 39.014 -51.160 1.00 47.77 C
ATOM 1279 O THR A 166 -4.752 40.047 -51.388 1.00 50.07 O
ATOM 1280 CB THR A 166 -5.208 36.935 -50.397 1.00 45.56 C
ATOM 1281 OG1 THR A 166 -6.371 37.386 -51.102 1.00 46.82 O
ATOM 1282 CG2 THR A 166 -5.643 36.087 -49.198 1.00 44.95 C
ATOM 1283 N VAL A 167 -3.123 38.603 -51.961 1.00 48.51 N
ATOM 1284 CA VAL A 167 -2.782 39.367 -53.154 1.00 47.02 C
ATOM 1285 C VAL A 167 -3.863 39.295 -54.223 1.00 46.33 C
ATOM 1286 O VAL A 167 -4.213 40.295 -54.819 1.00 47.17 O
ATOM 1287 CB VAL A 167 -1.456 38.884 -53.768 1.00 46.58 C
ATOM 1288 CG1 VAL A 167 -1.237 39.566 -55.112 1.00 47.01 C
ATOM 1289 CG2 VAL A 167 -0.309 39.206 -52.830 1.00 44.12 C
ATOM 1290 N GLU A 168 -4.397 38.109 -54.464 1.00 47.36 N
ATOM 1291 CA GLU A 168 -5.415 37.946 -55.490 1.00 48.37 C
ATOM 1292 C GLU A 168 -6.736 38.657 -55.197 1.00 49.85 C
ATOM 1293 O GLU A 168 -7.477 38.987 -56.127 1.00 50.77 O
ATOM 1294 CB GLU A 168 -5.691 36.466 -55.730 1.00 48.54 C
ATOM 1295 CG GLU A 168 -4.481 35.636 -56.138 1.00 49.85 C
ATOM 1296 CD GLU A 168 -3.437 35.539 -55.051 1.00 50.18 C
ATOM 1297 OE1 GLU A 168 -3.819 35.281 -53.895 1.00 54.01 O
ATOM 1298 OE2 GLU A 168 -2.235 35.707 -55.349 1.00 51.29 O
ATOM 1299 N GLY A 169 -7.050 38.880 -53.923 1.00 49.27 N
ATOM 1300 CA GLY A 169 -8.299 39.553 -53.605 1.00 49.89 C
ATOM 1301 C GLY A 169 -9.479 38.644 -53.287 1.00 50.93 C
ATOM 1302 O GLY A 169 -9.364 37.429 -53.324 1.00 51.92 O
ATOM 1303 N THR A 170 -10.623 39.248 -52.989 1.00 52.36 N
ATOM 1304 CA THR A 170 -11.843 38.532 -52.629 1.00 52.72 C
ATOM 1305 C THR A 170 -12.680 38.135 -53.824 1.00 52.43 C
ATOM 1306 O THR A 170 -12.483 38.639 -54.921 1.00 54.15 O
ATOM 1307 CB THR A 170 -12.725 39.412 -51.738 1.00 54.11 C
ATOM 1308 OG1 THR A 170 -11.956 39.873 -50.624 1.00 55.07 O
ATOM 1309 CG2 THR A 170 -13.921 38.636 -51.231 1.00 56.33 C
ATOM 1310 N THR A 171 -13.632 37.232 -53.606 1.00 52.03 N
ATOM 1311 CA THR A 171 -14.527 36.800 -54.673 1.00 50.78 C
ATOM 1312 C THR A 171 -15.498 37.933 -54.996 1.00 50.68 C
ATOM 1313 O THR A 171 -15.831 38.150 -56.151 1.00 50.00 O
ATOM 1314 CB THR A 171 -15.335 35.534 -54.273 1.00 49.74 C
ATOM 1315 OG1 THR A 171 -14.482 34.388 -54.307 1.00 47.47 O
ATOM 1316 CG2 THR A 171 -16.496 35.307 -55.224 1.00 48.02 C
ATOM 1317 N GLU A 172 -15.952 38.655 -53.976 1.00 51.89 N
ATOM 1318 CA GLU A 172 -16.876 39.763 -54.199 1.00 54.06 C
ATOM 1319 C GLU A 172 -16.243 40.913 -54.967 1.00 54.11 C
ATOM 1320 O GLU A 172 -16.892 41.545 -55.804 1.00 54.59 O
ATOM 1321 CB GLU A 172 -17.439 40.282 -52.875 1.00 55.66 C
ATOM 1322 CG GLU A 172 -18.578 39.433 -52.366 1.00 60.10 C
ATOM 1323 CD GLU A 172 -19.660 39.224 -53.426 1.00 62.93 C
ATOM 1324 OE1 GLU A 172 -20.370 40.208 -53.750 1.00 63.58 O
ATOM 1325 OE2 GLU A 172 -19.793 38.083 -53.940 1.00 63.32 O
ATOM 1326 N ASN A 173 -14.980 41.189 -54.670 1.00 54.07 N
ATOM 1327 CA ASN A 173 -14.262 42.245 -55.358 1.00 54.44 C
ATOM 1328 C ASN A 173 -14.096 41.875 -56.834 1.00 54.50 C
ATOM 1329 O ASN A 173 -14.444 42.638 -57.731 1.00 55.16 O
ATOM 1330 CB ASN A 173 -12.899 42.456 -54.701 1.00 54.13 C
ATOM 1331 CG ASN A 173 -12.990 43.301 -53.448 1.00 54.94 C
ATOM 1332 OD1 ASN A 173 -14.082 43.559 -52.942 1.00 54.06 O
ATOM 1333 ND2 ASN A 173 -11.843 43.738 -52.938 1.00 54.62 N
ATOM 1334 N ILE A 174 -13.578 40.686 -57.083 1.00 54.13 N
ATOM 1335 CA ILE A 174 -13.375 40.241 -58.442 1.00 54.15 C
ATOM 1336 C ILE A 174 -14.670 40.225 -59.231 1.00 54.24 C
ATOM 1337 O ILE A 174 -14.665 40.427 -60.435 1.00 55.75 O
ATOM 1338 CB ILE A 174 -12.721 38.850 -58.441 1.00 53.75 C
ATOM 1339 CG1 ILE A 174 -11.291 39.002 -57.930 1.00 55.07 C
ATOM 1340 CG2 ILE A 174 -12.756 38.224 -59.839 1.00 50.66 C
ATOM 1341 CD1 ILE A 174 -10.614 37.703 -57.642 1.00 59.69 C
ATOM 1342 N LYS A 175 -15.785 39.998 -58.555 1.00 54.73 N
ATOM 1343 CA LYS A 175 -17.070 39.952 -59.237 1.00 56.00 C
ATOM 1344 C LYS A 175 -17.644 41.333 -59.503 1.00 57.50 C
ATOM 1345 O LYS A 175 -18.553 41.477 -60.326 1.00 57.84 O
ATOM 1346 CB LYS A 175 -18.084 39.175 -58.411 1.00 55.95 C
ATOM 1347 CG LYS A 175 -17.838 37.687 -58.317 1.00 57.22 C
ATOM 1348 CD LYS A 175 -18.863 37.049 -57.389 1.00 58.30 C
ATOM 1349 CE LYS A 175 -20.283 37.397 -57.820 1.00 59.81 C
ATOM 1350 NZ LYS A 175 -21.315 36.801 -56.944 1.00 61.11 N
ATOM 1351 N HIS A 176 -17.113 42.344 -58.815 1.00 57.77 N
ATOM 1352 CA HIS A 176 -17.627 43.696 -58.959 1.00 58.02 C
ATOM 1353 C HIS A 176 -16.619 44.815 -59.188 1.00 58.38 C
ATOM 1354 O HIS A 176 -16.978 45.987 -59.102 1.00 58.27 O
ATOM 1355 CB HIS A 176 -18.480 44.030 -57.736 1.00 59.74 C
ATOM 1356 CG HIS A 176 -19.614 43.076 -57.521 1.00 62.98 C
ATOM 1357 ND1 HIS A 176 -20.680 42.976 -58.391 1.00 64.18 N
ATOM 1358 CD2 HIS A 176 -19.814 42.130 -56.574 1.00 64.15 C
ATOM 1359 CE1 HIS A 176 -21.487 42.006 -57.994 1.00 63.89 C
ATOM 1360 NE2 HIS A 176 -20.984 41.477 -56.893 1.00 65.81 N
ATOM 1361 N LEU A 177 -15.363 44.488 -59.479 1.00 58.58 N
ATOM 1362 CA LEU A 177 -14.390 45.553 -59.713 1.00 57.93 C
ATOM 1363 C LEU A 177 -14.703 46.234 -61.038 1.00 59.79 C
ATOM 1364 O LEU A 177 -14.908 45.580 -62.060 1.00 60.01 O
ATOM 1365 CB LEU A 177 -12.962 45.010 -59.695 1.00 54.89 C
ATOM 1366 CG LEU A 177 -12.361 44.957 -58.288 1.00 51.91 C
ATOM 1367 CD1 LEU A 177 -11.032 44.231 -58.290 1.00 50.84 C
ATOM 1368 CD2 LEU A 177 -12.193 46.375 -57.780 1.00 50.69 C
ATOM 1369 N THR A 178 -14.753 47.559 -60.998 1.00 61.75 N
ATOM 1370 CA THR A 178 -15.082 48.372 -62.160 1.00 62.55 C
ATOM 1371 C THR A 178 -13.909 48.877 -62.984 1.00 63.35 C
ATOM 1372 O THR A 178 -12.807 49.091 -62.479 1.00 63.48 O
ATOM 1373 CB THR A 178 -15.936 49.574 -61.722 1.00 61.89 C
ATOM 1374 OG1 THR A 178 -17.287 49.142 -61.529 1.00 63.40 O
ATOM 1375 CG2 THR A 178 -15.889 50.693 -62.748 1.00 64.69 C
ATOM 1376 N ARG A 179 -14.175 49.072 -64.270 1.00 64.48 N
ATOM 1377 CA ARG A 179 -13.184 49.572 -65.204 1.00 65.19 C
ATOM 1378 C ARG A 179 -12.581 50.828 -64.591 1.00 65.14 C
ATOM 1379 O ARG A 179 -11.392 51.108 -64.745 1.00 64.67 O
ATOM 1380 CB ARG A 179 -13.869 49.881 -66.536 1.00 66.19 C
ATOM 1381 CG ARG A 179 -12.938 50.082 -67.709 1.00 69.04 C
ATOM 1382 CD ARG A 179 -12.451 51.503 -67.784 1.00 72.43 C
ATOM 1383 NE ARG A 179 -11.434 51.668 -68.816 1.00 75.93 N
ATOM 1384 CZ ARG A 179 -10.826 52.821 -69.089 1.00 77.58 C
ATOM 1385 NH1 ARG A 179 -11.141 53.918 -68.403 1.00 77.40 N
ATOM 1386 NH2 ARG A 179 -9.893 52.873 -70.035 1.00 77.25 N
ATOM 1387 N ALA A 180 -13.411 51.565 -63.861 1.00 65.78 N
ATOM 1388 CA ALA A 180 -12.979 52.798 -63.204 1.00 66.36 C
ATOM 1389 C ALA A 180 -12.061 52.529 -62.015 1.00 66.06 C
ATOM 1390 O ALA A 180 -11.132 53.297 -61.757 1.00 66.11 O
ATOM 1391 CB ALA A 180 -14.200 53.597 -62.748 1.00 65.97 C
ATOM 1392 N ASP A 181 -12.332 51.439 -61.298 1.00 65.38 N
ATOM 1393 CA ASP A 181 -11.549 51.050 -60.126 1.00 63.79 C
ATOM 1394 C ASP A 181 -10.136 50.683 -60.538 1.00 62.46 C
ATOM 1395 O ASP A 181 -9.164 51.109 -59.910 1.00 61.20 O
ATOM 1396 CB ASP A 181 -12.198 49.853 -59.431 1.00 64.69 C
ATOM 1397 CG ASP A 181 -13.646 50.103 -59.073 1.00 67.38 C
ATOM 1398 OD1 ASP A 181 -14.364 50.711 -59.895 1.00 71.08 O
ATOM 1399 OD2 ASP A 181 -14.082 49.685 -57.983 1.00 67.79 O
ATOM 1400 N LEU A 182 -10.023 49.889 -61.598 1.00 61.50 N
ATOM 1401 CA LEU A 182 -8.715 49.469 -62.082 1.00 61.64 C
ATOM 1402 C LEU A 182 -7.964 50.713 -62.532 1.00 61.69 C
ATOM 1403 O LEU A 182 -6.773 50.887 -62.240 1.00 61.33 O
ATOM 1404 CB LEU A 182 -8.870 48.501 -63.252 1.00 61.17 C
ATOM 1405 CG LEU A 182 -9.882 47.379 -63.024 1.00 60.59 C
ATOM 1406 CD1 LEU A 182 -9.984 46.545 -64.271 1.00 59.78 C
ATOM 1407 CD2 LEU A 182 -9.468 46.519 -61.842 1.00 61.70 C
ATOM 1408 N ALA A 183 -8.686 51.582 -63.237 1.00 60.19 N
ATOM 1409 CA ALA A 183 -8.122 52.831 -63.731 1.00 59.19 C
ATOM 1410 C ALA A 183 -7.619 53.650 -62.557 1.00 58.00 C
ATOM 1411 O ALA A 183 -6.491 54.142 -62.560 1.00 58.20 O
ATOM 1412 CB ALA A 183 -9.178 53.613 -64.484 1.00 60.24 C
ATOM 1413 N SER A 184 -8.473 53.793 -61.550 1.00 55.97 N
ATOM 1414 CA SER A 184 -8.120 54.544 -60.360 1.00 53.88 C
ATOM 1415 C SER A 184 -6.882 53.935 -59.724 1.00 52.65 C
ATOM 1416 O SER A 184 -5.960 54.650 -59.326 1.00 51.35 O
ATOM 1417 CB SER A 184 -9.280 54.530 -59.364 1.00 53.78 C
ATOM 1418 OG SER A 184 -8.897 55.118 -58.130 1.00 54.97 O
ATOM 1419 N TYR A 185 -6.857 52.609 -59.643 1.00 52.11 N
ATOM 1420 CA TYR A 185 -5.727 51.926 -59.047 1.00 52.04 C
ATOM 1421 C TYR A 185 -4.453 52.358 -59.738 1.00 52.74 C
ATOM 1422 O TYR A 185 -3.514 52.840 -59.097 1.00 51.37 O
ATOM 1423 CB TYR A 185 -5.874 50.407 -59.172 1.00 52.02 C
ATOM 1424 CG TYR A 185 -4.710 49.651 -58.548 1.00 51.79 C
ATOM 1425 CD1 TYR A 185 -4.658 49.393 -57.168 1.00 49.55 C
ATOM 1426 CD2 TYR A 185 -3.622 49.259 -59.328 1.00 50.85 C
ATOM 1427 CE1 TYR A 185 -3.542 48.767 -56.589 1.00 49.03 C
ATOM 1428 CE2 TYR A 185 -2.501 48.635 -58.755 1.00 49.93 C
ATOM 1429 CZ TYR A 185 -2.463 48.389 -57.397 1.00 49.24 C
ATOM 1430 OH TYR A 185 -1.355 47.743 -56.871 1.00 48.19 O
ATOM 1431 N ILE A 186 -4.439 52.195 -61.057 1.00 54.09 N
ATOM 1432 CA ILE A 186 -3.272 52.529 -61.857 1.00 55.10 C
ATOM 1433 C ILE A 186 -2.778 53.947 -61.666 1.00 56.62 C
ATOM 1434 O ILE A 186 -1.582 54.171 -61.474 1.00 55.94 O
ATOM 1435 CB ILE A 186 -3.533 52.305 -63.353 1.00 53.30 C
ATOM 1436 CG1 ILE A 186 -3.948 50.852 -63.594 1.00 51.62 C
ATOM 1437 CG2 ILE A 186 -2.271 52.605 -64.137 1.00 53.84 C
ATOM 1438 CD1 ILE A 186 -4.161 50.495 -65.037 1.00 47.67 C
ATOM 1439 N ASP A 187 -3.695 54.903 -61.711 1.00 59.73 N
ATOM 1440 CA ASP A 187 -3.321 56.306 -61.565 1.00 63.92 C
ATOM 1441 C ASP A 187 -2.823 56.614 -60.172 1.00 64.23 C
ATOM 1442 O ASP A 187 -1.901 57.416 -59.986 1.00 64.58 O
ATOM 1443 CB ASP A 187 -4.505 57.231 -61.876 1.00 68.03 C
ATOM 1444 CG ASP A 187 -5.073 57.011 -63.272 1.00 72.98 C
ATOM 1445 OD1 ASP A 187 -4.280 56.976 -64.251 1.00 74.34 O
ATOM 1446 OD2 ASP A 187 -6.316 56.878 -63.384 1.00 75.10 O
ATOM 1447 N THR A 188 -3.435 55.967 -59.191 1.00 63.18 N
ATOM 1448 CA THR A 188 -3.068 56.203 -57.811 1.00 61.70 C
ATOM 1449 C THR A 188 -1.711 55.636 -57.435 1.00 61.11 C
ATOM 1450 O THR A 188 -0.951 56.266 -56.709 1.00 60.50 O
ATOM 1451 CB THR A 188 -4.091 55.590 -56.876 1.00 61.39 C
ATOM 1452 OG1 THR A 188 -5.410 55.843 -57.374 1.00 62.77 O
ATOM 1453 CG2 THR A 188 -3.944 56.182 -55.497 1.00 60.61 C
ATOM 1454 N HIS A 189 -1.396 54.455 -57.955 1.00 61.39 N
ATOM 1455 CA HIS A 189 -0.153 53.788 -57.589 1.00 61.72 C
ATOM 1456 C HIS A 189 0.993 53.726 -58.580 1.00 62.54 C
ATOM 1457 O HIS A 189 2.140 53.885 -58.196 1.00 61.73 O
ATOM 1458 CB HIS A 189 -0.483 52.378 -57.102 1.00 60.36 C
ATOM 1459 CG HIS A 189 -1.476 52.360 -55.982 1.00 58.65 C
ATOM 1460 ND1 HIS A 189 -1.234 52.962 -54.767 1.00 57.84 N
ATOM 1461 CD2 HIS A 189 -2.731 51.861 -55.910 1.00 59.22 C
ATOM 1462 CE1 HIS A 189 -2.296 52.836 -53.995 1.00 57.93 C
ATOM 1463 NE2 HIS A 189 -3.219 52.172 -54.664 1.00 58.79 N
ATOM 1464 N PHE A 190 0.708 53.478 -59.849 1.00 65.60 N
ATOM 1465 CA PHE A 190 1.784 53.420 -60.831 1.00 66.94 C
ATOM 1466 C PHE A 190 2.291 54.837 -61.085 1.00 67.93 C
ATOM 1467 O PHE A 190 1.940 55.460 -62.087 1.00 67.52 O
ATOM 1468 CB PHE A 190 1.276 52.780 -62.123 1.00 66.69 C
ATOM 1469 CG PHE A 190 0.933 51.319 -61.983 1.00 67.79 C
ATOM 1470 CD1 PHE A 190 0.448 50.598 -63.069 1.00 67.94 C
ATOM 1471 CD2 PHE A 190 1.113 50.653 -60.768 1.00 68.17 C
ATOM 1472 CE1 PHE A 190 0.150 49.234 -62.949 1.00 68.07 C
ATOM 1473 CE2 PHE A 190 0.818 49.293 -60.641 1.00 67.14 C
ATOM 1474 CZ PHE A 190 0.336 48.583 -61.733 1.00 66.48 C
ATOM 1475 N LYS A 191 3.112 55.338 -60.164 1.00 69.36 N
ATOM 1476 CA LYS A 191 3.656 56.688 -60.264 1.00 71.09 C
ATOM 1477 C LYS A 191 5.179 56.780 -60.160 1.00 71.00 C
ATOM 1478 O LYS A 191 5.804 56.188 -59.278 1.00 70.48 O
ATOM 1479 CB LYS A 191 3.008 57.592 -59.210 1.00 73.93 C
ATOM 1480 CG LYS A 191 1.525 57.866 -59.466 1.00 77.94 C
ATOM 1481 CD LYS A 191 1.068 59.171 -58.806 1.00 80.87 C
ATOM 1482 CE LYS A 191 -0.308 59.608 -59.315 1.00 82.85 C
ATOM 1483 NZ LYS A 191 -0.723 60.948 -58.799 1.00 83.25 N
ATOM 1484 N ALA A 192 5.753 57.553 -61.076 1.00 70.83 N
ATOM 1485 CA ALA A 192 7.192 57.765 -61.184 1.00 70.77 C
ATOM 1486 C ALA A 192 8.037 57.636 -59.912 1.00 70.38 C
ATOM 1487 O ALA A 192 8.928 56.792 -59.846 1.00 69.88 O
ATOM 1488 CB ALA A 192 7.456 59.117 -61.849 1.00 70.33 C
ATOM 1489 N PRO A 193 7.783 58.474 -58.891 1.00 70.79 N
ATOM 1490 CA PRO A 193 8.583 58.374 -57.664 1.00 70.98 C
ATOM 1491 C PRO A 193 8.502 57.019 -56.943 1.00 70.89 C
ATOM 1492 O PRO A 193 9.390 56.668 -56.153 1.00 70.70 O
ATOM 1493 CB PRO A 193 8.065 59.539 -56.821 1.00 70.89 C
ATOM 1494 CG PRO A 193 6.641 59.664 -57.252 1.00 72.29 C
ATOM 1495 CD PRO A 193 6.740 59.506 -58.753 1.00 71.79 C
ATOM 1496 N ARG A 194 7.452 56.254 -57.234 1.00 69.89 N
ATOM 1497 CA ARG A 194 7.271 54.939 -56.624 1.00 69.19 C
ATOM 1498 C ARG A 194 7.685 53.793 -57.546 1.00 67.79 C
ATOM 1499 O ARG A 194 7.453 52.629 -57.229 1.00 68.41 O
ATOM 1500 CB ARG A 194 5.810 54.759 -56.197 1.00 69.92 C
ATOM 1501 CG ARG A 194 5.416 55.614 -55.000 1.00 71.68 C
ATOM 1502 CD ARG A 194 3.906 55.703 -54.822 1.00 71.31 C
ATOM 1503 NE ARG A 194 3.279 54.389 -54.768 1.00 71.93 N
ATOM 1504 CZ ARG A 194 1.988 54.195 -54.529 1.00 71.90 C
ATOM 1505 NH1 ARG A 194 1.194 55.235 -54.315 1.00 72.69 N
ATOM 1506 NH2 ARG A 194 1.489 52.966 -54.529 1.00 71.39 N
ATOM 1507 N MET A 195 8.298 54.117 -58.682 1.00 66.11 N
ATOM 1508 CA MET A 195 8.735 53.095 -59.631 1.00 64.41 C
ATOM 1509 C MET A 195 10.245 53.084 -59.810 1.00 64.02 C
ATOM 1510 O MET A 195 10.936 54.049 -59.480 1.00 64.83 O
ATOM 1511 CB MET A 195 8.079 53.309 -60.994 1.00 62.83 C
ATOM 1512 CG MET A 195 6.573 53.311 -60.950 1.00 64.49 C
ATOM 1513 SD MET A 195 5.852 53.284 -62.599 1.00 67.33 S
ATOM 1514 CE MET A 195 5.039 54.850 -62.650 1.00 66.27 C
ATOM 1515 N VAL A 196 10.753 51.981 -60.340 1.00 63.16 N
ATOM 1516 CA VAL A 196 12.176 51.839 -60.581 1.00 62.84 C
ATOM 1517 C VAL A 196 12.419 51.126 -61.904 1.00 63.62 C
ATOM 1518 O VAL A 196 11.972 49.990 -62.081 1.00 64.13 O
ATOM 1519 CB VAL A 196 12.857 51.027 -59.466 1.00 62.68 C
ATOM 1520 CG1 VAL A 196 14.321 50.780 -59.815 1.00 63.32 C
ATOM 1521 CG2 VAL A 196 12.743 51.767 -58.149 1.00 61.21 C
ATOM 1522 N LEU A 197 13.102 51.799 -62.837 1.00 63.61 N
ATOM 1523 CA LEU A 197 13.426 51.188 -64.125 1.00 61.35 C
ATOM 1524 C LEU A 197 14.758 50.497 -63.899 1.00 59.83 C
ATOM 1525 O LEU A 197 15.781 51.140 -63.665 1.00 57.99 O
ATOM 1526 CB LEU A 197 13.542 52.238 -65.233 1.00 61.83 C
ATOM 1527 CG LEU A 197 13.648 51.668 -66.663 1.00 62.96 C
ATOM 1528 CD1 LEU A 197 12.453 50.784 -66.966 1.00 62.65 C
ATOM 1529 CD2 LEU A 197 13.714 52.793 -67.681 1.00 62.72 C
ATOM 1530 N ALA A 198 14.724 49.173 -63.925 1.00 59.31 N
ATOM 1531 CA ALA A 198 15.916 48.384 -63.696 1.00 60.09 C
ATOM 1532 C ALA A 198 16.244 47.597 -64.941 1.00 61.21 C
ATOM 1533 O ALA A 198 15.347 47.241 -65.718 1.00 61.69 O
ATOM 1534 CB ALA A 198 15.703 47.441 -62.528 1.00 59.46 C
ATOM 1535 N ALA A 199 17.534 47.328 -65.128 1.00 61.29 N
ATOM 1536 CA ALA A 199 17.991 46.578 -66.284 1.00 60.89 C
ATOM 1537 C ALA A 199 19.339 45.950 -65.984 1.00 61.01 C
ATOM 1538 O ALA A 199 20.119 46.480 -65.195 1.00 61.21 O
ATOM 1539 CB ALA A 199 18.096 47.503 -67.491 1.00 60.35 C
ATOM 1540 N ALA A 200 19.599 44.807 -66.601 1.00 61.30 N
ATOM 1541 CA ALA A 200 20.862 44.118 -66.415 1.00 63.13 C
ATOM 1542 C ALA A 200 21.184 43.372 -67.696 1.00 65.70 C
ATOM 1543 O ALA A 200 20.279 42.932 -68.413 1.00 66.43 O
ATOM 1544 CB ALA A 200 20.776 43.158 -65.256 1.00 62.99 C
ATOM 1545 N GLY A 201 22.478 43.244 -67.977 1.00 67.83 N
ATOM 1546 CA GLY A 201 22.934 42.570 -69.180 1.00 69.95 C
ATOM 1547 C GLY A 201 23.896 43.462 -69.950 1.00 71.89 C
ATOM 1548 O GLY A 201 24.687 44.203 -69.348 1.00 71.96 O
ATOM 1549 N GLY A 202 23.836 43.395 -71.280 1.00 72.54 N
ATOM 1550 CA GLY A 202 24.706 44.222 -72.102 1.00 72.86 C
ATOM 1551 C GLY A 202 23.984 45.492 -72.506 1.00 72.57 C
ATOM 1552 O GLY A 202 23.495 45.618 -73.625 1.00 72.11 O
ATOM 1553 N ILE A 203 23.922 46.449 -71.590 1.00 73.30 N
ATOM 1554 CA ILE A 203 23.224 47.691 -71.863 1.00 74.49 C
ATOM 1555 C ILE A 203 23.948 48.925 -71.356 1.00 73.93 C
ATOM 1556 O ILE A 203 24.619 48.899 -70.323 1.00 72.05 O
ATOM 1557 CB ILE A 203 21.819 47.673 -71.230 1.00 76.54 C
ATOM 1558 CG1 ILE A 203 21.017 46.498 -71.786 1.00 78.26 C
ATOM 1559 CG2 ILE A 203 21.093 48.975 -71.514 1.00 77.02 C
ATOM 1560 CD1 ILE A 203 19.737 46.242 -71.023 1.00 80.59 C
ATOM 1561 N SER A 204 23.793 50.011 -72.102 1.00 74.45 N
ATOM 1562 CA SER A 204 24.403 51.276 -71.736 1.00 75.24 C
ATOM 1563 C SER A 204 23.495 51.965 -70.736 1.00 74.83 C
ATOM 1564 O SER A 204 22.316 52.202 -71.016 1.00 73.12 O
ATOM 1565 CB SER A 204 24.572 52.173 -72.967 1.00 75.64 C
ATOM 1566 OG SER A 204 24.950 53.489 -72.586 1.00 74.33 O
ATOM 1567 N HIS A 205 24.044 52.278 -69.567 1.00 74.50 N
ATOM 1568 CA HIS A 205 23.267 52.953 -68.556 1.00 74.85 C
ATOM 1569 C HIS A 205 22.740 54.262 -69.145 1.00 75.26 C
ATOM 1570 O HIS A 205 21.560 54.590 -68.989 1.00 74.84 O
ATOM 1571 CB HIS A 205 24.126 53.227 -67.325 1.00 76.10 C
ATOM 1572 CG HIS A 205 23.394 53.939 -66.234 1.00 78.32 C
ATOM 1573 ND1 HIS A 205 22.281 53.409 -65.619 1.00 79.50 N
ATOM 1574 CD2 HIS A 205 23.580 55.163 -65.684 1.00 78.81 C
ATOM 1575 CE1 HIS A 205 21.809 54.276 -64.742 1.00 79.79 C
ATOM 1576 NE2 HIS A 205 22.578 55.349 -64.762 1.00 79.54 N
ATOM 1577 N LYS A 206 23.612 54.992 -69.843 1.00 76.37 N
ATOM 1578 CA LYS A 206 23.232 56.269 -70.450 1.00 77.07 C
ATOM 1579 C LYS A 206 22.221 56.113 -71.587 1.00 76.85 C
ATOM 1580 O LYS A 206 21.434 57.020 -71.838 1.00 76.37 O
ATOM 1581 CB LYS A 206 24.466 57.036 -70.961 1.00 78.30 C
ATOM 1582 CG LYS A 206 25.107 56.449 -72.216 1.00 80.13 C
ATOM 1583 CD LYS A 206 25.902 57.488 -73.017 1.00 79.11 C
ATOM 1584 CE LYS A 206 26.365 56.897 -74.357 1.00 79.38 C
ATOM 1585 NZ LYS A 206 27.081 57.868 -75.240 1.00 78.36 N
ATOM 1586 N GLU A 207 22.245 54.983 -72.288 1.00 77.32 N
ATOM 1587 CA GLU A 207 21.277 54.766 -73.363 1.00 78.53 C
ATOM 1588 C GLU A 207 19.944 54.391 -72.728 1.00 78.35 C
ATOM 1589 O GLU A 207 18.865 54.751 -73.223 1.00 77.08 O
ATOM 1590 CB GLU A 207 21.732 53.639 -74.283 1.00 79.21 C
ATOM 1591 CG GLU A 207 22.718 54.075 -75.329 1.00 82.54 C
ATOM 1592 CD GLU A 207 23.216 52.913 -76.162 1.00 84.38 C
ATOM 1593 OE1 GLU A 207 22.368 52.203 -76.748 1.00 84.56 O
ATOM 1594 OE2 GLU A 207 24.453 52.710 -76.228 1.00 85.20 O
ATOM 1595 N LEU A 208 20.042 53.654 -71.625 1.00 78.29 N
ATOM 1596 CA LEU A 208 18.877 53.224 -70.877 1.00 77.63 C
ATOM 1597 C LEU A 208 18.178 54.461 -70.342 1.00 77.59 C
ATOM 1598 O LEU A 208 16.982 54.670 -70.576 1.00 76.73 O
ATOM 1599 CB LEU A 208 19.298 52.337 -69.707 1.00 77.68 C
ATOM 1600 CG LEU A 208 18.182 51.968 -68.728 1.00 76.99 C
ATOM 1601 CD1 LEU A 208 17.154 51.081 -69.416 1.00 76.04 C
ATOM 1602 CD2 LEU A 208 18.790 51.265 -67.529 1.00 77.56 C
ATOM 1603 N VAL A 209 18.937 55.286 -69.628 1.00 77.26 N
ATOM 1604 CA VAL A 209 18.387 56.500 -69.051 1.00 78.51 C
ATOM 1605 C VAL A 209 17.871 57.469 -70.119 1.00 79.53 C
ATOM 1606 O VAL A 209 16.964 58.265 -69.856 1.00 79.94 O
ATOM 1607 CB VAL A 209 19.424 57.199 -68.141 1.00 77.44 C
ATOM 1608 CG1 VAL A 209 20.670 57.499 -68.913 1.00 79.35 C
ATOM 1609 CG2 VAL A 209 18.833 58.474 -67.563 1.00 78.33 C
ATOM 1610 N ASP A 210 18.433 57.395 -71.324 1.00 80.55 N
ATOM 1611 CA ASP A 210 17.992 58.270 -72.410 1.00 81.33 C
ATOM 1612 C ASP A 210 16.602 57.890 -72.883 1.00 80.68 C
ATOM 1613 O ASP A 210 15.707 58.739 -72.940 1.00 80.27 O
ATOM 1614 CB ASP A 210 18.972 58.223 -73.583 1.00 83.86 C
ATOM 1615 CG ASP A 210 20.094 59.239 -73.439 1.00 86.13 C
ATOM 1616 OD1 ASP A 210 19.775 60.430 -73.225 1.00 86.79 O
ATOM 1617 OD2 ASP A 210 21.283 58.855 -73.541 1.00 87.61 O
ATOM 1618 N ALA A 211 16.418 56.614 -73.218 1.00 80.25 N
ATOM 1619 CA ALA A 211 15.112 56.129 -73.658 1.00 79.47 C
ATOM 1620 C ALA A 211 14.124 56.356 -72.518 1.00 79.16 C
ATOM 1621 O ALA A 211 12.935 56.593 -72.741 1.00 78.18 O
ATOM 1622 CB ALA A 211 15.190 54.657 -73.998 1.00 78.84 C
ATOM 1623 N ALA A 212 14.642 56.280 -71.294 1.00 79.21 N
ATOM 1624 CA ALA A 212 13.848 56.484 -70.095 1.00 79.28 C
ATOM 1625 C ALA A 212 13.297 57.903 -70.088 1.00 80.38 C
ATOM 1626 O ALA A 212 12.107 58.114 -69.853 1.00 80.39 O
ATOM 1627 CB ALA A 212 14.700 56.251 -68.868 1.00 78.22 C
ATOM 1628 N ARG A 213 14.171 58.875 -70.348 1.00 81.57 N
ATOM 1629 CA ARG A 213 13.768 60.276 -70.383 1.00 82.27 C
ATOM 1630 C ARG A 213 12.728 60.494 -71.466 1.00 83.11 C
ATOM 1631 O ARG A 213 11.770 61.250 -71.286 1.00 83.54 O
ATOM 1632 CB ARG A 213 14.974 61.166 -70.656 1.00 82.17 C
ATOM 1633 CG ARG A 213 15.762 61.507 -69.422 1.00 83.19 C
ATOM 1634 CD ARG A 213 17.151 61.998 -69.772 1.00 84.21 C
ATOM 1635 NE ARG A 213 17.924 62.284 -68.566 1.00 84.89 N
ATOM 1636 CZ ARG A 213 19.251 62.276 -68.511 1.00 85.51 C
ATOM 1637 NH1 ARG A 213 19.961 61.993 -69.600 1.00 84.75 N
ATOM 1638 NH2 ARG A 213 19.867 62.547 -67.365 1.00 85.46 N
ATOM 1639 N GLN A 214 12.913 59.807 -72.586 1.00 83.59 N
ATOM 1640 CA GLN A 214 12.008 59.938 -73.713 1.00 84.78 C
ATOM 1641 C GLN A 214 10.604 59.361 -73.487 1.00 85.25 C
ATOM 1642 O GLN A 214 9.616 59.946 -73.938 1.00 84.95 O
ATOM 1643 CB GLN A 214 12.647 59.299 -74.950 1.00 85.63 C
ATOM 1644 CG GLN A 214 12.079 59.795 -76.276 1.00 87.39 C
ATOM 1645 CD GLN A 214 12.868 59.289 -77.473 1.00 88.27 C
ATOM 1646 OE1 GLN A 214 12.772 58.120 -77.851 1.00 88.49 O
ATOM 1647 NE2 GLN A 214 13.664 60.171 -78.071 1.00 88.28 N
ATOM 1648 N HIS A 215 10.500 58.236 -72.780 1.00 85.89 N
ATOM 1649 CA HIS A 215 9.190 57.620 -72.568 1.00 86.14 C
ATOM 1650 C HIS A 215 8.579 57.739 -71.181 1.00 86.51 C
ATOM 1651 O HIS A 215 7.360 57.666 -71.033 1.00 85.89 O
ATOM 1652 CB HIS A 215 9.242 56.155 -72.962 1.00 86.25 C
ATOM 1653 CG HIS A 215 9.844 55.920 -74.310 1.00 85.90 C
ATOM 1654 ND1 HIS A 215 11.202 55.779 -74.504 1.00 85.20 N
ATOM 1655 CD2 HIS A 215 9.274 55.811 -75.532 1.00 85.26 C
ATOM 1656 CE1 HIS A 215 11.442 55.588 -75.788 1.00 85.07 C
ATOM 1657 NE2 HIS A 215 10.289 55.604 -76.434 1.00 85.32 N
ATOM 1658 N PHE A 216 9.413 57.886 -70.164 1.00 87.36 N
ATOM 1659 CA PHE A 216 8.896 58.046 -68.817 1.00 88.56 C
ATOM 1660 C PHE A 216 8.990 59.533 -68.524 1.00 89.49 C
ATOM 1661 O PHE A 216 9.936 60.017 -67.904 1.00 89.50 O
ATOM 1662 CB PHE A 216 9.709 57.217 -67.816 1.00 88.68 C
ATOM 1663 CG PHE A 216 9.526 55.723 -67.976 1.00 88.67 C
ATOM 1664 CD1 PHE A 216 10.497 54.946 -68.603 1.00 88.71 C
ATOM 1665 CD2 PHE A 216 8.369 55.097 -67.514 1.00 88.27 C
ATOM 1666 CE1 PHE A 216 10.320 53.566 -68.767 1.00 88.55 C
ATOM 1667 CE2 PHE A 216 8.182 53.724 -67.673 1.00 88.22 C
ATOM 1668 CZ PHE A 216 9.162 52.957 -68.302 1.00 88.17 C
ATOM 1669 N SER A 217 7.989 60.252 -69.013 1.00 90.81 N
ATOM 1670 CA SER A 217 7.909 61.696 -68.870 1.00 92.36 C
ATOM 1671 C SER A 217 6.865 62.147 -67.843 1.00 93.05 C
ATOM 1672 O SER A 217 7.162 62.255 -66.651 1.00 92.89 O
ATOM 1673 CB SER A 217 7.598 62.300 -70.238 1.00 92.77 C
ATOM 1674 OG SER A 217 6.669 61.484 -70.939 1.00 92.29 O
ATOM 1675 N GLY A 218 5.655 62.415 -68.326 1.00 93.48 N
ATOM 1676 CA GLY A 218 4.554 62.856 -67.482 1.00 95.12 C
ATOM 1677 C GLY A 218 4.868 63.291 -66.062 1.00 96.07 C
ATOM 1678 O GLY A 218 4.397 62.668 -65.105 1.00 96.49 O
ATOM 1679 N VAL A 219 5.641 64.366 -65.919 1.00 96.95 N
ATOM 1680 CA VAL A 219 6.017 64.874 -64.598 1.00 97.52 C
ATOM 1681 C VAL A 219 4.801 65.395 -63.828 1.00 96.79 C
ATOM 1682 O VAL A 219 3.749 65.680 -64.406 1.00 96.10 O
ATOM 1683 CB VAL A 219 7.090 66.014 -64.700 1.00 98.77 C
ATOM 1684 CG1 VAL A 219 7.583 66.413 -63.298 1.00 98.53 C
ATOM 1685 CG2 VAL A 219 8.270 65.556 -65.567 1.00 98.74 C
ATOM 1686 N SER A 220 4.966 65.512 -62.514 1.00 96.31 N
ATOM 1687 CA SER A 220 3.916 65.980 -61.620 1.00 95.76 C
ATOM 1688 C SER A 220 4.047 67.465 -61.259 1.00 95.16 C
ATOM 1689 O SER A 220 5.148 68.024 -61.254 1.00 95.46 O
ATOM 1690 CB SER A 220 3.933 65.125 -60.355 1.00 96.10 C
ATOM 1691 OG SER A 220 5.268 64.853 -59.952 1.00 96.57 O
ATOM 1692 N PHE A 221 2.917 68.093 -60.953 1.00 93.51 N
ATOM 1693 CA PHE A 221 2.903 69.504 -60.601 1.00 92.38 C
ATOM 1694 C PHE A 221 2.848 69.746 -59.100 1.00 91.93 C
ATOM 1695 O PHE A 221 3.705 70.432 -58.541 1.00 92.41 O
ATOM 1696 CB PHE A 221 1.713 70.197 -61.262 1.00 92.19 C
ATOM 1697 CG PHE A 221 1.697 70.063 -62.745 1.00 92.09 C
ATOM 1698 CD1 PHE A 221 1.104 68.964 -63.343 1.00 91.83 C
ATOM 1699 CD2 PHE A 221 2.308 71.018 -63.548 1.00 92.41 C
ATOM 1700 CE1 PHE A 221 1.121 68.816 -64.721 1.00 92.27 C
ATOM 1701 CE2 PHE A 221 2.332 70.879 -64.927 1.00 92.23 C
ATOM 1702 CZ PHE A 221 1.736 69.775 -65.515 1.00 91.98 C
ATOM 1703 N THR A 222 1.834 69.190 -58.448 1.00 90.70 N
ATOM 1704 CA THR A 222 1.675 69.364 -57.013 1.00 88.76 C
ATOM 1705 C THR A 222 2.683 68.552 -56.217 1.00 87.62 C
ATOM 1706 O THR A 222 3.400 67.723 -56.771 1.00 87.10 O
ATOM 1707 CB THR A 222 0.263 68.968 -56.562 1.00 89.02 C
ATOM 1708 OG1 THR A 222 -0.007 67.622 -56.968 1.00 89.04 O
ATOM 1709 CG2 THR A 222 -0.770 69.900 -57.176 1.00 88.95 C
ATOM 1710 N TYR A 223 2.725 68.804 -54.914 1.00 86.59 N
ATOM 1711 CA TYR A 223 3.632 68.113 -54.004 1.00 85.76 C
ATOM 1712 C TYR A 223 3.061 66.741 -53.621 1.00 85.65 C
ATOM 1713 O TYR A 223 3.798 65.795 -53.339 1.00 83.94 O
ATOM 1714 CB TYR A 223 3.836 68.967 -52.748 1.00 85.07 C
ATOM 1715 CG TYR A 223 2.572 69.167 -51.928 1.00 83.97 C
ATOM 1716 CD1 TYR A 223 2.394 68.498 -50.712 1.00 82.80 C
ATOM 1717 CD2 TYR A 223 1.546 70.006 -52.376 1.00 82.71 C
ATOM 1718 CE1 TYR A 223 1.225 68.658 -49.961 1.00 82.76 C
ATOM 1719 CE2 TYR A 223 0.369 70.174 -51.637 1.00 82.51 C
ATOM 1720 CZ TYR A 223 0.213 69.497 -50.427 1.00 83.32 C
ATOM 1721 OH TYR A 223 -0.945 69.655 -49.685 1.00 82.09 O
ATOM 1722 N LYS A 224 1.738 66.643 -53.617 1.00 86.12 N
ATOM 1723 CA LYS A 224 1.081 65.400 -53.276 1.00 87.86 C
ATOM 1724 C LYS A 224 1.323 64.337 -54.337 1.00 89.25 C
ATOM 1725 O LYS A 224 1.093 63.152 -54.100 1.00 90.21 O
ATOM 1726 CB LYS A 224 -0.419 65.633 -53.101 1.00 87.97 C
ATOM 1727 CG LYS A 224 -0.768 66.310 -51.792 1.00 90.02 C
ATOM 1728 CD LYS A 224 -2.263 66.555 -51.651 1.00 92.38 C
ATOM 1729 CE LYS A 224 -2.592 67.183 -50.295 1.00 93.77 C
ATOM 1730 NZ LYS A 224 -4.038 67.529 -50.137 1.00 94.96 N
ATOM 1731 N GLU A 225 1.797 64.754 -55.505 1.00 90.33 N
ATOM 1732 CA GLU A 225 2.050 63.814 -56.590 1.00 90.35 C
ATOM 1733 C GLU A 225 3.460 63.237 -56.594 1.00 89.46 C
ATOM 1734 O GLU A 225 3.708 62.236 -57.261 1.00 90.31 O
ATOM 1735 CB GLU A 225 1.802 64.469 -57.953 1.00 91.69 C
ATOM 1736 CG GLU A 225 0.405 65.011 -58.173 1.00 94.16 C
ATOM 1737 CD GLU A 225 0.107 65.258 -59.643 1.00 96.31 C
ATOM 1738 OE1 GLU A 225 0.958 65.866 -60.334 1.00 97.00 O
ATOM 1739 OE2 GLU A 225 -0.983 64.844 -60.102 1.00 97.49 O
ATOM 1740 N ASP A 226 4.391 63.846 -55.869 1.00 87.95 N
ATOM 1741 CA ASP A 226 5.762 63.339 -55.885 1.00 87.70 C
ATOM 1742 C ASP A 226 6.268 62.791 -54.550 1.00 85.35 C
ATOM 1743 O ASP A 226 7.436 62.405 -54.409 1.00 83.26 O
ATOM 1744 CB ASP A 226 6.702 64.428 -56.420 1.00 91.52 C
ATOM 1745 CG ASP A 226 6.720 65.673 -55.550 1.00 94.22 C
ATOM 1746 OD1 ASP A 226 5.679 65.989 -54.927 1.00 95.86 O
ATOM 1747 OD2 ASP A 226 7.778 66.343 -55.504 1.00 95.90 O
ATOM 1748 N ALA A 227 5.361 62.759 -53.583 1.00 83.64 N
ATOM 1749 CA ALA A 227 5.611 62.251 -52.241 1.00 81.49 C
ATOM 1750 C ALA A 227 5.191 60.785 -52.195 1.00 79.60 C
ATOM 1751 O ALA A 227 4.108 60.431 -52.659 1.00 78.25 O
ATOM 1752 CB ALA A 227 4.797 63.050 -51.238 1.00 81.60 C
ATOM 1753 N VAL A 228 6.059 59.938 -51.650 1.00 78.50 N
ATOM 1754 CA VAL A 228 5.780 58.511 -51.518 1.00 76.99 C
ATOM 1755 C VAL A 228 5.079 58.297 -50.171 1.00 75.24 C
ATOM 1756 O VAL A 228 5.700 58.416 -49.115 1.00 74.53 O
ATOM 1757 CB VAL A 228 7.088 57.688 -51.564 1.00 77.45 C
ATOM 1758 CG1 VAL A 228 8.118 58.263 -50.589 1.00 76.71 C
ATOM 1759 CG2 VAL A 228 6.787 56.238 -51.230 1.00 78.37 C
ATOM 1760 N PRO A 229 3.775 57.970 -50.199 1.00 73.97 N
ATOM 1761 CA PRO A 229 2.961 57.744 -48.997 1.00 73.05 C
ATOM 1762 C PRO A 229 3.461 56.641 -48.064 1.00 71.37 C
ATOM 1763 O PRO A 229 3.743 55.526 -48.504 1.00 71.66 O
ATOM 1764 CB PRO A 229 1.585 57.427 -49.577 1.00 73.41 C
ATOM 1765 CG PRO A 229 1.932 56.672 -50.819 1.00 74.20 C
ATOM 1766 CD PRO A 229 3.039 57.538 -51.402 1.00 74.65 C
ATOM 1767 N ILE A 230 3.583 56.961 -46.780 1.00 68.72 N
ATOM 1768 CA ILE A 230 4.020 55.967 -45.810 1.00 67.13 C
ATOM 1769 C ILE A 230 2.753 55.219 -45.398 1.00 64.23 C
ATOM 1770 O ILE A 230 1.746 55.839 -45.046 1.00 62.63 O
ATOM 1771 CB ILE A 230 4.661 56.613 -44.559 1.00 68.06 C
ATOM 1772 CG1 ILE A 230 5.709 57.653 -44.982 1.00 68.38 C
ATOM 1773 CG2 ILE A 230 5.324 55.529 -43.708 1.00 66.43 C
ATOM 1774 CD1 ILE A 230 6.230 58.530 -43.840 1.00 66.61 C
ATOM 1775 N LEU A 231 2.798 53.890 -45.468 1.00 61.17 N
ATOM 1776 CA LEU A 231 1.637 53.080 -45.117 1.00 57.44 C
ATOM 1777 C LEU A 231 1.426 52.954 -43.615 1.00 54.75 C
ATOM 1778 O LEU A 231 2.375 52.999 -42.826 1.00 53.46 O
ATOM 1779 CB LEU A 231 1.763 51.680 -45.732 1.00 56.35 C
ATOM 1780 CG LEU A 231 1.601 51.557 -47.256 1.00 56.76 C
ATOM 1781 CD1 LEU A 231 1.709 50.094 -47.665 1.00 54.93 C
ATOM 1782 CD2 LEU A 231 0.253 52.139 -47.695 1.00 55.08 C
ATOM 1783 N PRO A 232 0.165 52.821 -43.192 1.00 52.89 N
ATOM 1784 CA PRO A 232 -0.108 52.679 -41.758 1.00 52.73 C
ATOM 1785 C PRO A 232 0.375 51.309 -41.280 1.00 53.34 C
ATOM 1786 O PRO A 232 0.245 50.310 -41.998 1.00 54.56 O
ATOM 1787 CB PRO A 232 -1.623 52.842 -41.673 1.00 51.39 C
ATOM 1788 CG PRO A 232 -2.097 52.366 -43.004 1.00 52.82 C
ATOM 1789 CD PRO A 232 -1.078 52.936 -43.965 1.00 52.10 C
ATOM 1790 N ARG A 233 0.959 51.271 -40.084 1.00 53.69 N
ATOM 1791 CA ARG A 233 1.480 50.030 -39.509 1.00 53.64 C
ATOM 1792 C ARG A 233 0.469 48.903 -39.409 1.00 51.80 C
ATOM 1793 O ARG A 233 -0.715 49.119 -39.152 1.00 52.41 O
ATOM 1794 CB ARG A 233 2.004 50.256 -38.098 1.00 56.01 C
ATOM 1795 CG ARG A 233 3.103 51.283 -37.961 1.00 59.34 C
ATOM 1796 CD ARG A 233 3.807 50.982 -36.661 1.00 60.44 C
ATOM 1797 NE ARG A 233 4.207 49.578 -36.672 1.00 59.14 N
ATOM 1798 CZ ARG A 233 5.286 49.113 -37.291 1.00 58.56 C
ATOM 1799 NH1 ARG A 233 6.090 49.944 -37.942 1.00 59.81 N
ATOM 1800 NH2 ARG A 233 5.545 47.814 -37.287 1.00 59.20 N
ATOM 1801 N CYS A 234 0.963 47.690 -39.600 1.00 49.63 N
ATOM 1802 CA CYS A 234 0.130 46.508 -39.489 1.00 46.16 C
ATOM 1803 C CYS A 234 0.489 45.821 -38.172 1.00 43.04 C
ATOM 1804 O CYS A 234 1.627 45.391 -37.959 1.00 41.20 O
ATOM 1805 CB CYS A 234 0.377 45.579 -40.667 1.00 46.16 C
ATOM 1806 SG CYS A 234 -0.366 46.182 -42.169 1.00 48.38 S
ATOM 1807 N ARG A 235 -0.486 45.756 -37.276 1.00 40.60 N
ATOM 1808 CA ARG A 235 -0.297 45.129 -35.969 1.00 38.75 C
ATOM 1809 C ARG A 235 -0.124 43.603 -36.041 1.00 37.32 C
ATOM 1810 O ARG A 235 -0.887 42.895 -36.717 1.00 36.95 O
ATOM 1811 CB ARG A 235 -1.488 45.476 -35.064 1.00 36.76 C
ATOM 1812 CG ARG A 235 -1.606 44.626 -33.811 1.00 33.35 C
ATOM 1813 CD ARG A 235 -2.967 44.786 -33.201 1.00 29.81 C
ATOM 1814 NE ARG A 235 -4.015 44.382 -34.134 1.00 29.61 N
ATOM 1815 CZ ARG A 235 -5.316 44.577 -33.925 1.00 28.60 C
ATOM 1816 NH1 ARG A 235 -5.723 45.176 -32.809 1.00 28.14 N
ATOM 1817 NH2 ARG A 235 -6.213 44.165 -34.817 1.00 25.85 N
ATOM 1818 N PHE A 236 0.894 43.099 -35.354 1.00 34.96 N
ATOM 1819 CA PHE A 236 1.094 41.661 -35.333 1.00 36.32 C
ATOM 1820 C PHE A 236 0.278 41.084 -34.173 1.00 37.26 C
ATOM 1821 O PHE A 236 0.109 41.738 -33.136 1.00 37.75 O
ATOM 1822 CB PHE A 236 2.552 41.303 -35.107 1.00 33.38 C
ATOM 1823 CG PHE A 236 2.800 39.825 -35.080 1.00 29.97 C
ATOM 1824 CD1 PHE A 236 3.028 39.126 -36.250 1.00 29.10 C
ATOM 1825 CD2 PHE A 236 2.792 39.131 -33.885 1.00 29.01 C
ATOM 1826 CE1 PHE A 236 3.252 37.750 -36.230 1.00 30.14 C
ATOM 1827 CE2 PHE A 236 3.013 37.752 -33.854 1.00 28.55 C
ATOM 1828 CZ PHE A 236 3.246 37.062 -35.027 1.00 27.32 C
ATOM 1829 N THR A 237 -0.212 39.860 -34.338 1.00 36.88 N
ATOM 1830 CA THR A 237 -0.997 39.234 -33.289 1.00 37.22 C
ATOM 1831 C THR A 237 -0.627 37.772 -33.101 1.00 36.82 C
ATOM 1832 O THR A 237 -0.671 36.987 -34.051 1.00 36.53 O
ATOM 1833 CB THR A 237 -2.502 39.331 -33.616 1.00 37.00 C
ATOM 1834 OG1 THR A 237 -2.829 40.693 -33.907 1.00 40.92 O
ATOM 1835 CG2 THR A 237 -3.343 38.865 -32.450 1.00 35.64 C
ATOM 1836 N GLY A 238 -0.235 37.416 -31.880 1.00 36.92 N
ATOM 1837 CA GLY A 238 0.072 36.024 -31.587 1.00 36.16 C
ATOM 1838 C GLY A 238 -1.279 35.314 -31.618 1.00 36.15 C
ATOM 1839 O GLY A 238 -2.157 35.587 -30.800 1.00 36.84 O
ATOM 1840 N SER A 239 -1.470 34.413 -32.566 1.00 34.65 N
ATOM 1841 CA SER A 239 -2.750 33.739 -32.667 1.00 33.30 C
ATOM 1842 C SER A 239 -2.672 32.556 -33.617 1.00 32.42 C
ATOM 1843 O SER A 239 -1.587 32.201 -34.084 1.00 32.75 O
ATOM 1844 CB SER A 239 -3.793 34.733 -33.154 1.00 33.17 C
ATOM 1845 OG SER A 239 -3.438 35.236 -34.428 1.00 32.82 O
ATOM 1846 N GLU A 240 -3.816 31.948 -33.903 1.00 31.23 N
ATOM 1847 CA GLU A 240 -3.861 30.792 -34.790 1.00 31.78 C
ATOM 1848 C GLU A 240 -5.187 30.683 -35.530 1.00 32.16 C
ATOM 1849 O GLU A 240 -6.239 31.110 -35.044 1.00 32.18 O
ATOM 1850 CB GLU A 240 -3.674 29.488 -33.996 1.00 31.54 C
ATOM 1851 CG GLU A 240 -4.755 29.312 -32.930 1.00 37.37 C
ATOM 1852 CD GLU A 240 -4.921 27.888 -32.400 1.00 40.58 C
ATOM 1853 OE1 GLU A 240 -3.905 27.235 -32.055 1.00 41.69 O
ATOM 1854 OE2 GLU A 240 -6.092 27.436 -32.309 1.00 43.26 O
ATOM 1855 N ILE A 241 -5.120 30.085 -36.708 1.00 32.29 N
ATOM 1856 CA ILE A 241 -6.296 29.828 -37.510 1.00 33.64 C
ATOM 1857 C ILE A 241 -6.124 28.352 -37.873 1.00 33.51 C
ATOM 1858 O ILE A 241 -5.061 27.942 -38.348 1.00 33.19 O
ATOM 1859 CB ILE A 241 -6.322 30.731 -38.753 1.00 36.62 C
ATOM 1860 CG1 ILE A 241 -7.430 30.296 -39.697 1.00 38.23 C
ATOM 1861 CG2 ILE A 241 -4.993 30.683 -39.468 1.00 39.23 C
ATOM 1862 CD1 ILE A 241 -7.745 31.355 -40.743 1.00 38.04 C
ATOM 1863 N ARG A 242 -7.144 27.543 -37.576 1.00 33.81 N
ATOM 1864 CA ARG A 242 -7.109 26.101 -37.846 1.00 30.67 C
ATOM 1865 C ARG A 242 -8.212 25.730 -38.804 1.00 31.28 C
ATOM 1866 O ARG A 242 -9.391 25.822 -38.479 1.00 33.77 O
ATOM 1867 CB ARG A 242 -7.272 25.306 -36.547 1.00 29.23 C
ATOM 1868 CG ARG A 242 -6.086 25.408 -35.616 1.00 26.34 C
ATOM 1869 CD ARG A 242 -6.324 24.760 -34.279 1.00 26.02 C
ATOM 1870 NE ARG A 242 -5.177 24.950 -33.385 1.00 30.94 N
ATOM 1871 CZ ARG A 242 -4.295 24.004 -33.033 1.00 34.83 C
ATOM 1872 NH1 ARG A 242 -4.393 22.750 -33.492 1.00 36.72 N
ATOM 1873 NH2 ARG A 242 -3.301 24.313 -32.208 1.00 34.30 N
ATOM 1874 N ALA A 243 -7.822 25.326 -40.001 1.00 33.01 N
ATOM 1875 CA ALA A 243 -8.779 24.932 -41.031 1.00 33.63 C
ATOM 1876 C ALA A 243 -8.622 23.430 -41.174 1.00 33.61 C
ATOM 1877 O ALA A 243 -7.695 22.943 -41.807 1.00 34.35 O
ATOM 1878 CB ALA A 243 -8.466 25.638 -42.342 1.00 31.70 C
ATOM 1879 N ARG A 244 -9.543 22.700 -40.575 1.00 34.22 N
ATOM 1880 CA ARG A 244 -9.470 21.258 -40.597 1.00 34.88 C
ATOM 1881 C ARG A 244 -10.273 20.535 -41.667 1.00 35.73 C
ATOM 1882 O ARG A 244 -11.446 20.832 -41.910 1.00 36.83 O
ATOM 1883 CB ARG A 244 -9.863 20.726 -39.220 1.00 33.05 C
ATOM 1884 CG ARG A 244 -9.821 19.229 -39.128 1.00 33.31 C
ATOM 1885 CD ARG A 244 -9.892 18.776 -37.726 1.00 31.79 C
ATOM 1886 NE ARG A 244 -10.010 17.332 -37.653 1.00 33.01 N
ATOM 1887 CZ ARG A 244 -10.197 16.672 -36.519 1.00 34.49 C
ATOM 1888 NH1 ARG A 244 -10.283 17.338 -35.369 1.00 33.31 N
ATOM 1889 NH2 ARG A 244 -10.301 15.353 -36.538 1.00 32.54 N
ATOM 1890 N ASP A 245 -9.618 19.574 -42.304 1.00 36.71 N
ATOM 1891 CA ASP A 245 -10.249 18.744 -43.318 1.00 38.67 C
ATOM 1892 C ASP A 245 -9.475 17.438 -43.332 1.00 38.39 C
ATOM 1893 O ASP A 245 -8.428 17.324 -43.968 1.00 37.11 O
ATOM 1894 CB ASP A 245 -10.192 19.392 -44.693 1.00 40.53 C
ATOM 1895 CG ASP A 245 -11.003 18.632 -45.713 1.00 45.03 C
ATOM 1896 OD1 ASP A 245 -11.724 17.692 -45.299 1.00 46.21 O
ATOM 1897 OD2 ASP A 245 -10.927 18.978 -46.915 1.00 46.87 O
ATOM 1898 N ASP A 246 -9.987 16.464 -42.592 1.00 38.37 N
ATOM 1899 CA ASP A 246 -9.338 15.174 -42.502 1.00 38.44 C
ATOM 1900 C ASP A 246 -9.338 14.436 -43.843 1.00 38.24 C
ATOM 1901 O ASP A 246 -8.671 13.409 -43.992 1.00 38.25 O
ATOM 1902 CB ASP A 246 -10.010 14.327 -41.423 1.00 39.09 C
ATOM 1903 CG ASP A 246 -9.902 14.949 -40.034 1.00 41.15 C
ATOM 1904 OD1 ASP A 246 -8.932 15.711 -39.771 1.00 41.21 O
ATOM 1905 OD2 ASP A 246 -10.786 14.651 -39.201 1.00 40.18 O
ATOM 1906 N ALA A 247 -10.067 14.970 -44.820 1.00 37.13 N
ATOM 1907 CA ALA A 247 -10.121 14.361 -46.149 1.00 35.79 C
ATOM 1908 C ALA A 247 -8.856 14.673 -46.939 1.00 35.41 C
ATOM 1909 O ALA A 247 -8.609 14.052 -47.960 1.00 36.53 O
ATOM 1910 CB ALA A 247 -11.339 14.849 -46.921 1.00 33.79 C
ATOM 1911 N LEU A 248 -8.074 15.650 -46.489 1.00 34.79 N
ATOM 1912 CA LEU A 248 -6.824 15.990 -47.162 1.00 35.39 C
ATOM 1913 C LEU A 248 -5.772 14.965 -46.734 1.00 37.54 C
ATOM 1914 O LEU A 248 -5.735 14.530 -45.580 1.00 39.61 O
ATOM 1915 CB LEU A 248 -6.383 17.408 -46.802 1.00 33.94 C
ATOM 1916 CG LEU A 248 -7.315 18.509 -47.352 1.00 34.14 C
ATOM 1917 CD1 LEU A 248 -6.770 19.871 -47.006 1.00 31.22 C
ATOM 1918 CD2 LEU A 248 -7.457 18.395 -48.859 1.00 29.60 C
ATOM 1919 N PRO A 249 -4.904 14.554 -47.665 1.00 37.64 N
ATOM 1920 CA PRO A 249 -3.859 13.564 -47.389 1.00 35.78 C
ATOM 1921 C PRO A 249 -2.769 13.952 -46.403 1.00 35.48 C
ATOM 1922 O PRO A 249 -2.382 13.141 -45.578 1.00 38.73 O
ATOM 1923 CB PRO A 249 -3.310 13.247 -48.778 1.00 34.48 C
ATOM 1924 CG PRO A 249 -3.438 14.538 -49.485 1.00 37.96 C
ATOM 1925 CD PRO A 249 -4.815 15.046 -49.051 1.00 38.26 C
ATOM 1926 N VAL A 250 -2.261 15.174 -46.485 1.00 35.59 N
ATOM 1927 CA VAL A 250 -1.206 15.623 -45.570 1.00 33.54 C
ATOM 1928 C VAL A 250 -1.647 16.908 -44.890 1.00 34.63 C
ATOM 1929 O VAL A 250 -2.627 17.532 -45.285 1.00 34.38 O
ATOM 1930 CB VAL A 250 0.122 15.924 -46.319 1.00 31.83 C
ATOM 1931 CG1 VAL A 250 0.680 14.674 -46.934 1.00 29.60 C
ATOM 1932 CG2 VAL A 250 -0.117 16.948 -47.395 1.00 28.52 C
ATOM 1933 N ALA A 251 -0.915 17.319 -43.872 1.00 35.93 N
ATOM 1934 CA ALA A 251 -1.266 18.546 -43.170 1.00 36.79 C
ATOM 1935 C ALA A 251 -0.157 19.581 -43.326 1.00 37.76 C
ATOM 1936 O ALA A 251 1.036 19.240 -43.337 1.00 37.09 O
ATOM 1937 CB ALA A 251 -1.504 18.260 -41.679 1.00 35.11 C
ATOM 1938 N HIS A 252 -0.552 20.840 -43.466 1.00 37.27 N
ATOM 1939 CA HIS A 252 0.417 21.912 -43.570 1.00 37.73 C
ATOM 1940 C HIS A 252 0.345 22.745 -42.298 1.00 36.84 C
ATOM 1941 O HIS A 252 -0.730 23.062 -41.807 1.00 37.71 O
ATOM 1942 CB HIS A 252 0.130 22.809 -44.778 1.00 39.32 C
ATOM 1943 CG HIS A 252 0.454 22.176 -46.095 1.00 40.80 C
ATOM 1944 ND1 HIS A 252 1.276 22.779 -47.023 1.00 41.28 N
ATOM 1945 CD2 HIS A 252 0.039 21.013 -46.653 1.00 39.74 C
ATOM 1946 CE1 HIS A 252 1.356 22.013 -48.097 1.00 40.67 C
ATOM 1947 NE2 HIS A 252 0.613 20.937 -47.899 1.00 40.63 N
ATOM 1948 N VAL A 253 1.501 23.097 -41.767 1.00 35.77 N
ATOM 1949 CA VAL A 253 1.565 23.908 -40.570 1.00 35.06 C
ATOM 1950 C VAL A 253 2.603 25.015 -40.793 1.00 36.30 C
ATOM 1951 O VAL A 253 3.665 24.778 -41.363 1.00 37.51 O
ATOM 1952 CB VAL A 253 1.984 23.047 -39.349 1.00 33.76 C
ATOM 1953 CG1 VAL A 253 2.156 23.911 -38.118 1.00 32.31 C
ATOM 1954 CG2 VAL A 253 0.950 21.980 -39.089 1.00 32.87 C
ATOM 1955 N ALA A 254 2.282 26.223 -40.350 1.00 36.42 N
ATOM 1956 CA ALA A 254 3.189 27.353 -40.468 1.00 35.52 C
ATOM 1957 C ALA A 254 3.138 28.126 -39.164 1.00 35.80 C
ATOM 1958 O ALA A 254 2.073 28.511 -38.700 1.00 36.32 O
ATOM 1959 CB ALA A 254 2.763 28.255 -41.617 1.00 36.81 C
ATOM 1960 N LEU A 255 4.298 28.356 -38.576 1.00 36.60 N
ATOM 1961 CA LEU A 255 4.384 29.091 -37.326 1.00 37.84 C
ATOM 1962 C LEU A 255 5.335 30.257 -37.548 1.00 38.12 C
ATOM 1963 O LEU A 255 6.349 30.097 -38.216 1.00 40.40 O
ATOM 1964 CB LEU A 255 4.952 28.180 -36.236 1.00 37.32 C
ATOM 1965 CG LEU A 255 4.802 28.728 -34.819 1.00 36.21 C
ATOM 1966 CD1 LEU A 255 3.330 28.598 -34.377 1.00 36.42 C
ATOM 1967 CD2 LEU A 255 5.718 27.972 -33.888 1.00 34.41 C
ATOM 1968 N ALA A 256 5.037 31.424 -36.988 1.00 38.84 N
ATOM 1969 CA ALA A 256 5.922 32.572 -37.180 1.00 38.20 C
ATOM 1970 C ALA A 256 5.787 33.680 -36.154 1.00 38.29 C
ATOM 1971 O ALA A 256 4.734 33.879 -35.558 1.00 40.98 O
ATOM 1972 CB ALA A 256 5.716 33.156 -38.569 1.00 36.67 C
ATOM 1973 N VAL A 257 6.876 34.415 -35.971 1.00 38.83 N
ATOM 1974 CA VAL A 257 6.925 35.547 -35.054 1.00 38.11 C
ATOM 1975 C VAL A 257 7.065 36.794 -35.927 1.00 39.07 C
ATOM 1976 O VAL A 257 7.345 36.657 -37.110 1.00 37.48 O
ATOM 1977 CB VAL A 257 8.131 35.423 -34.118 1.00 35.71 C
ATOM 1978 CG1 VAL A 257 7.903 34.304 -33.151 1.00 32.32 C
ATOM 1979 CG2 VAL A 257 9.392 35.164 -34.924 1.00 34.33 C
ATOM 1980 N GLU A 258 6.865 37.993 -35.371 1.00 42.31 N
ATOM 1981 CA GLU A 258 6.993 39.214 -36.183 1.00 45.70 C
ATOM 1982 C GLU A 258 8.470 39.464 -36.529 1.00 47.00 C
ATOM 1983 O GLU A 258 9.360 39.277 -35.689 1.00 46.88 O
ATOM 1984 CB GLU A 258 6.425 40.446 -35.461 1.00 46.84 C
ATOM 1985 CG GLU A 258 6.251 41.667 -36.381 1.00 52.31 C
ATOM 1986 CD GLU A 258 5.879 42.975 -35.651 1.00 58.20 C
ATOM 1987 OE1 GLU A 258 4.938 42.982 -34.819 1.00 60.60 O
ATOM 1988 OE2 GLU A 258 6.527 44.018 -35.924 1.00 62.51 O
ATOM 1989 N GLY A 259 8.721 39.863 -37.776 1.00 48.16 N
ATOM 1990 CA GLY A 259 10.078 40.139 -38.224 1.00 48.05 C
ATOM 1991 C GLY A 259 10.352 41.628 -38.156 1.00 48.77 C
ATOM 1992 O GLY A 259 9.419 42.411 -38.007 1.00 49.68 O
ATOM 1993 N PRO A 260 11.614 42.056 -38.273 1.00 49.54 N
ATOM 1994 CA PRO A 260 11.971 43.478 -38.208 1.00 51.40 C
ATOM 1995 C PRO A 260 11.559 44.390 -39.367 1.00 52.72 C
ATOM 1996 O PRO A 260 11.077 45.501 -39.143 1.00 54.42 O
ATOM 1997 CB PRO A 260 13.487 43.440 -38.020 1.00 51.12 C
ATOM 1998 CG PRO A 260 13.873 42.224 -38.781 1.00 50.95 C
ATOM 1999 CD PRO A 260 12.818 41.217 -38.384 1.00 49.22 C
ATOM 2000 N GLY A 261 11.725 43.941 -40.603 1.00 52.65 N
ATOM 2001 CA GLY A 261 11.385 44.820 -41.710 1.00 52.05 C
ATOM 2002 C GLY A 261 12.668 45.092 -42.477 1.00 50.75 C
ATOM 2003 O GLY A 261 13.746 45.148 -41.885 1.00 51.62 O
ATOM 2004 N TRP A 262 12.557 45.251 -43.789 1.00 49.01 N
ATOM 2005 CA TRP A 262 13.715 45.468 -44.663 1.00 46.62 C
ATOM 2006 C TRP A 262 14.966 46.152 -44.096 1.00 47.40 C
ATOM 2007 O TRP A 262 16.003 45.500 -43.870 1.00 47.52 O
ATOM 2008 CB TRP A 262 13.265 46.198 -45.935 1.00 40.50 C
ATOM 2009 CG TRP A 262 12.469 45.309 -46.839 1.00 34.27 C
ATOM 2010 CD1 TRP A 262 11.182 45.502 -47.267 1.00 31.38 C
ATOM 2011 CD2 TRP A 262 12.893 44.055 -47.389 1.00 30.70 C
ATOM 2012 NE1 TRP A 262 10.777 44.440 -48.049 1.00 29.53 N
ATOM 2013 CE2 TRP A 262 11.806 43.538 -48.138 1.00 29.28 C
ATOM 2014 CE3 TRP A 262 14.086 43.314 -47.318 1.00 28.28 C
ATOM 2015 CZ2 TRP A 262 11.875 42.309 -48.813 1.00 28.58 C
ATOM 2016 CZ3 TRP A 262 14.156 42.087 -47.992 1.00 29.20 C
ATOM 2017 CH2 TRP A 262 13.054 41.599 -48.731 1.00 28.54 C
ATOM 2018 N ALA A 263 14.858 47.455 -43.866 1.00 46.17 N
ATOM 2019 CA ALA A 263 15.976 48.250 -43.384 1.00 48.51 C
ATOM 2020 C ALA A 263 16.788 47.752 -42.183 1.00 50.06 C
ATOM 2021 O ALA A 263 17.932 48.170 -41.998 1.00 52.53 O
ATOM 2022 CB ALA A 263 15.504 49.680 -43.124 1.00 47.83 C
ATOM 2023 N ASP A 264 16.231 46.862 -41.374 1.00 50.47 N
ATOM 2024 CA ASP A 264 16.949 46.387 -40.190 1.00 49.93 C
ATOM 2025 C ASP A 264 18.093 45.404 -40.498 1.00 50.63 C
ATOM 2026 O ASP A 264 17.907 44.384 -41.165 1.00 50.67 O
ATOM 2027 CB ASP A 264 15.955 45.743 -39.208 1.00 49.83 C
ATOM 2028 CG ASP A 264 16.433 45.782 -37.761 1.00 48.85 C
ATOM 2029 OD1 ASP A 264 17.604 45.418 -37.492 1.00 49.64 O
ATOM 2030 OD2 ASP A 264 15.626 46.167 -36.885 1.00 47.25 O
ATOM 2031 N PRO A 265 19.298 45.713 -40.006 1.00 50.78 N
ATOM 2032 CA PRO A 265 20.508 44.903 -40.187 1.00 50.88 C
ATOM 2033 C PRO A 265 20.402 43.500 -39.589 1.00 51.47 C
ATOM 2034 O PRO A 265 21.077 42.568 -40.052 1.00 51.61 O
ATOM 2035 CB PRO A 265 21.572 45.726 -39.485 1.00 50.41 C
ATOM 2036 CG PRO A 265 21.096 47.126 -39.716 1.00 51.36 C
ATOM 2037 CD PRO A 265 19.632 47.025 -39.430 1.00 50.22 C
ATOM 2038 N ASP A 266 19.575 43.355 -38.551 1.00 50.97 N
ATOM 2039 CA ASP A 266 19.394 42.055 -37.897 1.00 50.43 C
ATOM 2040 C ASP A 266 18.998 40.973 -38.909 1.00 49.74 C
ATOM 2041 O ASP A 266 19.271 39.783 -38.710 1.00 47.53 O
ATOM 2042 CB ASP A 266 18.325 42.138 -36.801 1.00 51.07 C
ATOM 2043 CG ASP A 266 18.829 42.803 -35.529 1.00 52.11 C
ATOM 2044 OD1 ASP A 266 20.062 42.819 -35.313 1.00 53.73 O
ATOM 2045 OD2 ASP A 266 17.991 43.288 -34.735 1.00 51.10 O
ATOM 2046 N ASN A 267 18.360 41.399 -39.998 1.00 49.03 N
ATOM 2047 CA ASN A 267 17.927 40.473 -41.031 1.00 48.32 C
ATOM 2048 C ASN A 267 19.059 39.592 -41.543 1.00 48.79 C
ATOM 2049 O ASN A 267 18.829 38.453 -41.962 1.00 50.22 O
ATOM 2050 CB ASN A 267 17.296 41.233 -42.188 1.00 46.51 C
ATOM 2051 CG ASN A 267 15.863 41.600 -41.917 1.00 48.22 C
ATOM 2052 OD1 ASN A 267 15.059 40.727 -41.610 1.00 51.30 O
ATOM 2053 ND2 ASN A 267 15.524 42.892 -42.034 1.00 45.33 N
ATOM 2054 N VAL A 268 20.283 40.101 -41.511 1.00 48.48 N
ATOM 2055 CA VAL A 268 21.400 39.302 -41.993 1.00 48.08 C
ATOM 2056 C VAL A 268 21.580 38.147 -41.031 1.00 47.02 C
ATOM 2057 O VAL A 268 21.872 37.025 -41.440 1.00 46.80 O
ATOM 2058 CB VAL A 268 22.724 40.125 -42.070 1.00 48.44 C
ATOM 2059 CG1 VAL A 268 23.870 39.239 -42.558 1.00 44.03 C
ATOM 2060 CG2 VAL A 268 22.541 41.311 -43.016 1.00 49.28 C
ATOM 2061 N VAL A 269 21.382 38.427 -39.747 1.00 45.63 N
ATOM 2062 CA VAL A 269 21.537 37.395 -38.736 1.00 45.52 C
ATOM 2063 C VAL A 269 20.413 36.369 -38.809 1.00 44.72 C
ATOM 2064 O VAL A 269 20.662 35.167 -38.720 1.00 44.30 O
ATOM 2065 CB VAL A 269 21.572 37.993 -37.323 1.00 44.16 C
ATOM 2066 CG1 VAL A 269 21.984 36.924 -36.327 1.00 44.27 C
ATOM 2067 CG2 VAL A 269 22.529 39.146 -37.281 1.00 43.84 C
ATOM 2068 N LEU A 270 19.180 36.842 -38.970 1.00 43.92 N
ATOM 2069 CA LEU A 270 18.044 35.934 -39.062 1.00 43.89 C
ATOM 2070 C LEU A 270 18.238 34.964 -40.224 1.00 44.85 C
ATOM 2071 O LEU A 270 17.947 33.770 -40.092 1.00 44.29 O
ATOM 2072 CB LEU A 270 16.744 36.718 -39.238 1.00 42.40 C
ATOM 2073 CG LEU A 270 16.380 37.627 -38.064 1.00 41.65 C
ATOM 2074 CD1 LEU A 270 15.034 38.261 -38.311 1.00 41.57 C
ATOM 2075 CD2 LEU A 270 16.346 36.821 -36.789 1.00 42.73 C
ATOM 2076 N HIS A 271 18.737 35.479 -41.353 1.00 46.19 N
ATOM 2077 CA HIS A 271 18.989 34.656 -42.543 1.00 46.60 C
ATOM 2078 C HIS A 271 20.098 33.640 -42.293 1.00 45.76 C
ATOM 2079 O HIS A 271 20.125 32.575 -42.907 1.00 44.51 O
ATOM 2080 CB HIS A 271 19.350 35.531 -43.752 1.00 48.86 C
ATOM 2081 CG HIS A 271 18.171 36.197 -44.395 1.00 50.97 C
ATOM 2082 ND1 HIS A 271 17.100 35.490 -44.899 1.00 51.52 N
ATOM 2083 CD2 HIS A 271 17.894 37.506 -44.614 1.00 51.28 C
ATOM 2084 CE1 HIS A 271 16.213 36.335 -45.398 1.00 51.77 C
ATOM 2085 NE2 HIS A 271 16.670 37.564 -45.239 1.00 50.88 N
ATOM 2086 N VAL A 272 21.018 33.972 -41.401 1.00 45.32 N
ATOM 2087 CA VAL A 272 22.080 33.042 -41.079 1.00 47.24 C
ATOM 2088 C VAL A 272 21.440 31.963 -40.234 1.00 48.58 C
ATOM 2089 O VAL A 272 21.657 30.767 -40.460 1.00 49.42 O
ATOM 2090 CB VAL A 272 23.182 33.695 -40.258 1.00 47.75 C
ATOM 2091 CG1 VAL A 272 24.167 32.629 -39.791 1.00 47.78 C
ATOM 2092 CG2 VAL A 272 23.894 34.745 -41.094 1.00 47.90 C
ATOM 2093 N ALA A 273 20.653 32.408 -39.255 1.00 49.38 N
ATOM 2094 CA ALA A 273 19.919 31.520 -38.344 1.00 48.80 C
ATOM 2095 C ALA A 273 19.067 30.540 -39.149 1.00 48.37 C
ATOM 2096 O ALA A 273 19.146 29.320 -38.957 1.00 47.43 O
ATOM 2097 CB ALA A 273 19.030 32.342 -37.422 1.00 49.08 C
ATOM 2098 N ASN A 274 18.248 31.069 -40.052 1.00 46.72 N
ATOM 2099 CA ASN A 274 17.436 30.185 -40.865 1.00 48.69 C
ATOM 2100 C ASN A 274 18.320 29.209 -41.620 1.00 48.86 C
ATOM 2101 O ASN A 274 17.915 28.085 -41.890 1.00 47.99 O
ATOM 2102 CB ASN A 274 16.592 30.979 -41.849 1.00 49.27 C
ATOM 2103 CG ASN A 274 15.281 31.414 -41.254 1.00 50.26 C
ATOM 2104 OD1 ASN A 274 14.494 32.109 -41.899 1.00 53.10 O
ATOM 2105 ND2 ASN A 274 15.028 30.999 -40.016 1.00 49.86 N
ATOM 2106 N ALA A 275 19.533 29.645 -41.948 1.00 50.59 N
ATOM 2107 CA ALA A 275 20.486 28.805 -42.674 1.00 49.97 C
ATOM 2108 C ALA A 275 20.914 27.608 -41.834 1.00 49.97 C
ATOM 2109 O ALA A 275 21.173 26.529 -42.377 1.00 49.71 O
ATOM 2110 CB ALA A 275 21.695 29.615 -43.075 1.00 49.31 C
ATOM 2111 N ILE A 276 20.985 27.790 -40.516 1.00 48.76 N
ATOM 2112 CA ILE A 276 21.374 26.686 -39.645 1.00 48.51 C
ATOM 2113 C ILE A 276 20.306 25.593 -39.672 1.00 48.62 C
ATOM 2114 O ILE A 276 20.617 24.423 -39.851 1.00 49.50 O
ATOM 2115 CB ILE A 276 21.576 27.146 -38.196 1.00 47.49 C
ATOM 2116 CG1 ILE A 276 22.513 28.353 -38.159 1.00 46.74 C
ATOM 2117 CG2 ILE A 276 22.184 26.013 -37.384 1.00 45.19 C
ATOM 2118 CD1 ILE A 276 22.815 28.848 -36.758 1.00 47.56 C
ATOM 2119 N ILE A 277 19.049 25.987 -39.507 1.00 49.84 N
ATOM 2120 CA ILE A 277 17.915 25.059 -39.524 1.00 49.32 C
ATOM 2121 C ILE A 277 17.662 24.592 -40.946 1.00 48.60 C
ATOM 2122 O ILE A 277 17.222 23.469 -41.190 1.00 48.82 O
ATOM 2123 CB ILE A 277 16.641 25.745 -38.991 1.00 50.39 C
ATOM 2124 CG1 ILE A 277 16.753 25.916 -37.468 1.00 50.82 C
ATOM 2125 CG2 ILE A 277 15.409 24.947 -39.393 1.00 50.25 C
ATOM 2126 CD1 ILE A 277 15.621 26.693 -36.833 1.00 52.23 C
ATOM 2127 N GLY A 278 17.927 25.482 -41.888 1.00 47.24 N
ATOM 2128 CA GLY A 278 17.755 25.143 -43.285 1.00 46.05 C
ATOM 2129 C GLY A 278 16.381 24.718 -43.759 1.00 44.06 C
ATOM 2130 O GLY A 278 15.378 25.371 -43.477 1.00 43.08 O
ATOM 2131 N ARG A 279 16.352 23.627 -44.516 1.00 42.98 N
ATOM 2132 CA ARG A 279 15.117 23.107 -45.074 1.00 43.43 C
ATOM 2133 C ARG A 279 15.308 21.661 -45.506 1.00 43.40 C
ATOM 2134 O ARG A 279 16.404 21.112 -45.412 1.00 45.89 O
ATOM 2135 CB ARG A 279 14.670 23.949 -46.263 1.00 43.82 C
ATOM 2136 CG ARG A 279 15.729 24.076 -47.313 1.00 47.99 C
ATOM 2137 CD ARG A 279 15.204 24.671 -48.592 1.00 50.51 C
ATOM 2138 NE ARG A 279 16.128 24.334 -49.664 1.00 55.61 N
ATOM 2139 CZ ARG A 279 15.822 24.320 -50.955 1.00 57.85 C
ATOM 2140 NH1 ARG A 279 14.590 24.634 -51.358 1.00 56.97 N
ATOM 2141 NH2 ARG A 279 16.756 23.972 -51.841 1.00 59.34 N
ATOM 2142 N TYR A 280 14.246 21.043 -46.001 1.00 42.11 N
ATOM 2143 CA TYR A 280 14.339 19.647 -46.371 1.00 41.50 C
ATOM 2144 C TYR A 280 13.101 19.137 -47.080 1.00 41.02 C
ATOM 2145 O TYR A 280 12.044 19.742 -47.024 1.00 41.76 O
ATOM 2146 CB TYR A 280 14.564 18.828 -45.096 1.00 40.40 C
ATOM 2147 CG TYR A 280 14.346 17.346 -45.257 1.00 42.36 C
ATOM 2148 CD1 TYR A 280 15.386 16.512 -45.644 1.00 42.50 C
ATOM 2149 CD2 TYR A 280 13.086 16.779 -45.046 1.00 42.83 C
ATOM 2150 CE1 TYR A 280 15.184 15.151 -45.815 1.00 44.41 C
ATOM 2151 CE2 TYR A 280 12.870 15.413 -45.218 1.00 42.83 C
ATOM 2152 CZ TYR A 280 13.927 14.605 -45.604 1.00 44.26 C
ATOM 2153 OH TYR A 280 13.743 13.253 -45.806 1.00 44.81 O
ATOM 2154 N ASP A 281 13.250 18.016 -47.764 1.00 41.79 N
ATOM 2155 CA ASP A 281 12.134 17.370 -48.426 1.00 44.46 C
ATOM 2156 C ASP A 281 12.599 15.954 -48.738 1.00 44.93 C
ATOM 2157 O ASP A 281 13.794 15.699 -48.843 1.00 46.04 O
ATOM 2158 CB ASP A 281 11.679 18.156 -49.667 1.00 46.42 C
ATOM 2159 CG ASP A 281 12.192 17.580 -50.959 1.00 50.13 C
ATOM 2160 OD1 ASP A 281 11.974 16.375 -51.206 1.00 53.48 O
ATOM 2161 OD2 ASP A 281 12.789 18.339 -51.751 1.00 50.97 O
ATOM 2162 N ARG A 282 11.654 15.029 -48.844 1.00 45.46 N
ATOM 2163 CA ARG A 282 11.959 13.631 -49.083 1.00 46.47 C
ATOM 2164 C ARG A 282 12.798 13.231 -50.290 1.00 47.55 C
ATOM 2165 O ARG A 282 12.873 12.049 -50.617 1.00 49.85 O
ATOM 2166 CB ARG A 282 10.670 12.829 -49.106 1.00 47.31 C
ATOM 2167 CG ARG A 282 10.087 12.557 -47.738 1.00 50.22 C
ATOM 2168 CD ARG A 282 8.909 11.632 -47.895 1.00 53.43 C
ATOM 2169 NE ARG A 282 7.999 12.142 -48.925 1.00 56.81 N
ATOM 2170 CZ ARG A 282 7.005 11.437 -49.456 1.00 56.73 C
ATOM 2171 NH1 ARG A 282 6.804 10.185 -49.054 1.00 55.63 N
ATOM 2172 NH2 ARG A 282 6.211 11.988 -50.374 1.00 55.43 N
ATOM 2173 N THR A 283 13.430 14.179 -50.964 1.00 47.85 N
ATOM 2174 CA THR A 283 14.262 13.810 -52.101 1.00 46.23 C
ATOM 2175 C THR A 283 15.681 14.363 -51.956 1.00 46.47 C
ATOM 2176 O THR A 283 16.433 14.447 -52.933 1.00 48.11 O
ATOM 2177 CB THR A 283 13.643 14.269 -53.432 1.00 43.55 C
ATOM 2178 OG1 THR A 283 13.652 15.695 -53.501 1.00 45.78 O
ATOM 2179 CG2 THR A 283 12.223 13.779 -53.544 1.00 42.08 C
ATOM 2180 N PHE A 284 16.035 14.750 -50.732 1.00 44.70 N
ATOM 2181 CA PHE A 284 17.381 15.243 -50.435 1.00 43.53 C
ATOM 2182 C PHE A 284 18.266 14.012 -50.246 1.00 45.49 C
ATOM 2183 O PHE A 284 18.313 13.445 -49.152 1.00 47.08 O
ATOM 2184 CB PHE A 284 17.382 16.058 -49.139 1.00 37.75 C
ATOM 2185 CG PHE A 284 16.861 17.447 -49.300 1.00 33.03 C
ATOM 2186 CD1 PHE A 284 15.807 17.712 -50.168 1.00 28.71 C
ATOM 2187 CD2 PHE A 284 17.434 18.498 -48.595 1.00 30.62 C
ATOM 2188 CE1 PHE A 284 15.341 19.007 -50.332 1.00 27.70 C
ATOM 2189 CE2 PHE A 284 16.970 19.805 -48.755 1.00 30.04 C
ATOM 2190 CZ PHE A 284 15.921 20.058 -49.627 1.00 28.64 C
ATOM 2191 N GLY A 285 18.957 13.585 -51.298 1.00 45.44 N
ATOM 2192 CA GLY A 285 19.803 12.411 -51.173 1.00 45.93 C
ATOM 2193 C GLY A 285 20.605 12.377 -49.880 1.00 45.85 C
ATOM 2194 O GLY A 285 20.812 11.314 -49.290 1.00 45.76 O
ATOM 2195 N GLY A 286 21.063 13.544 -49.444 1.00 45.98 N
ATOM 2196 CA GLY A 286 21.845 13.630 -48.225 1.00 48.89 C
ATOM 2197 C GLY A 286 21.339 12.722 -47.125 1.00 50.74 C
ATOM 2198 O GLY A 286 22.133 12.105 -46.408 1.00 52.79 O
ATOM 2199 N GLY A 287 20.015 12.660 -46.986 1.00 51.38 N
ATOM 2200 CA GLY A 287 19.381 11.814 -45.987 1.00 49.19 C
ATOM 2201 C GLY A 287 19.726 12.091 -44.540 1.00 48.83 C
ATOM 2202 O GLY A 287 19.811 13.238 -44.103 1.00 48.14 O
ATOM 2203 N LYS A 288 19.939 11.012 -43.801 1.00 49.31 N
ATOM 2204 CA LYS A 288 20.252 11.091 -42.386 1.00 50.51 C
ATOM 2205 C LYS A 288 21.588 11.727 -42.042 1.00 50.04 C
ATOM 2206 O LYS A 288 21.979 11.753 -40.873 1.00 50.22 O
ATOM 2207 CB LYS A 288 20.184 9.698 -41.764 1.00 52.96 C
ATOM 2208 CG LYS A 288 21.067 8.652 -42.444 1.00 55.97 C
ATOM 2209 CD LYS A 288 20.928 7.286 -41.760 1.00 58.29 C
ATOM 2210 CE LYS A 288 21.593 6.159 -42.557 1.00 59.92 C
ATOM 2211 NZ LYS A 288 23.078 6.299 -42.649 1.00 61.05 N
ATOM 2212 N HIS A 289 22.297 12.253 -43.029 1.00 49.37 N
ATOM 2213 CA HIS A 289 23.581 12.863 -42.712 1.00 49.29 C
ATOM 2214 C HIS A 289 23.599 14.362 -42.878 1.00 49.38 C
ATOM 2215 O HIS A 289 24.622 15.008 -42.648 1.00 48.83 O
ATOM 2216 CB HIS A 289 24.679 12.218 -43.539 1.00 47.74 C
ATOM 2217 CG HIS A 289 24.903 10.781 -43.196 1.00 44.99 C
ATOM 2218 ND1 HIS A 289 24.569 9.752 -44.052 1.00 44.41 N
ATOM 2219 CD2 HIS A 289 25.388 10.199 -42.074 1.00 42.82 C
ATOM 2220 CE1 HIS A 289 24.840 8.595 -43.472 1.00 44.15 C
ATOM 2221 NE2 HIS A 289 25.338 8.839 -42.271 1.00 45.29 N
ATOM 2222 N LEU A 290 22.450 14.903 -43.266 1.00 49.23 N
ATOM 2223 CA LEU A 290 22.291 16.323 -43.460 1.00 49.27 C
ATOM 2224 C LEU A 290 22.753 17.077 -42.224 1.00 50.91 C
ATOM 2225 O LEU A 290 22.556 16.623 -41.101 1.00 49.70 O
ATOM 2226 CB LEU A 290 20.835 16.619 -43.761 1.00 48.16 C
ATOM 2227 CG LEU A 290 20.389 16.056 -45.108 1.00 49.07 C
ATOM 2228 CD1 LEU A 290 18.878 16.149 -45.225 1.00 50.88 C
ATOM 2229 CD2 LEU A 290 21.066 16.830 -46.237 1.00 48.39 C
ATOM 2230 N SER A 291 23.381 18.230 -42.445 1.00 54.93 N
ATOM 2231 CA SER A 291 23.905 19.061 -41.358 1.00 57.49 C
ATOM 2232 C SER A 291 22.794 19.649 -40.495 1.00 58.36 C
ATOM 2233 O SER A 291 22.949 19.755 -39.274 1.00 59.09 O
ATOM 2234 CB SER A 291 24.787 20.199 -41.910 1.00 57.38 C
ATOM 2235 OG SER A 291 25.911 19.702 -42.624 1.00 58.19 O
ATOM 2236 N SER A 292 21.678 20.029 -41.119 1.00 58.38 N
ATOM 2237 CA SER A 292 20.559 20.589 -40.360 1.00 57.63 C
ATOM 2238 C SER A 292 20.007 19.533 -39.414 1.00 56.04 C
ATOM 2239 O SER A 292 19.454 18.514 -39.846 1.00 55.21 O
ATOM 2240 CB SER A 292 19.437 21.065 -41.280 1.00 58.67 C
ATOM 2241 OG SER A 292 18.326 21.485 -40.505 1.00 60.86 O
ATOM 2242 N ARG A 293 20.160 19.776 -38.119 1.00 54.07 N
ATOM 2243 CA ARG A 293 19.684 18.827 -37.129 1.00 52.74 C
ATOM 2244 C ARG A 293 18.222 18.433 -37.372 1.00 51.51 C
ATOM 2245 O ARG A 293 17.901 17.237 -37.435 1.00 50.96 O
ATOM 2246 CB ARG A 293 19.881 19.409 -35.732 1.00 52.39 C
ATOM 2247 CG ARG A 293 21.355 19.607 -35.382 1.00 54.90 C
ATOM 2248 CD ARG A 293 21.542 20.164 -33.992 1.00 55.06 C
ATOM 2249 NE ARG A 293 20.531 19.599 -33.123 1.00 60.05 N
ATOM 2250 CZ ARG A 293 20.734 19.225 -31.868 1.00 63.46 C
ATOM 2251 NH1 ARG A 293 21.943 19.356 -31.314 1.00 63.32 N
ATOM 2252 NH2 ARG A 293 19.715 18.714 -31.172 1.00 63.40 N
ATOM 2253 N LEU A 294 17.349 19.429 -37.538 1.00 48.20 N
ATOM 2254 CA LEU A 294 15.942 19.162 -37.768 1.00 44.58 C
ATOM 2255 C LEU A 294 15.782 18.254 -38.963 1.00 45.65 C
ATOM 2256 O LEU A 294 14.980 17.321 -38.940 1.00 47.49 O
ATOM 2257 CB LEU A 294 15.170 20.459 -38.007 1.00 43.14 C
ATOM 2258 CG LEU A 294 13.673 20.299 -38.330 1.00 39.26 C
ATOM 2259 CD1 LEU A 294 12.973 19.570 -37.193 1.00 37.29 C
ATOM 2260 CD2 LEU A 294 13.047 21.663 -38.584 1.00 34.90 C
ATOM 2261 N ALA A 295 16.537 18.531 -40.021 1.00 45.71 N
ATOM 2262 CA ALA A 295 16.463 17.707 -41.219 1.00 43.85 C
ATOM 2263 C ALA A 295 16.875 16.283 -40.863 1.00 43.22 C
ATOM 2264 O ALA A 295 16.241 15.328 -41.292 1.00 43.33 O
ATOM 2265 CB ALA A 295 17.357 18.261 -42.282 1.00 41.89 C
ATOM 2266 N ALA A 296 17.923 16.141 -40.058 1.00 43.58 N
ATOM 2267 CA ALA A 296 18.384 14.815 -39.659 1.00 44.82 C
ATOM 2268 C ALA A 296 17.281 14.032 -38.923 1.00 46.50 C
ATOM 2269 O ALA A 296 16.995 12.869 -39.257 1.00 47.28 O
ATOM 2270 CB ALA A 296 19.596 14.947 -38.790 1.00 44.96 C
ATOM 2271 N LEU A 297 16.666 14.678 -37.928 1.00 45.91 N
ATOM 2272 CA LEU A 297 15.577 14.088 -37.143 1.00 44.03 C
ATOM 2273 C LEU A 297 14.376 13.744 -38.034 1.00 44.35 C
ATOM 2274 O LEU A 297 13.712 12.716 -37.854 1.00 43.50 O
ATOM 2275 CB LEU A 297 15.122 15.073 -36.071 1.00 42.22 C
ATOM 2276 CG LEU A 297 16.108 15.339 -34.945 1.00 40.74 C
ATOM 2277 CD1 LEU A 297 15.642 16.497 -34.079 1.00 39.03 C
ATOM 2278 CD2 LEU A 297 16.255 14.072 -34.142 1.00 39.65 C
ATOM 2279 N ALA A 298 14.086 14.625 -38.982 1.00 43.74 N
ATOM 2280 CA ALA A 298 12.985 14.389 -39.887 1.00 44.63 C
ATOM 2281 C ALA A 298 13.223 13.053 -40.587 1.00 45.67 C
ATOM 2282 O ALA A 298 12.325 12.219 -40.697 1.00 45.54 O
ATOM 2283 CB ALA A 298 12.903 15.506 -40.896 1.00 44.59 C
ATOM 2284 N VAL A 299 14.451 12.836 -41.034 1.00 46.62 N
ATOM 2285 CA VAL A 299 14.777 11.598 -41.725 1.00 47.80 C
ATOM 2286 C VAL A 299 14.713 10.384 -40.800 1.00 48.96 C
ATOM 2287 O VAL A 299 14.099 9.362 -41.136 1.00 47.59 O
ATOM 2288 CB VAL A 299 16.181 11.682 -42.369 1.00 46.73 C
ATOM 2289 CG1 VAL A 299 16.544 10.352 -43.013 1.00 43.02 C
ATOM 2290 CG2 VAL A 299 16.196 12.792 -43.409 1.00 44.04 C
ATOM 2291 N GLU A 300 15.335 10.505 -39.632 1.00 50.64 N
ATOM 2292 CA GLU A 300 15.364 9.405 -38.675 1.00 54.47 C
ATOM 2293 C GLU A 300 13.988 9.013 -38.173 1.00 54.31 C
ATOM 2294 O GLU A 300 13.674 7.832 -38.058 1.00 54.13 O
ATOM 2295 CB GLU A 300 16.261 9.757 -37.481 1.00 58.28 C
ATOM 2296 CG GLU A 300 17.708 10.046 -37.875 1.00 68.03 C
ATOM 2297 CD GLU A 300 18.438 8.813 -38.440 1.00 73.68 C
ATOM 2298 OE1 GLU A 300 17.867 8.131 -39.328 1.00 76.06 O
ATOM 2299 OE2 GLU A 300 19.585 8.527 -38.003 1.00 76.22 O
ATOM 2300 N HIS A 301 13.159 10.008 -37.892 1.00 54.16 N
ATOM 2301 CA HIS A 301 11.841 9.728 -37.363 1.00 53.65 C
ATOM 2302 C HIS A 301 10.719 9.885 -38.362 1.00 53.78 C
ATOM 2303 O HIS A 301 9.550 9.713 -38.013 1.00 54.37 O
ATOM 2304 CB HIS A 301 11.590 10.613 -36.152 1.00 54.43 C
ATOM 2305 CG HIS A 301 12.636 10.473 -35.091 1.00 54.78 C
ATOM 2306 ND1 HIS A 301 12.845 9.295 -34.407 1.00 53.45 N
ATOM 2307 CD2 HIS A 301 13.557 11.350 -34.625 1.00 54.86 C
ATOM 2308 CE1 HIS A 301 13.850 9.454 -33.564 1.00 54.28 C
ATOM 2309 NE2 HIS A 301 14.301 10.692 -33.676 1.00 54.41 N
ATOM 2310 N LYS A 302 11.068 10.214 -39.602 1.00 52.82 N
ATOM 2311 CA LYS A 302 10.067 10.375 -40.648 1.00 50.85 C
ATOM 2312 C LYS A 302 9.006 11.366 -40.174 1.00 50.03 C
ATOM 2313 O LYS A 302 7.802 11.115 -40.244 1.00 49.66 O
ATOM 2314 CB LYS A 302 9.472 9.006 -40.973 1.00 49.90 C
ATOM 2315 CG LYS A 302 10.561 8.025 -41.327 1.00 52.35 C
ATOM 2316 CD LYS A 302 10.068 6.675 -41.776 1.00 55.38 C
ATOM 2317 CE LYS A 302 11.266 5.807 -42.189 1.00 57.57 C
ATOM 2318 NZ LYS A 302 10.880 4.452 -42.684 1.00 60.39 N
ATOM 2319 N LEU A 303 9.492 12.505 -39.694 1.00 48.90 N
ATOM 2320 CA LEU A 303 8.648 13.562 -39.170 1.00 48.77 C
ATOM 2321 C LEU A 303 7.838 14.332 -40.193 1.00 50.10 C
ATOM 2322 O LEU A 303 6.757 14.820 -39.862 1.00 52.13 O
ATOM 2323 CB LEU A 303 9.488 14.550 -38.366 1.00 45.65 C
ATOM 2324 CG LEU A 303 10.183 13.907 -37.167 1.00 44.28 C
ATOM 2325 CD1 LEU A 303 11.023 14.954 -36.455 1.00 43.46 C
ATOM 2326 CD2 LEU A 303 9.151 13.298 -36.220 1.00 40.13 C
ATOM 2327 N CYS A 304 8.335 14.452 -41.424 1.00 49.29 N
ATOM 2328 CA CYS A 304 7.592 15.202 -42.439 1.00 48.38 C
ATOM 2329 C CYS A 304 7.986 14.860 -43.854 1.00 48.28 C
ATOM 2330 O CYS A 304 8.942 14.130 -44.086 1.00 49.91 O
ATOM 2331 CB CYS A 304 7.807 16.695 -42.254 1.00 47.61 C
ATOM 2332 SG CYS A 304 9.541 17.149 -42.424 1.00 46.14 S
ATOM 2333 N HIS A 305 7.228 15.410 -44.794 1.00 47.39 N
ATOM 2334 CA HIS A 305 7.455 15.221 -46.220 1.00 45.91 C
ATOM 2335 C HIS A 305 8.422 16.317 -46.652 1.00 44.92 C
ATOM 2336 O HIS A 305 9.178 16.163 -47.608 1.00 44.50 O
ATOM 2337 CB HIS A 305 6.135 15.377 -46.987 1.00 45.30 C
ATOM 2338 CG HIS A 305 5.180 14.250 -46.781 1.00 45.27 C
ATOM 2339 ND1 HIS A 305 5.151 13.143 -47.596 1.00 47.13 N
ATOM 2340 CD2 HIS A 305 4.248 14.033 -45.825 1.00 46.91 C
ATOM 2341 CE1 HIS A 305 4.245 12.290 -47.155 1.00 45.51 C
ATOM 2342 NE2 HIS A 305 3.683 12.807 -46.080 1.00 45.99 N
ATOM 2343 N SER A 306 8.379 17.428 -45.923 1.00 43.79 N
ATOM 2344 CA SER A 306 9.219 18.579 -46.208 1.00 42.23 C
ATOM 2345 C SER A 306 9.023 19.629 -45.142 1.00 42.21 C
ATOM 2346 O SER A 306 8.046 19.601 -44.404 1.00 43.33 O
ATOM 2347 CB SER A 306 8.837 19.192 -47.547 1.00 40.88 C
ATOM 2348 OG SER A 306 7.501 19.670 -47.519 1.00 40.10 O
ATOM 2349 N PHE A 307 9.972 20.545 -45.052 1.00 42.56 N
ATOM 2350 CA PHE A 307 9.873 21.640 -44.117 1.00 43.88 C
ATOM 2351 C PHE A 307 10.768 22.737 -44.651 1.00 44.80 C
ATOM 2352 O PHE A 307 11.667 22.476 -45.436 1.00 45.27 O
ATOM 2353 CB PHE A 307 10.278 21.208 -42.714 1.00 44.65 C
ATOM 2354 CG PHE A 307 11.746 21.290 -42.443 1.00 45.01 C
ATOM 2355 CD1 PHE A 307 12.379 22.528 -42.328 1.00 43.71 C
ATOM 2356 CD2 PHE A 307 12.480 20.132 -42.216 1.00 44.13 C
ATOM 2357 CE1 PHE A 307 13.713 22.606 -41.985 1.00 43.70 C
ATOM 2358 CE2 PHE A 307 13.816 20.204 -41.873 1.00 44.01 C
ATOM 2359 CZ PHE A 307 14.434 21.444 -41.757 1.00 44.00 C
ATOM 2360 N GLN A 308 10.529 23.968 -44.228 1.00 46.05 N
ATOM 2361 CA GLN A 308 11.309 25.079 -44.732 1.00 47.29 C
ATOM 2362 C GLN A 308 11.220 26.251 -43.797 1.00 47.08 C
ATOM 2363 O GLN A 308 10.175 26.491 -43.209 1.00 46.73 O
ATOM 2364 CB GLN A 308 10.768 25.518 -46.090 1.00 47.51 C
ATOM 2365 CG GLN A 308 9.280 25.827 -46.053 1.00 48.47 C
ATOM 2366 CD GLN A 308 8.807 26.616 -47.257 1.00 50.49 C
ATOM 2367 OE1 GLN A 308 7.602 26.749 -47.496 1.00 49.67 O
ATOM 2368 NE2 GLN A 308 9.753 27.161 -48.019 1.00 52.58 N
ATOM 2369 N THR A 309 12.318 26.984 -43.665 1.00 46.99 N
ATOM 2370 CA THR A 309 12.317 28.156 -42.813 1.00 46.89 C
ATOM 2371 C THR A 309 12.146 29.349 -43.731 1.00 46.03 C
ATOM 2372 O THR A 309 12.295 29.227 -44.947 1.00 46.15 O
ATOM 2373 CB THR A 309 13.629 28.329 -42.070 1.00 46.42 C
ATOM 2374 OG1 THR A 309 14.677 28.501 -43.024 1.00 47.50 O
ATOM 2375 CG2 THR A 309 13.914 27.129 -41.204 1.00 46.14 C
ATOM 2376 N PHE A 310 11.815 30.496 -43.158 1.00 44.31 N
ATOM 2377 CA PHE A 310 11.658 31.687 -43.962 1.00 45.49 C
ATOM 2378 C PHE A 310 11.772 32.943 -43.118 1.00 45.56 C
ATOM 2379 O PHE A 310 11.561 32.908 -41.906 1.00 46.41 O
ATOM 2380 CB PHE A 310 10.316 31.678 -44.716 1.00 44.41 C
ATOM 2381 CG PHE A 310 9.114 31.537 -43.828 1.00 45.94 C
ATOM 2382 CD1 PHE A 310 8.560 30.285 -43.584 1.00 45.39 C
ATOM 2383 CD2 PHE A 310 8.565 32.654 -43.195 1.00 45.65 C
ATOM 2384 CE1 PHE A 310 7.483 30.143 -42.719 1.00 46.85 C
ATOM 2385 CE2 PHE A 310 7.490 32.527 -42.329 1.00 44.85 C
ATOM 2386 CZ PHE A 310 6.947 31.268 -42.087 1.00 46.66 C
ATOM 2387 N ASN A 311 12.148 34.041 -43.770 1.00 45.76 N
ATOM 2388 CA ASN A 311 12.262 35.341 -43.120 1.00 45.11 C
ATOM 2389 C ASN A 311 11.736 36.383 -44.091 1.00 44.17 C
ATOM 2390 O ASN A 311 12.485 37.171 -44.655 1.00 44.39 O
ATOM 2391 CB ASN A 311 13.702 35.663 -42.746 1.00 46.23 C
ATOM 2392 CG ASN A 311 13.853 37.077 -42.197 1.00 50.30 C
ATOM 2393 OD1 ASN A 311 12.953 37.596 -41.520 1.00 48.90 O
ATOM 2394 ND2 ASN A 311 14.998 37.707 -42.477 1.00 53.17 N
ATOM 2395 N THR A 312 10.428 36.360 -44.288 1.00 42.88 N
ATOM 2396 CA THR A 312 9.765 37.281 -45.183 1.00 42.62 C
ATOM 2397 C THR A 312 9.767 38.704 -44.630 1.00 44.23 C
ATOM 2398 O THR A 312 9.285 38.955 -43.522 1.00 45.40 O
ATOM 2399 CB THR A 312 8.321 36.817 -45.433 1.00 41.31 C
ATOM 2400 OG1 THR A 312 8.350 35.623 -46.224 1.00 39.90 O
ATOM 2401 CG2 THR A 312 7.504 37.893 -46.142 1.00 38.96 C
ATOM 2402 N SER A 313 10.316 39.633 -45.409 1.00 44.73 N
ATOM 2403 CA SER A 313 10.380 41.034 -44.998 1.00 44.75 C
ATOM 2404 C SER A 313 9.366 41.935 -45.682 1.00 42.93 C
ATOM 2405 O SER A 313 8.736 41.567 -46.658 1.00 43.41 O
ATOM 2406 CB SER A 313 11.778 41.595 -45.242 1.00 44.68 C
ATOM 2407 OG SER A 313 12.760 40.803 -44.590 1.00 47.87 O
ATOM 2408 N TYR A 314 9.216 43.126 -45.132 1.00 42.54 N
ATOM 2409 CA TYR A 314 8.311 44.139 -45.658 1.00 42.36 C
ATOM 2410 C TYR A 314 8.887 45.471 -45.184 1.00 41.81 C
ATOM 2411 O TYR A 314 9.905 45.506 -44.486 1.00 41.10 O
ATOM 2412 CB TYR A 314 6.889 43.978 -45.108 1.00 42.72 C
ATOM 2413 CG TYR A 314 6.116 42.796 -45.647 1.00 44.46 C
ATOM 2414 CD1 TYR A 314 5.572 41.838 -44.779 1.00 45.80 C
ATOM 2415 CD2 TYR A 314 5.912 42.632 -47.014 1.00 42.67 C
ATOM 2416 CE1 TYR A 314 4.848 40.742 -45.264 1.00 44.17 C
ATOM 2417 CE2 TYR A 314 5.188 41.541 -47.507 1.00 43.86 C
ATOM 2418 CZ TYR A 314 4.660 40.598 -46.625 1.00 44.91 C
ATOM 2419 OH TYR A 314 3.954 39.507 -47.097 1.00 46.01 O
ATOM 2420 N SER A 315 8.239 46.564 -45.552 1.00 40.67 N
ATOM 2421 CA SER A 315 8.738 47.867 -45.155 1.00 41.06 C
ATOM 2422 C SER A 315 8.984 48.027 -43.670 1.00 42.77 C
ATOM 2423 O SER A 315 10.099 48.324 -43.259 1.00 44.62 O
ATOM 2424 CB SER A 315 7.789 48.962 -45.620 1.00 38.86 C
ATOM 2425 OG SER A 315 6.452 48.647 -45.305 1.00 37.46 O
ATOM 2426 N ASP A 316 7.943 47.785 -42.874 1.00 45.07 N
ATOM 2427 CA ASP A 316 7.970 47.966 -41.420 1.00 44.73 C
ATOM 2428 C ASP A 316 7.765 46.725 -40.566 1.00 45.56 C
ATOM 2429 O ASP A 316 7.682 46.825 -39.346 1.00 44.59 O
ATOM 2430 CB ASP A 316 6.889 48.966 -41.050 1.00 43.67 C
ATOM 2431 CG ASP A 316 5.546 48.603 -41.663 1.00 45.70 C
ATOM 2432 OD1 ASP A 316 5.502 47.672 -42.500 1.00 44.55 O
ATOM 2433 OD2 ASP A 316 4.529 49.250 -41.324 1.00 49.49 O
ATOM 2434 N THR A 317 7.681 45.559 -41.189 1.00 46.75 N
ATOM 2435 CA THR A 317 7.455 44.335 -40.425 1.00 47.25 C
ATOM 2436 C THR A 317 7.838 43.108 -41.240 1.00 46.49 C
ATOM 2437 O THR A 317 8.397 43.228 -42.321 1.00 48.03 O
ATOM 2438 CB THR A 317 5.955 44.242 -39.985 1.00 48.36 C
ATOM 2439 OG1 THR A 317 5.734 43.025 -39.270 1.00 50.21 O
ATOM 2440 CG2 THR A 317 5.020 44.299 -41.185 1.00 47.67 C
ATOM 2441 N GLY A 318 7.545 41.924 -40.724 1.00 45.00 N
ATOM 2442 CA GLY A 318 7.881 40.723 -41.458 1.00 42.24 C
ATOM 2443 C GLY A 318 7.478 39.475 -40.706 1.00 41.31 C
ATOM 2444 O GLY A 318 7.044 39.539 -39.553 1.00 40.23 O
ATOM 2445 N LEU A 319 7.616 38.335 -41.369 1.00 39.29 N
ATOM 2446 CA LEU A 319 7.275 37.064 -40.769 1.00 37.11 C
ATOM 2447 C LEU A 319 8.465 36.128 -40.770 1.00 37.31 C
ATOM 2448 O LEU A 319 8.950 35.720 -41.812 1.00 37.93 O
ATOM 2449 CB LEU A 319 6.101 36.426 -41.515 1.00 34.54 C
ATOM 2450 CG LEU A 319 4.764 37.147 -41.327 1.00 34.11 C
ATOM 2451 CD1 LEU A 319 3.666 36.356 -42.002 1.00 34.34 C
ATOM 2452 CD2 LEU A 319 4.446 37.288 -39.841 1.00 33.47 C
ATOM 2453 N PHE A 320 8.946 35.802 -39.584 1.00 38.85 N
ATOM 2454 CA PHE A 320 10.071 34.892 -39.432 1.00 40.85 C
ATOM 2455 C PHE A 320 9.499 33.575 -38.898 1.00 41.10 C
ATOM 2456 O PHE A 320 8.954 33.540 -37.799 1.00 42.53 O
ATOM 2457 CB PHE A 320 11.072 35.473 -38.423 1.00 42.13 C
ATOM 2458 CG PHE A 320 12.249 34.580 -38.143 1.00 43.20 C
ATOM 2459 CD1 PHE A 320 13.321 34.530 -39.013 1.00 43.04 C
ATOM 2460 CD2 PHE A 320 12.268 33.766 -37.015 1.00 44.75 C
ATOM 2461 CE1 PHE A 320 14.397 33.682 -38.767 1.00 45.06 C
ATOM 2462 CE2 PHE A 320 13.342 32.911 -36.762 1.00 45.03 C
ATOM 2463 CZ PHE A 320 14.406 32.867 -37.637 1.00 44.68 C
ATOM 2464 N GLY A 321 9.613 32.496 -39.658 1.00 40.38 N
ATOM 2465 CA GLY A 321 9.074 31.244 -39.170 1.00 40.91 C
ATOM 2466 C GLY A 321 9.468 30.028 -39.972 1.00 40.97 C
ATOM 2467 O GLY A 321 10.537 29.994 -40.575 1.00 41.64 O
ATOM 2468 N PHE A 322 8.608 29.014 -39.950 1.00 40.38 N
ATOM 2469 CA PHE A 322 8.853 27.787 -40.688 1.00 40.00 C
ATOM 2470 C PHE A 322 7.528 27.164 -41.107 1.00 39.36 C
ATOM 2471 O PHE A 322 6.478 27.523 -40.594 1.00 40.35 O
ATOM 2472 CB PHE A 322 9.687 26.801 -39.859 1.00 39.14 C
ATOM 2473 CG PHE A 322 9.049 26.394 -38.562 1.00 39.87 C
ATOM 2474 CD1 PHE A 322 7.972 25.513 -38.541 1.00 38.71 C
ATOM 2475 CD2 PHE A 322 9.535 26.889 -37.351 1.00 40.74 C
ATOM 2476 CE1 PHE A 322 7.386 25.125 -37.337 1.00 38.08 C
ATOM 2477 CE2 PHE A 322 8.955 26.509 -36.129 1.00 40.17 C
ATOM 2478 CZ PHE A 322 7.880 25.625 -36.125 1.00 39.63 C
ATOM 2479 N HIS A 323 7.590 26.245 -42.059 1.00 38.32 N
ATOM 2480 CA HIS A 323 6.408 25.580 -42.571 1.00 37.37 C
ATOM 2481 C HIS A 323 6.776 24.148 -42.872 1.00 36.75 C
ATOM 2482 O HIS A 323 7.858 23.886 -43.363 1.00 37.23 O
ATOM 2483 CB HIS A 323 5.921 26.294 -43.844 1.00 37.44 C
ATOM 2484 CG HIS A 323 5.066 25.448 -44.743 1.00 40.10 C
ATOM 2485 ND1 HIS A 323 5.553 24.839 -45.883 1.00 41.86 N
ATOM 2486 CD2 HIS A 323 3.749 25.131 -44.689 1.00 41.62 C
ATOM 2487 CE1 HIS A 323 4.574 24.192 -46.492 1.00 39.28 C
ATOM 2488 NE2 HIS A 323 3.469 24.352 -45.789 1.00 40.01 N
ATOM 2489 N PHE A 324 5.892 23.215 -42.548 1.00 36.49 N
ATOM 2490 CA PHE A 324 6.161 21.821 -42.842 1.00 36.30 C
ATOM 2491 C PHE A 324 4.903 21.116 -43.303 1.00 37.27 C
ATOM 2492 O PHE A 324 3.789 21.625 -43.115 1.00 38.88 O
ATOM 2493 CB PHE A 324 6.789 21.103 -41.640 1.00 34.86 C
ATOM 2494 CG PHE A 324 5.923 21.063 -40.405 1.00 36.49 C
ATOM 2495 CD1 PHE A 324 4.851 20.182 -40.304 1.00 35.08 C
ATOM 2496 CD2 PHE A 324 6.238 21.847 -39.297 1.00 37.71 C
ATOM 2497 CE1 PHE A 324 4.123 20.081 -39.119 1.00 33.77 C
ATOM 2498 CE2 PHE A 324 5.513 21.748 -38.108 1.00 36.13 C
ATOM 2499 CZ PHE A 324 4.459 20.864 -38.023 1.00 34.20 C
ATOM 2500 N VAL A 325 5.099 19.968 -43.949 1.00 35.68 N
ATOM 2501 CA VAL A 325 4.014 19.153 -44.456 1.00 35.59 C
ATOM 2502 C VAL A 325 4.240 17.785 -43.841 1.00 37.53 C
ATOM 2503 O VAL A 325 5.311 17.211 -43.968 1.00 39.12 O
ATOM 2504 CB VAL A 325 4.073 19.053 -45.985 1.00 34.73 C
ATOM 2505 CG1 VAL A 325 2.883 18.265 -46.510 1.00 32.71 C
ATOM 2506 CG2 VAL A 325 4.093 20.443 -46.585 1.00 33.15 C
ATOM 2507 N ALA A 326 3.236 17.251 -43.167 1.00 38.48 N
ATOM 2508 CA ALA A 326 3.411 15.966 -42.533 1.00 38.20 C
ATOM 2509 C ALA A 326 2.146 15.152 -42.575 1.00 38.84 C
ATOM 2510 O ALA A 326 1.088 15.678 -42.898 1.00 38.63 O
ATOM 2511 CB ALA A 326 3.841 16.176 -41.099 1.00 37.96 C
ATOM 2512 N ASP A 327 2.275 13.862 -42.265 1.00 41.26 N
ATOM 2513 CA ASP A 327 1.144 12.949 -42.214 1.00 42.53 C
ATOM 2514 C ASP A 327 0.406 13.317 -40.944 1.00 41.84 C
ATOM 2515 O ASP A 327 1.009 13.769 -39.962 1.00 41.20 O
ATOM 2516 CB ASP A 327 1.616 11.513 -42.101 1.00 47.62 C
ATOM 2517 CG ASP A 327 2.553 11.137 -43.206 1.00 55.06 C
ATOM 2518 OD1 ASP A 327 2.092 11.050 -44.366 1.00 58.98 O
ATOM 2519 OD2 ASP A 327 3.759 10.945 -42.919 1.00 60.00 O
ATOM 2520 N PRO A 328 -0.913 13.102 -40.927 1.00 40.19 N
ATOM 2521 CA PRO A 328 -1.667 13.447 -39.727 1.00 39.21 C
ATOM 2522 C PRO A 328 -1.073 12.929 -38.436 1.00 39.73 C
ATOM 2523 O PRO A 328 -1.183 13.586 -37.406 1.00 43.29 O
ATOM 2524 CB PRO A 328 -3.059 12.896 -40.018 1.00 37.50 C
ATOM 2525 CG PRO A 328 -2.828 11.872 -41.066 1.00 38.54 C
ATOM 2526 CD PRO A 328 -1.770 12.450 -41.925 1.00 37.78 C
ATOM 2527 N LEU A 329 -0.408 11.780 -38.484 1.00 38.74 N
ATOM 2528 CA LEU A 329 0.152 11.206 -37.259 1.00 36.72 C
ATOM 2529 C LEU A 329 1.556 11.566 -36.860 1.00 35.23 C
ATOM 2530 O LEU A 329 2.073 11.000 -35.907 1.00 33.57 O
ATOM 2531 CB LEU A 329 0.027 9.681 -37.273 1.00 34.35 C
ATOM 2532 CG LEU A 329 -1.429 9.238 -37.217 1.00 33.58 C
ATOM 2533 CD1 LEU A 329 -1.520 7.749 -37.232 1.00 30.92 C
ATOM 2534 CD2 LEU A 329 -2.072 9.814 -35.970 1.00 33.43 C
ATOM 2535 N SER A 330 2.188 12.499 -37.555 1.00 35.95 N
ATOM 2536 CA SER A 330 3.539 12.867 -37.147 1.00 38.57 C
ATOM 2537 C SER A 330 3.697 14.368 -36.927 1.00 38.63 C
ATOM 2538 O SER A 330 4.803 14.867 -36.709 1.00 38.92 O
ATOM 2539 CB SER A 330 4.569 12.366 -38.161 1.00 38.60 C
ATOM 2540 OG SER A 330 4.410 12.993 -39.417 1.00 44.13 O
ATOM 2541 N ILE A 331 2.581 15.078 -36.957 1.00 38.73 N
ATOM 2542 CA ILE A 331 2.601 16.515 -36.775 1.00 40.92 C
ATOM 2543 C ILE A 331 3.184 16.938 -35.430 1.00 43.65 C
ATOM 2544 O ILE A 331 4.027 17.836 -35.361 1.00 43.61 O
ATOM 2545 CB ILE A 331 1.205 17.094 -36.829 1.00 40.10 C
ATOM 2546 CG1 ILE A 331 0.554 16.779 -38.158 1.00 40.21 C
ATOM 2547 CG2 ILE A 331 1.269 18.590 -36.602 1.00 42.22 C
ATOM 2548 CD1 ILE A 331 -0.907 17.205 -38.193 1.00 44.46 C
ATOM 2549 N ASP A 332 2.708 16.302 -34.362 1.00 45.13 N
ATOM 2550 CA ASP A 332 3.147 16.652 -33.024 1.00 45.93 C
ATOM 2551 C ASP A 332 4.653 16.533 -32.805 1.00 45.92 C
ATOM 2552 O ASP A 332 5.267 17.431 -32.231 1.00 44.52 O
ATOM 2553 CB ASP A 332 2.408 15.814 -31.983 1.00 47.92 C
ATOM 2554 CG ASP A 332 2.512 16.413 -30.589 1.00 52.39 C
ATOM 2555 OD1 ASP A 332 2.030 17.566 -30.411 1.00 55.34 O
ATOM 2556 OD2 ASP A 332 3.078 15.748 -29.686 1.00 51.99 O
ATOM 2557 N ASP A 333 5.254 15.429 -33.249 1.00 46.59 N
ATOM 2558 CA ASP A 333 6.701 15.260 -33.086 1.00 46.33 C
ATOM 2559 C ASP A 333 7.475 16.276 -33.937 1.00 44.42 C
ATOM 2560 O ASP A 333 8.495 16.817 -33.503 1.00 42.09 O
ATOM 2561 CB ASP A 333 7.117 13.833 -33.444 1.00 49.09 C
ATOM 2562 CG ASP A 333 6.639 12.813 -32.415 1.00 51.72 C
ATOM 2563 OD1 ASP A 333 6.867 13.064 -31.207 1.00 52.63 O
ATOM 2564 OD2 ASP A 333 6.050 11.772 -32.805 1.00 51.40 O
ATOM 2565 N MET A 334 6.970 16.545 -35.141 1.00 41.75 N
ATOM 2566 CA MET A 334 7.595 17.514 -36.024 1.00 39.61 C
ATOM 2567 C MET A 334 7.613 18.882 -35.356 1.00 39.71 C
ATOM 2568 O MET A 334 8.667 19.508 -35.238 1.00 41.23 O
ATOM 2569 CB MET A 334 6.834 17.598 -37.343 1.00 39.46 C
ATOM 2570 CG MET A 334 7.501 18.478 -38.399 1.00 41.78 C
ATOM 2571 SD MET A 334 9.279 18.055 -38.769 1.00 43.40 S
ATOM 2572 CE MET A 334 9.941 19.708 -39.123 1.00 37.87 C
ATOM 2573 N MET A 335 6.439 19.343 -34.921 1.00 39.30 N
ATOM 2574 CA MET A 335 6.308 20.638 -34.259 1.00 37.06 C
ATOM 2575 C MET A 335 7.190 20.668 -33.030 1.00 36.35 C
ATOM 2576 O MET A 335 7.776 21.696 -32.701 1.00 36.63 O
ATOM 2577 CB MET A 335 4.863 20.891 -33.848 1.00 35.97 C
ATOM 2578 CG MET A 335 4.662 22.201 -33.121 1.00 37.72 C
ATOM 2579 SD MET A 335 5.016 23.654 -34.149 1.00 45.64 S
ATOM 2580 CE MET A 335 3.404 24.088 -34.809 1.00 41.57 C
ATOM 2581 N PHE A 336 7.292 19.526 -32.362 1.00 35.87 N
ATOM 2582 CA PHE A 336 8.107 19.411 -31.158 1.00 36.68 C
ATOM 2583 C PHE A 336 9.578 19.685 -31.457 1.00 37.26 C
ATOM 2584 O PHE A 336 10.232 20.470 -30.771 1.00 36.12 O
ATOM 2585 CB PHE A 336 7.969 18.006 -30.570 1.00 36.76 C
ATOM 2586 CG PHE A 336 8.864 17.755 -29.391 1.00 37.80 C
ATOM 2587 CD1 PHE A 336 8.510 18.203 -28.116 1.00 37.88 C
ATOM 2588 CD2 PHE A 336 10.094 17.111 -29.562 1.00 38.41 C
ATOM 2589 CE1 PHE A 336 9.361 18.017 -27.029 1.00 34.69 C
ATOM 2590 CE2 PHE A 336 10.952 16.925 -28.487 1.00 36.39 C
ATOM 2591 CZ PHE A 336 10.582 17.381 -27.218 1.00 36.29 C
ATOM 2592 N CYS A 337 10.090 19.006 -32.480 1.00 38.48 N
ATOM 2593 CA CYS A 337 11.471 19.152 -32.894 1.00 39.58 C
ATOM 2594 C CYS A 337 11.698 20.530 -33.516 1.00 40.67 C
ATOM 2595 O CYS A 337 12.706 21.182 -33.236 1.00 42.32 O
ATOM 2596 CB CYS A 337 11.831 18.058 -33.898 1.00 39.80 C
ATOM 2597 SG CYS A 337 11.672 16.364 -33.253 1.00 43.87 S
ATOM 2598 N ALA A 338 10.764 20.978 -34.353 1.00 39.10 N
ATOM 2599 CA ALA A 338 10.913 22.279 -34.976 1.00 39.78 C
ATOM 2600 C ALA A 338 11.067 23.342 -33.893 1.00 41.32 C
ATOM 2601 O ALA A 338 12.044 24.097 -33.900 1.00 42.82 O
ATOM 2602 CB ALA A 338 9.725 22.586 -35.867 1.00 38.60 C
ATOM 2603 N GLN A 339 10.127 23.394 -32.949 1.00 41.57 N
ATOM 2604 CA GLN A 339 10.221 24.385 -31.888 1.00 40.21 C
ATOM 2605 C GLN A 339 11.477 24.152 -31.081 1.00 40.02 C
ATOM 2606 O GLN A 339 12.087 25.104 -30.590 1.00 41.60 O
ATOM 2607 CB GLN A 339 9.008 24.333 -30.967 1.00 41.59 C
ATOM 2608 CG GLN A 339 7.729 24.800 -31.615 1.00 43.25 C
ATOM 2609 CD GLN A 339 6.634 25.081 -30.604 1.00 43.55 C
ATOM 2610 OE1 GLN A 339 6.708 26.040 -29.844 1.00 42.32 O
ATOM 2611 NE2 GLN A 339 5.611 24.240 -30.591 1.00 46.25 N
ATOM 2612 N GLY A 340 11.869 22.887 -30.951 1.00 38.40 N
ATOM 2613 CA GLY A 340 13.065 22.564 -30.196 1.00 39.41 C
ATOM 2614 C GLY A 340 14.285 23.246 -30.772 1.00 41.22 C
ATOM 2615 O GLY A 340 15.094 23.826 -30.041 1.00 39.16 O
ATOM 2616 N GLU A 341 14.398 23.188 -32.098 1.00 42.48 N
ATOM 2617 CA GLU A 341 15.512 23.782 -32.803 1.00 43.34 C
ATOM 2618 C GLU A 341 15.529 25.295 -32.662 1.00 45.56 C
ATOM 2619 O GLU A 341 16.600 25.915 -32.533 1.00 46.74 O
ATOM 2620 CB GLU A 341 15.465 23.370 -34.264 1.00 44.27 C
ATOM 2621 CG GLU A 341 15.803 21.907 -34.465 1.00 48.52 C
ATOM 2622 CD GLU A 341 17.007 21.469 -33.639 1.00 50.72 C
ATOM 2623 OE1 GLU A 341 18.055 22.146 -33.712 1.00 51.23 O
ATOM 2624 OE2 GLU A 341 16.905 20.448 -32.917 1.00 53.15 O
ATOM 2625 N TRP A 342 14.348 25.897 -32.699 1.00 45.30 N
ATOM 2626 CA TRP A 342 14.250 27.332 -32.525 1.00 45.87 C
ATOM 2627 C TRP A 342 14.804 27.703 -31.154 1.00 46.47 C
ATOM 2628 O TRP A 342 15.443 28.738 -30.984 1.00 46.32 O
ATOM 2629 CB TRP A 342 12.802 27.751 -32.599 1.00 47.50 C
ATOM 2630 CG TRP A 342 12.436 28.396 -33.861 1.00 47.47 C
ATOM 2631 CD1 TRP A 342 13.129 28.372 -35.022 1.00 44.51 C
ATOM 2632 CD2 TRP A 342 11.243 29.132 -34.111 1.00 48.00 C
ATOM 2633 NE1 TRP A 342 12.443 29.048 -35.989 1.00 44.17 N
ATOM 2634 CE2 TRP A 342 11.277 29.527 -35.459 1.00 46.74 C
ATOM 2635 CE3 TRP A 342 10.140 29.493 -33.325 1.00 49.37 C
ATOM 2636 CZ2 TRP A 342 10.248 30.271 -36.052 1.00 49.59 C
ATOM 2637 CZ3 TRP A 342 9.113 30.234 -33.908 1.00 50.27 C
ATOM 2638 CH2 TRP A 342 9.176 30.615 -35.261 1.00 50.28 C
ATOM 2639 N MET A 343 14.536 26.861 -30.165 1.00 47.37 N
ATOM 2640 CA MET A 343 15.041 27.118 -28.831 1.00 47.88 C
ATOM 2641 C MET A 343 16.548 26.993 -28.850 1.00 48.58 C
ATOM 2642 O MET A 343 17.248 27.823 -28.288 1.00 49.21 O
ATOM 2643 CB MET A 343 14.427 26.147 -27.826 1.00 47.16 C
ATOM 2644 CG MET A 343 12.997 26.507 -27.484 1.00 46.28 C
ATOM 2645 SD MET A 343 12.852 28.220 -26.882 1.00 48.53 S
ATOM 2646 CE MET A 343 12.123 29.072 -28.309 1.00 44.46 C
ATOM 2647 N ARG A 344 17.048 25.967 -29.523 1.00 50.74 N
ATOM 2648 CA ARG A 344 18.483 25.777 -29.624 1.00 52.80 C
ATOM 2649 C ARG A 344 19.144 27.031 -30.204 1.00 51.48 C
ATOM 2650 O ARG A 344 20.166 27.489 -29.702 1.00 49.92 O
ATOM 2651 CB ARG A 344 18.780 24.572 -30.501 1.00 56.75 C
ATOM 2652 CG ARG A 344 20.224 24.134 -30.471 1.00 65.04 C
ATOM 2653 CD ARG A 344 20.361 22.663 -30.859 1.00 71.13 C
ATOM 2654 NE ARG A 344 19.971 21.728 -29.790 1.00 76.60 N
ATOM 2655 CZ ARG A 344 18.736 21.571 -29.295 1.00 78.14 C
ATOM 2656 NH1 ARG A 344 17.721 22.290 -29.754 1.00 78.25 N
ATOM 2657 NH2 ARG A 344 18.510 20.662 -28.349 1.00 78.24 N
ATOM 2658 N LEU A 345 18.555 27.589 -31.255 1.00 50.72 N
ATOM 2659 CA LEU A 345 19.103 28.799 -31.856 1.00 52.13 C
ATOM 2660 C LEU A 345 19.379 29.878 -30.816 1.00 52.73 C
ATOM 2661 O LEU A 345 20.509 30.330 -30.654 1.00 53.56 O
ATOM 2662 CB LEU A 345 18.140 29.390 -32.888 1.00 52.08 C
ATOM 2663 CG LEU A 345 18.083 28.794 -34.291 1.00 52.05 C
ATOM 2664 CD1 LEU A 345 17.110 29.606 -35.131 1.00 49.97 C
ATOM 2665 CD2 LEU A 345 19.465 28.802 -34.911 1.00 52.07 C
ATOM 2666 N CYS A 346 18.326 30.298 -30.129 1.00 53.26 N
ATOM 2667 CA CYS A 346 18.424 31.334 -29.114 1.00 53.41 C
ATOM 2668 C CYS A 346 19.360 30.967 -27.977 1.00 54.09 C
ATOM 2669 O CYS A 346 19.993 31.844 -27.377 1.00 54.76 O
ATOM 2670 CB CYS A 346 17.050 31.606 -28.491 1.00 52.55 C
ATOM 2671 SG CYS A 346 15.686 31.945 -29.612 1.00 53.37 S
ATOM 2672 N THR A 347 19.460 29.674 -27.687 1.00 54.27 N
ATOM 2673 CA THR A 347 20.242 29.244 -26.543 1.00 55.36 C
ATOM 2674 C THR A 347 21.586 28.543 -26.690 1.00 56.24 C
ATOM 2675 O THR A 347 22.500 28.802 -25.912 1.00 55.64 O
ATOM 2676 CB THR A 347 19.353 28.382 -25.611 1.00 53.93 C
ATOM 2677 OG1 THR A 347 20.133 27.918 -24.513 1.00 56.55 O
ATOM 2678 CG2 THR A 347 18.825 27.174 -26.327 1.00 54.19 C
ATOM 2679 N SER A 348 21.736 27.666 -27.665 1.00 58.68 N
ATOM 2680 CA SER A 348 23.003 26.958 -27.765 1.00 61.73 C
ATOM 2681 C SER A 348 23.717 26.896 -29.117 1.00 63.29 C
ATOM 2682 O SER A 348 24.464 25.944 -29.377 1.00 63.12 O
ATOM 2683 CB SER A 348 22.805 25.549 -27.212 1.00 62.67 C
ATOM 2684 OG SER A 348 21.518 25.058 -27.546 1.00 61.57 O
ATOM 2685 N THR A 349 23.512 27.915 -29.956 1.00 64.31 N
ATOM 2686 CA THR A 349 24.148 27.980 -31.270 1.00 64.97 C
ATOM 2687 C THR A 349 25.657 27.882 -31.106 1.00 65.85 C
ATOM 2688 O THR A 349 26.222 28.383 -30.137 1.00 66.42 O
ATOM 2689 CB THR A 349 23.805 29.290 -31.996 1.00 65.07 C
ATOM 2690 OG1 THR A 349 22.392 29.353 -32.218 1.00 67.06 O
ATOM 2691 CG2 THR A 349 24.509 29.359 -33.340 1.00 65.92 C
ATOM 2692 N THR A 350 26.292 27.227 -32.072 1.00 67.16 N
ATOM 2693 CA THR A 350 27.733 26.993 -32.084 1.00 67.40 C
ATOM 2694 C THR A 350 28.461 27.805 -33.156 1.00 68.11 C
ATOM 2695 O THR A 350 27.855 28.224 -34.148 1.00 68.23 O
ATOM 2696 CB THR A 350 27.999 25.504 -32.339 1.00 66.77 C
ATOM 2697 OG1 THR A 350 27.516 24.757 -31.222 1.00 66.29 O
ATOM 2698 CG2 THR A 350 29.483 25.230 -32.544 1.00 69.13 C
ATOM 2699 N GLU A 351 29.761 28.032 -32.953 1.00 67.55 N
ATOM 2700 CA GLU A 351 30.535 28.761 -33.945 1.00 65.97 C
ATOM 2701 C GLU A 351 30.551 27.939 -35.231 1.00 65.00 C
ATOM 2702 O GLU A 351 30.426 28.493 -36.319 1.00 63.62 O
ATOM 2703 CB GLU A 351 31.960 29.019 -33.452 1.00 66.48 C
ATOM 2704 CG GLU A 351 32.090 30.137 -32.406 1.00 67.70 C
ATOM 2705 CD GLU A 351 31.404 31.449 -32.815 1.00 69.18 C
ATOM 2706 OE1 GLU A 351 31.215 31.698 -34.032 1.00 69.47 O
ATOM 2707 OE2 GLU A 351 31.066 32.245 -31.909 1.00 69.40 O
ATOM 2708 N SER A 352 30.683 26.619 -35.097 1.00 65.09 N
ATOM 2709 CA SER A 352 30.694 25.718 -36.252 1.00 65.54 C
ATOM 2710 C SER A 352 29.406 25.897 -37.022 1.00 66.65 C
ATOM 2711 O SER A 352 29.408 26.038 -38.248 1.00 66.64 O
ATOM 2712 CB SER A 352 30.771 24.256 -35.817 1.00 64.87 C
ATOM 2713 OG SER A 352 31.830 24.041 -34.912 1.00 68.71 O
ATOM 2714 N GLU A 353 28.299 25.877 -36.284 1.00 68.38 N
ATOM 2715 CA GLU A 353 26.978 26.021 -36.879 1.00 68.70 C
ATOM 2716 C GLU A 353 26.879 27.251 -37.765 1.00 68.69 C
ATOM 2717 O GLU A 353 26.405 27.163 -38.901 1.00 69.53 O
ATOM 2718 CB GLU A 353 25.888 26.087 -35.793 1.00 68.44 C
ATOM 2719 CG GLU A 353 25.680 24.793 -35.020 1.00 70.06 C
ATOM 2720 CD GLU A 353 24.367 24.761 -34.242 1.00 70.98 C
ATOM 2721 OE1 GLU A 353 24.128 25.664 -33.409 1.00 70.16 O
ATOM 2722 OE2 GLU A 353 23.571 23.822 -34.463 1.00 73.57 O
ATOM 2723 N VAL A 354 27.322 28.394 -37.251 1.00 68.09 N
ATOM 2724 CA VAL A 354 27.249 29.626 -38.015 1.00 68.93 C
ATOM 2725 C VAL A 354 28.264 29.643 -39.148 1.00 69.18 C
ATOM 2726 O VAL A 354 27.997 30.188 -40.215 1.00 69.58 O
ATOM 2727 CB VAL A 354 27.457 30.861 -37.119 1.00 69.71 C
ATOM 2728 CG1 VAL A 354 26.555 30.766 -35.898 1.00 70.29 C
ATOM 2729 CG2 VAL A 354 28.914 30.975 -36.707 1.00 71.96 C
ATOM 2730 N LYS A 355 29.428 29.043 -38.926 1.00 69.78 N
ATOM 2731 CA LYS A 355 30.451 29.008 -39.966 1.00 68.95 C
ATOM 2732 C LYS A 355 29.805 28.420 -41.210 1.00 67.17 C
ATOM 2733 O LYS A 355 29.890 28.979 -42.304 1.00 68.15 O
ATOM 2734 CB LYS A 355 31.630 28.126 -39.544 1.00 70.30 C
ATOM 2735 CG LYS A 355 32.809 28.184 -40.502 1.00 73.10 C
ATOM 2736 CD LYS A 355 33.664 26.928 -40.412 1.00 74.85 C
ATOM 2737 CE LYS A 355 34.943 27.051 -41.243 1.00 74.63 C
ATOM 2738 NZ LYS A 355 35.904 28.030 -40.644 1.00 74.21 N
ATOM 2739 N ARG A 356 29.136 27.293 -41.023 1.00 64.26 N
ATOM 2740 CA ARG A 356 28.481 26.610 -42.122 1.00 61.68 C
ATOM 2741 C ARG A 356 27.337 27.439 -42.689 1.00 60.88 C
ATOM 2742 O ARG A 356 27.265 27.682 -43.894 1.00 60.56 O
ATOM 2743 CB ARG A 356 27.954 25.269 -41.640 1.00 60.15 C
ATOM 2744 CG ARG A 356 27.481 24.378 -42.735 1.00 60.28 C
ATOM 2745 CD ARG A 356 26.682 23.232 -42.161 1.00 65.71 C
ATOM 2746 NE ARG A 356 25.352 23.666 -41.723 1.00 68.57 N
ATOM 2747 CZ ARG A 356 24.878 23.536 -40.482 1.00 68.71 C
ATOM 2748 NH1 ARG A 356 25.629 22.977 -39.533 1.00 66.77 N
ATOM 2749 NH2 ARG A 356 23.649 23.970 -40.197 1.00 67.07 N
ATOM 2750 N ALA A 357 26.440 27.871 -41.808 1.00 60.61 N
ATOM 2751 CA ALA A 357 25.284 28.663 -42.204 1.00 59.09 C
ATOM 2752 C ALA A 357 25.688 29.885 -43.016 1.00 59.26 C
ATOM 2753 O ALA A 357 24.989 30.268 -43.956 1.00 59.39 O
ATOM 2754 CB ALA A 357 24.514 29.089 -40.975 1.00 59.81 C
ATOM 2755 N LYS A 358 26.816 30.494 -42.649 1.00 59.34 N
ATOM 2756 CA LYS A 358 27.321 31.676 -43.342 1.00 58.11 C
ATOM 2757 C LYS A 358 27.731 31.317 -44.763 1.00 57.80 C
ATOM 2758 O LYS A 358 27.360 32.008 -45.709 1.00 57.49 O
ATOM 2759 CB LYS A 358 28.500 32.280 -42.571 1.00 58.65 C
ATOM 2760 CG LYS A 358 28.089 32.967 -41.268 1.00 58.62 C
ATOM 2761 CD LYS A 358 29.277 33.213 -40.341 1.00 59.14 C
ATOM 2762 CE LYS A 358 30.231 34.253 -40.904 1.00 60.26 C
ATOM 2763 NZ LYS A 358 31.359 34.496 -39.965 1.00 61.03 N
ATOM 2764 N ASN A 359 28.483 30.234 -44.921 1.00 57.59 N
ATOM 2765 CA ASN A 359 28.884 29.822 -46.255 1.00 58.66 C
ATOM 2766 C ASN A 359 27.629 29.565 -47.065 1.00 58.53 C
ATOM 2767 O ASN A 359 27.468 30.089 -48.170 1.00 57.96 O
ATOM 2768 CB ASN A 359 29.738 28.555 -46.206 1.00 60.43 C
ATOM 2769 CG ASN A 359 31.145 28.827 -45.707 1.00 62.78 C
ATOM 2770 OD1 ASN A 359 31.791 29.805 -46.119 1.00 62.43 O
ATOM 2771 ND2 ASN A 359 31.636 27.960 -44.825 1.00 64.19 N
ATOM 2772 N HIS A 360 26.735 28.763 -46.497 1.00 59.13 N
ATOM 2773 CA HIS A 360 25.481 28.441 -47.161 1.00 58.64 C
ATOM 2774 C HIS A 360 24.745 29.705 -47.593 1.00 57.20 C
ATOM 2775 O HIS A 360 24.211 29.775 -48.693 1.00 55.53 O
ATOM 2776 CB HIS A 360 24.571 27.634 -46.239 1.00 59.79 C
ATOM 2777 CG HIS A 360 23.264 27.274 -46.871 1.00 62.02 C
ATOM 2778 ND1 HIS A 360 23.155 26.328 -47.868 1.00 63.16 N
ATOM 2779 CD2 HIS A 360 22.023 27.791 -46.708 1.00 62.68 C
ATOM 2780 CE1 HIS A 360 21.906 26.279 -48.293 1.00 62.66 C
ATOM 2781 NE2 HIS A 360 21.198 27.156 -47.606 1.00 62.60 N
ATOM 2782 N LEU A 361 24.713 30.698 -46.713 1.00 57.49 N
ATOM 2783 CA LEU A 361 24.042 31.958 -47.005 1.00 58.08 C
ATOM 2784 C LEU A 361 24.709 32.713 -48.152 1.00 58.86 C
ATOM 2785 O LEU A 361 24.022 33.256 -49.015 1.00 59.73 O
ATOM 2786 CB LEU A 361 24.008 32.845 -45.758 1.00 56.31 C
ATOM 2787 CG LEU A 361 23.147 34.097 -45.920 1.00 55.43 C
ATOM 2788 CD1 LEU A 361 21.740 33.683 -46.310 1.00 54.82 C
ATOM 2789 CD2 LEU A 361 23.128 34.889 -44.629 1.00 54.83 C
ATOM 2790 N ARG A 362 26.042 32.749 -48.164 1.00 59.81 N
ATOM 2791 CA ARG A 362 26.778 33.437 -49.233 1.00 59.86 C
ATOM 2792 C ARG A 362 26.388 32.857 -50.586 1.00 60.42 C
ATOM 2793 O ARG A 362 25.897 33.575 -51.461 1.00 59.56 O
ATOM 2794 CB ARG A 362 28.296 33.292 -49.054 1.00 58.63 C
ATOM 2795 CG ARG A 362 28.859 33.957 -47.812 1.00 56.95 C
ATOM 2796 CD ARG A 362 30.375 33.886 -47.796 1.00 55.95 C
ATOM 2797 NE ARG A 362 30.946 34.529 -46.612 1.00 56.38 N
ATOM 2798 CZ ARG A 362 31.241 33.898 -45.476 1.00 55.62 C
ATOM 2799 NH1 ARG A 362 31.024 32.594 -45.361 1.00 56.54 N
ATOM 2800 NH2 ARG A 362 31.747 34.574 -44.453 1.00 54.60 N
ATOM 2801 N SER A 363 26.597 31.552 -50.747 1.00 61.54 N
ATOM 2802 CA SER A 363 26.274 30.884 -52.003 1.00 63.42 C
ATOM 2803 C SER A 363 24.805 31.019 -52.373 1.00 63.84 C
ATOM 2804 O SER A 363 24.427 30.844 -53.531 1.00 65.02 O
ATOM 2805 CB SER A 363 26.657 29.408 -51.932 1.00 63.40 C
ATOM 2806 OG SER A 363 25.927 28.751 -50.925 1.00 66.49 O
ATOM 2807 N ALA A 364 23.979 31.342 -51.389 1.00 64.92 N
ATOM 2808 CA ALA A 364 22.555 31.514 -51.631 1.00 65.16 C
ATOM 2809 C ALA A 364 22.302 32.896 -52.214 1.00 64.98 C
ATOM 2810 O ALA A 364 21.464 33.055 -53.102 1.00 64.97 O
ATOM 2811 CB ALA A 364 21.784 31.349 -50.338 1.00 66.47 C
ATOM 2812 N MET A 365 23.021 33.895 -51.710 1.00 64.88 N
ATOM 2813 CA MET A 365 22.853 35.249 -52.207 1.00 66.00 C
ATOM 2814 C MET A 365 23.442 35.338 -53.610 1.00 66.63 C
ATOM 2815 O MET A 365 22.933 36.064 -54.465 1.00 66.70 O
ATOM 2816 CB MET A 365 23.542 36.247 -51.287 1.00 66.74 C
ATOM 2817 CG MET A 365 25.049 36.152 -51.276 1.00 69.86 C
ATOM 2818 SD MET A 365 25.798 37.360 -50.142 1.00 74.78 S
ATOM 2819 CE MET A 365 27.596 37.044 -50.393 1.00 73.53 C
ATOM 2820 N VAL A 366 24.517 34.589 -53.842 1.00 66.41 N
ATOM 2821 CA VAL A 366 25.162 34.571 -55.150 1.00 65.49 C
ATOM 2822 C VAL A 366 24.248 33.887 -56.162 1.00 64.71 C
ATOM 2823 O VAL A 366 24.237 34.235 -57.337 1.00 64.74 O
ATOM 2824 CB VAL A 366 26.521 33.830 -55.089 1.00 65.52 C
ATOM 2825 CG1 VAL A 366 27.038 33.570 -56.488 1.00 63.48 C
ATOM 2826 CG2 VAL A 366 27.529 34.665 -54.305 1.00 63.76 C
ATOM 2827 N ALA A 367 23.466 32.924 -55.698 1.00 64.64 N
ATOM 2828 CA ALA A 367 22.549 32.208 -56.574 1.00 65.81 C
ATOM 2829 C ALA A 367 21.369 33.073 -57.025 1.00 66.15 C
ATOM 2830 O ALA A 367 20.794 32.849 -58.089 1.00 65.93 O
ATOM 2831 CB ALA A 367 22.040 30.958 -55.874 1.00 64.75 C
ATOM 2832 N GLN A 368 21.009 34.059 -56.215 1.00 67.49 N
ATOM 2833 CA GLN A 368 19.889 34.935 -56.548 1.00 69.78 C
ATOM 2834 C GLN A 368 20.297 36.005 -57.554 1.00 70.41 C
ATOM 2835 O GLN A 368 19.578 36.986 -57.781 1.00 70.45 O
ATOM 2836 CB GLN A 368 19.349 35.612 -55.292 1.00 71.00 C
ATOM 2837 CG GLN A 368 18.995 34.669 -54.159 1.00 71.48 C
ATOM 2838 CD GLN A 368 18.048 35.316 -53.171 1.00 71.36 C
ATOM 2839 OE1 GLN A 368 18.208 36.487 -52.819 1.00 71.27 O
ATOM 2840 NE2 GLN A 368 17.056 34.558 -52.716 1.00 69.76 N
ATOM 2841 N LEU A 369 21.470 35.811 -58.139 1.00 70.99 N
ATOM 2842 CA LEU A 369 22.009 36.724 -59.138 1.00 70.64 C
ATOM 2843 C LEU A 369 22.529 35.829 -60.255 1.00 70.98 C
ATOM 2844 O LEU A 369 23.631 36.027 -60.773 1.00 71.66 O
ATOM 2845 CB LEU A 369 23.158 37.538 -58.541 1.00 68.82 C
ATOM 2846 CG LEU A 369 22.833 38.454 -57.366 1.00 66.24 C
ATOM 2847 CD1 LEU A 369 24.120 38.999 -56.801 1.00 66.30 C
ATOM 2848 CD2 LEU A 369 21.929 39.580 -57.817 1.00 65.69 C
ATOM 2849 N ASP A 370 21.723 34.836 -60.613 1.00 70.80 N
ATOM 2850 CA ASP A 370 22.104 33.886 -61.644 1.00 70.77 C
ATOM 2851 C ASP A 370 21.309 34.059 -62.932 1.00 69.30 C
ATOM 2852 O ASP A 370 20.489 33.217 -63.292 1.00 69.52 O
ATOM 2853 CB ASP A 370 21.931 32.468 -61.112 1.00 72.37 C
ATOM 2854 CG ASP A 370 22.834 31.483 -61.807 1.00 74.98 C
ATOM 2855 OD1 ASP A 370 24.077 31.686 -61.762 1.00 76.12 O
ATOM 2856 OD2 ASP A 370 22.302 30.512 -62.391 1.00 75.10 O
ATOM 2857 N GLY A 371 21.571 35.155 -63.632 1.00 67.78 N
ATOM 2858 CA GLY A 371 20.868 35.429 -64.867 1.00 66.27 C
ATOM 2859 C GLY A 371 20.537 36.899 -64.885 1.00 65.06 C
ATOM 2860 O GLY A 371 20.749 37.579 -63.884 1.00 63.55 O
ATOM 2861 N THR A 372 20.021 37.403 -66.000 1.00 65.23 N
ATOM 2862 CA THR A 372 19.705 38.819 -66.059 1.00 65.72 C
ATOM 2863 C THR A 372 18.426 39.136 -65.319 1.00 64.64 C
ATOM 2864 O THR A 372 18.317 40.186 -64.685 1.00 65.44 O
ATOM 2865 CB THR A 372 19.594 39.355 -67.517 1.00 66.48 C
ATOM 2866 OG1 THR A 372 18.707 38.530 -68.282 1.00 67.85 O
ATOM 2867 CG2 THR A 372 20.963 39.388 -68.172 1.00 67.43 C
ATOM 2868 N THR A 373 17.456 38.235 -65.377 1.00 63.40 N
ATOM 2869 CA THR A 373 16.212 38.512 -64.682 1.00 62.45 C
ATOM 2870 C THR A 373 16.414 38.497 -63.168 1.00 61.61 C
ATOM 2871 O THR A 373 16.007 39.431 -62.472 1.00 61.47 O
ATOM 2872 CB THR A 373 15.120 37.529 -65.085 1.00 62.15 C
ATOM 2873 OG1 THR A 373 15.092 37.427 -66.514 1.00 63.65 O
ATOM 2874 CG2 THR A 373 13.766 38.034 -64.615 1.00 60.58 C
ATOM 2875 N PRO A 374 17.052 37.448 -62.630 1.00 60.38 N
ATOM 2876 CA PRO A 374 17.234 37.474 -61.177 1.00 60.05 C
ATOM 2877 C PRO A 374 18.008 38.700 -60.675 1.00 59.83 C
ATOM 2878 O PRO A 374 17.680 39.263 -59.631 1.00 60.72 O
ATOM 2879 CB PRO A 374 17.941 36.144 -60.882 1.00 59.06 C
ATOM 2880 CG PRO A 374 18.536 35.746 -62.188 1.00 59.75 C
ATOM 2881 CD PRO A 374 17.502 36.166 -63.194 1.00 60.19 C
ATOM 2882 N VAL A 375 19.026 39.115 -61.424 1.00 59.56 N
ATOM 2883 CA VAL A 375 19.832 40.275 -61.044 1.00 57.67 C
ATOM 2884 C VAL A 375 18.988 41.540 -61.157 1.00 57.92 C
ATOM 2885 O VAL A 375 19.045 42.440 -60.314 1.00 57.08 O
ATOM 2886 CB VAL A 375 21.067 40.425 -61.962 1.00 55.93 C
ATOM 2887 CG1 VAL A 375 21.820 41.709 -61.620 1.00 52.62 C
ATOM 2888 CG2 VAL A 375 21.974 39.216 -61.807 1.00 55.08 C
ATOM 2889 N CYS A 376 18.203 41.610 -62.217 1.00 57.73 N
ATOM 2890 CA CYS A 376 17.361 42.764 -62.422 1.00 59.32 C
ATOM 2891 C CYS A 376 16.386 42.865 -61.240 1.00 59.19 C
ATOM 2892 O CYS A 376 16.146 43.957 -60.718 1.00 60.14 O
ATOM 2893 CB CYS A 376 16.619 42.618 -63.752 1.00 60.66 C
ATOM 2894 SG CYS A 376 16.019 44.175 -64.414 1.00 63.97 S
ATOM 2895 N GLU A 377 15.838 41.721 -60.820 1.00 58.58 N
ATOM 2896 CA GLU A 377 14.911 41.650 -59.682 1.00 55.14 C
ATOM 2897 C GLU A 377 15.582 42.206 -58.427 1.00 53.44 C
ATOM 2898 O GLU A 377 14.963 42.937 -57.668 1.00 51.80 O
ATOM 2899 CB GLU A 377 14.481 40.202 -59.437 1.00 54.32 C
ATOM 2900 CG GLU A 377 13.628 39.978 -58.188 1.00 56.38 C
ATOM 2901 CD GLU A 377 12.207 40.574 -58.268 1.00 59.00 C
ATOM 2902 OE1 GLU A 377 11.452 40.271 -59.231 1.00 58.83 O
ATOM 2903 OE2 GLU A 377 11.838 41.337 -57.345 1.00 58.71 O
ATOM 2904 N THR A 378 16.847 41.861 -58.212 1.00 53.13 N
ATOM 2905 CA THR A 378 17.574 42.359 -57.049 1.00 54.83 C
ATOM 2906 C THR A 378 17.617 43.887 -57.078 1.00 57.17 C
ATOM 2907 O THR A 378 17.258 44.554 -56.099 1.00 58.05 O
ATOM 2908 CB THR A 378 19.018 41.825 -57.005 1.00 53.63 C
ATOM 2909 OG1 THR A 378 18.999 40.418 -56.752 1.00 54.04 O
ATOM 2910 CG2 THR A 378 19.802 42.505 -55.907 1.00 52.61 C
ATOM 2911 N ILE A 379 18.056 44.438 -58.204 1.00 58.38 N
ATOM 2912 CA ILE A 379 18.136 45.879 -58.352 1.00 58.94 C
ATOM 2913 C ILE A 379 16.783 46.511 -58.022 1.00 58.92 C
ATOM 2914 O ILE A 379 16.686 47.336 -57.105 1.00 59.98 O
ATOM 2915 CB ILE A 379 18.567 46.263 -59.794 1.00 60.28 C
ATOM 2916 CG1 ILE A 379 19.973 45.720 -60.067 1.00 60.84 C
ATOM 2917 CG2 ILE A 379 18.549 47.787 -59.976 1.00 59.90 C
ATOM 2918 CD1 ILE A 379 20.444 45.895 -61.502 1.00 61.32 C
ATOM 2919 N GLY A 380 15.742 46.116 -58.752 1.00 57.35 N
ATOM 2920 CA GLY A 380 14.422 46.679 -58.511 1.00 56.65 C
ATOM 2921 C GLY A 380 14.028 46.673 -57.042 1.00 56.33 C
ATOM 2922 O GLY A 380 13.658 47.703 -56.462 1.00 56.08 O
ATOM 2923 N SER A 381 14.120 45.490 -56.439 1.00 55.09 N
ATOM 2924 CA SER A 381 13.780 45.286 -55.044 1.00 51.79 C
ATOM 2925 C SER A 381 14.653 46.114 -54.126 1.00 52.12 C
ATOM 2926 O SER A 381 14.146 46.802 -53.247 1.00 50.55 O
ATOM 2927 CB SER A 381 13.908 43.807 -54.713 1.00 50.45 C
ATOM 2928 OG SER A 381 12.950 43.074 -55.456 1.00 46.55 O
ATOM 2929 N HIS A 382 15.964 46.051 -54.336 1.00 53.04 N
ATOM 2930 CA HIS A 382 16.908 46.815 -53.523 1.00 53.43 C
ATOM 2931 C HIS A 382 16.633 48.313 -53.463 1.00 54.44 C
ATOM 2932 O HIS A 382 16.602 48.900 -52.384 1.00 54.70 O
ATOM 2933 CB HIS A 382 18.336 46.626 -54.029 1.00 52.81 C
ATOM 2934 CG HIS A 382 19.018 45.420 -53.476 1.00 52.02 C
ATOM 2935 ND1 HIS A 382 20.347 45.422 -53.116 1.00 53.39 N
ATOM 2936 CD2 HIS A 382 18.563 44.171 -53.233 1.00 51.52 C
ATOM 2937 CE1 HIS A 382 20.681 44.223 -52.673 1.00 53.87 C
ATOM 2938 NE2 HIS A 382 19.616 43.445 -52.734 1.00 52.32 N
ATOM 2939 N LEU A 383 16.458 48.946 -54.614 1.00 54.78 N
ATOM 2940 CA LEU A 383 16.222 50.379 -54.600 1.00 57.23 C
ATOM 2941 C LEU A 383 14.888 50.669 -53.962 1.00 57.03 C
ATOM 2942 O LEU A 383 14.733 51.625 -53.202 1.00 56.93 O
ATOM 2943 CB LEU A 383 16.237 50.954 -56.021 1.00 59.93 C
ATOM 2944 CG LEU A 383 17.476 50.798 -56.915 1.00 60.20 C
ATOM 2945 CD1 LEU A 383 17.452 51.961 -57.893 1.00 60.36 C
ATOM 2946 CD2 LEU A 383 18.783 50.817 -56.123 1.00 58.27 C
ATOM 2947 N LEU A 384 13.923 49.823 -54.292 1.00 57.15 N
ATOM 2948 CA LEU A 384 12.571 49.958 -53.787 1.00 56.17 C
ATOM 2949 C LEU A 384 12.486 49.734 -52.257 1.00 56.48 C
ATOM 2950 O LEU A 384 11.636 50.335 -51.596 1.00 56.62 O
ATOM 2951 CB LEU A 384 11.677 48.974 -54.546 1.00 54.36 C
ATOM 2952 CG LEU A 384 10.187 49.249 -54.713 1.00 53.04 C
ATOM 2953 CD1 LEU A 384 9.986 50.600 -55.371 1.00 54.16 C
ATOM 2954 CD2 LEU A 384 9.560 48.142 -55.560 1.00 51.36 C
ATOM 2955 N ASN A 385 13.376 48.902 -51.699 1.00 55.71 N
ATOM 2956 CA ASN A 385 13.369 48.596 -50.259 1.00 56.41 C
ATOM 2957 C ASN A 385 14.457 49.277 -49.444 1.00 56.96 C
ATOM 2958 O ASN A 385 14.233 49.654 -48.302 1.00 56.65 O
ATOM 2959 CB ASN A 385 13.486 47.082 -50.010 1.00 55.29 C
ATOM 2960 CG ASN A 385 12.284 46.309 -50.500 1.00 56.49 C
ATOM 2961 OD1 ASN A 385 11.145 46.771 -50.384 1.00 56.50 O
ATOM 2962 ND2 ASN A 385 12.525 45.114 -51.035 1.00 55.86 N
ATOM 2963 N TYR A 386 15.645 49.395 -50.022 1.00 58.78 N
ATOM 2964 CA TYR A 386 16.775 50.018 -49.349 1.00 59.25 C
ATOM 2965 C TYR A 386 17.088 51.387 -49.964 1.00 59.32 C
ATOM 2966 O TYR A 386 17.918 52.135 -49.443 1.00 57.32 O
ATOM 2967 CB TYR A 386 18.005 49.125 -49.469 1.00 59.63 C
ATOM 2968 CG TYR A 386 17.808 47.706 -48.995 1.00 62.36 C
ATOM 2969 CD1 TYR A 386 17.400 47.430 -47.687 1.00 63.27 C
ATOM 2970 CD2 TYR A 386 18.104 46.627 -49.832 1.00 63.01 C
ATOM 2971 CE1 TYR A 386 17.300 46.104 -47.219 1.00 64.14 C
ATOM 2972 CE2 TYR A 386 18.009 45.305 -49.377 1.00 64.42 C
ATOM 2973 CZ TYR A 386 17.612 45.053 -48.072 1.00 64.56 C
ATOM 2974 OH TYR A 386 17.546 43.755 -47.620 1.00 66.00 O
ATOM 2975 N GLY A 387 16.414 51.709 -51.069 1.00 59.93 N
ATOM 2976 CA GLY A 387 16.661 52.971 -51.749 1.00 60.74 C
ATOM 2977 C GLY A 387 18.092 53.039 -52.280 1.00 61.20 C
ATOM 2978 O GLY A 387 18.667 54.121 -52.411 1.00 60.46 O
ATOM 2979 N ARG A 388 18.663 51.876 -52.590 1.00 60.19 N
ATOM 2980 CA ARG A 388 20.027 51.788 -53.078 1.00 58.71 C
ATOM 2981 C ARG A 388 20.378 50.316 -53.238 1.00 59.09 C
ATOM 2982 O ARG A 388 19.868 49.471 -52.515 1.00 60.08 O
ATOM 2983 CB ARG A 388 20.976 52.419 -52.067 1.00 58.01 C
ATOM 2984 CG ARG A 388 21.261 51.536 -50.863 1.00 59.46 C
ATOM 2985 CD ARG A 388 21.991 52.298 -49.758 1.00 59.33 C
ATOM 2986 NE ARG A 388 22.418 51.434 -48.652 1.00 60.06 N
ATOM 2987 CZ ARG A 388 23.410 50.547 -48.727 1.00 60.77 C
ATOM 2988 NH1 ARG A 388 23.727 49.803 -47.673 1.00 59.12 N
ATOM 2989 NH2 ARG A 388 24.094 50.403 -49.856 1.00 62.18 N
ATOM 2990 N ARG A 389 21.256 50.008 -54.182 1.00 59.35 N
ATOM 2991 CA ARG A 389 21.658 48.630 -54.410 1.00 59.03 C
ATOM 2992 C ARG A 389 22.673 48.271 -53.358 1.00 60.01 C
ATOM 2993 O ARG A 389 23.415 49.135 -52.901 1.00 60.32 O
ATOM 2994 CB ARG A 389 22.278 48.476 -55.800 1.00 56.76 C
ATOM 2995 CG ARG A 389 23.047 47.185 -56.002 1.00 56.96 C
ATOM 2996 CD ARG A 389 22.157 45.957 -55.953 1.00 56.48 C
ATOM 2997 NE ARG A 389 22.924 44.707 -56.005 1.00 57.39 N
ATOM 2998 CZ ARG A 389 23.245 44.051 -57.120 1.00 56.86 C
ATOM 2999 NH1 ARG A 389 22.868 44.508 -58.304 1.00 58.54 N
ATOM 3000 NH2 ARG A 389 23.945 42.929 -57.052 1.00 56.08 N
ATOM 3001 N ILE A 390 22.685 47.006 -52.955 1.00 61.28 N
ATOM 3002 CA ILE A 390 23.642 46.530 -51.963 1.00 63.17 C
ATOM 3003 C ILE A 390 24.469 45.432 -52.627 1.00 64.62 C
ATOM 3004 O ILE A 390 23.957 44.363 -52.967 1.00 64.76 O
ATOM 3005 CB ILE A 390 22.941 45.966 -50.694 1.00 62.94 C
ATOM 3006 CG1 ILE A 390 22.209 47.097 -49.958 1.00 63.17 C
ATOM 3007 CG2 ILE A 390 23.965 45.323 -49.773 1.00 61.35 C
ATOM 3008 CD1 ILE A 390 21.442 46.658 -48.716 1.00 61.76 C
ATOM 3009 N SER A 391 25.750 45.717 -52.824 1.00 65.48 N
ATOM 3010 CA SER A 391 26.663 44.776 -53.466 1.00 65.98 C
ATOM 3011 C SER A 391 26.777 43.447 -52.732 1.00 65.23 C
ATOM 3012 O SER A 391 26.423 43.342 -51.562 1.00 64.90 O
ATOM 3013 CB SER A 391 28.057 45.397 -53.569 1.00 66.74 C
ATOM 3014 OG SER A 391 28.588 45.658 -52.280 1.00 67.23 O
ATOM 3015 N LEU A 392 27.278 42.434 -53.429 1.00 64.57 N
ATOM 3016 CA LEU A 392 27.470 41.133 -52.817 1.00 65.04 C
ATOM 3017 C LEU A 392 28.605 41.285 -51.824 1.00 65.73 C
ATOM 3018 O LEU A 392 28.722 40.526 -50.859 1.00 65.40 O
ATOM 3019 CB LEU A 392 27.875 40.095 -53.857 1.00 65.63 C
ATOM 3020 CG LEU A 392 26.811 39.543 -54.796 1.00 66.40 C
ATOM 3021 CD1 LEU A 392 27.455 38.521 -55.732 1.00 66.48 C
ATOM 3022 CD2 LEU A 392 25.702 38.899 -53.975 1.00 67.25 C
ATOM 3023 N GLU A 393 29.454 42.275 -52.075 1.00 66.94 N
ATOM 3024 CA GLU A 393 30.600 42.517 -51.219 1.00 66.62 C
ATOM 3025 C GLU A 393 30.177 43.106 -49.891 1.00 64.98 C
ATOM 3026 O GLU A 393 30.818 42.844 -48.870 1.00 63.79 O
ATOM 3027 CB GLU A 393 31.593 43.446 -51.911 1.00 68.67 C
ATOM 3028 CG GLU A 393 32.758 43.837 -51.033 1.00 71.25 C
ATOM 3029 CD GLU A 393 33.712 44.759 -51.740 1.00 72.03 C
ATOM 3030 OE1 GLU A 393 33.239 45.756 -52.324 1.00 72.12 O
ATOM 3031 OE2 GLU A 393 34.930 44.484 -51.706 1.00 74.45 O
ATOM 3032 N GLU A 394 29.108 43.905 -49.905 1.00 63.77 N
ATOM 3033 CA GLU A 394 28.611 44.501 -48.665 1.00 62.65 C
ATOM 3034 C GLU A 394 27.971 43.362 -47.883 1.00 61.63 C
ATOM 3035 O GLU A 394 28.333 43.119 -46.731 1.00 62.22 O
ATOM 3036 CB GLU A 394 27.578 45.594 -48.930 1.00 61.52 C
ATOM 3037 CG GLU A 394 27.345 46.480 -47.721 1.00 61.70 C
ATOM 3038 CD GLU A 394 26.213 47.476 -47.925 1.00 64.56 C
ATOM 3039 OE1 GLU A 394 26.148 48.113 -48.996 1.00 66.22 O
ATOM 3040 OE2 GLU A 394 25.383 47.639 -47.006 1.00 65.87 O
ATOM 3041 N TRP A 395 27.033 42.657 -48.519 1.00 59.28 N
ATOM 3042 CA TRP A 395 26.379 41.516 -47.879 1.00 57.58 C
ATOM 3043 C TRP A 395 27.448 40.631 -47.250 1.00 58.30 C
ATOM 3044 O TRP A 395 27.400 40.336 -46.054 1.00 60.49 O
ATOM 3045 CB TRP A 395 25.593 40.673 -48.892 1.00 53.51 C
ATOM 3046 CG TRP A 395 24.248 41.185 -49.236 1.00 49.85 C
ATOM 3047 CD1 TRP A 395 23.649 41.125 -50.450 1.00 49.54 C
ATOM 3048 CD2 TRP A 395 23.317 41.839 -48.360 1.00 49.93 C
ATOM 3049 NE1 TRP A 395 22.403 41.705 -50.401 1.00 50.16 N
ATOM 3050 CE2 TRP A 395 22.173 42.153 -49.127 1.00 50.01 C
ATOM 3051 CE3 TRP A 395 23.337 42.192 -47.003 1.00 49.47 C
ATOM 3052 CZ2 TRP A 395 21.055 42.806 -48.583 1.00 49.35 C
ATOM 3053 CZ3 TRP A 395 22.223 42.843 -46.465 1.00 49.11 C
ATOM 3054 CH2 TRP A 395 21.100 43.142 -47.257 1.00 47.29 C
ATOM 3055 N ASP A 396 28.422 40.215 -48.051 1.00 57.43 N
ATOM 3056 CA ASP A 396 29.461 39.355 -47.534 1.00 57.46 C
ATOM 3057 C ASP A 396 30.180 39.990 -46.363 1.00 57.43 C
ATOM 3058 O ASP A 396 30.659 39.301 -45.463 1.00 57.16 O
ATOM 3059 CB ASP A 396 30.466 39.011 -48.610 1.00 58.37 C
ATOM 3060 CG ASP A 396 31.508 38.059 -48.108 1.00 60.07 C
ATOM 3061 OD1 ASP A 396 32.397 38.492 -47.338 1.00 61.98 O
ATOM 3062 OD2 ASP A 396 31.421 36.870 -48.463 1.00 60.51 O
ATOM 3063 N SER A 397 30.257 41.312 -46.375 1.00 57.88 N
ATOM 3064 CA SER A 397 30.915 42.034 -45.291 1.00 58.61 C
ATOM 3065 C SER A 397 30.113 41.853 -44.010 1.00 58.11 C
ATOM 3066 O SER A 397 30.662 41.598 -42.932 1.00 58.21 O
ATOM 3067 CB SER A 397 31.001 43.526 -45.625 1.00 58.62 C
ATOM 3068 OG SER A 397 31.310 44.288 -44.471 1.00 59.21 O
ATOM 3069 N ARG A 398 28.800 41.996 -44.154 1.00 56.68 N
ATOM 3070 CA ARG A 398 27.869 41.867 -43.053 1.00 55.06 C
ATOM 3071 C ARG A 398 27.797 40.422 -42.578 1.00 55.42 C
ATOM 3072 O ARG A 398 27.855 40.147 -41.377 1.00 55.45 O
ATOM 3073 CB ARG A 398 26.505 42.340 -43.515 1.00 52.64 C
ATOM 3074 CG ARG A 398 26.549 43.731 -44.081 1.00 50.57 C
ATOM 3075 CD ARG A 398 25.211 44.109 -44.657 1.00 50.28 C
ATOM 3076 NE ARG A 398 25.064 45.553 -44.756 1.00 49.23 N
ATOM 3077 CZ ARG A 398 25.331 46.397 -43.762 1.00 49.95 C
ATOM 3078 NH1 ARG A 398 25.766 45.932 -42.596 1.00 48.25 N
ATOM 3079 NH2 ARG A 398 25.153 47.707 -43.930 1.00 48.26 N
ATOM 3080 N ILE A 399 27.681 39.500 -43.526 1.00 54.06 N
ATOM 3081 CA ILE A 399 27.598 38.094 -43.190 1.00 55.01 C
ATOM 3082 C ILE A 399 28.809 37.659 -42.396 1.00 57.90 C
ATOM 3083 O ILE A 399 28.694 36.890 -41.442 1.00 59.36 O
ATOM 3084 CB ILE A 399 27.507 37.213 -44.451 1.00 53.56 C
ATOM 3085 CG1 ILE A 399 26.163 37.438 -45.143 1.00 53.33 C
ATOM 3086 CG2 ILE A 399 27.685 35.743 -44.078 1.00 51.85 C
ATOM 3087 CD1 ILE A 399 25.974 36.641 -46.405 1.00 53.49 C
ATOM 3088 N SER A 400 29.976 38.157 -42.791 1.00 60.81 N
ATOM 3089 CA SER A 400 31.224 37.787 -42.130 1.00 62.06 C
ATOM 3090 C SER A 400 31.299 38.185 -40.654 1.00 62.17 C
ATOM 3091 O SER A 400 31.934 37.491 -39.856 1.00 61.81 O
ATOM 3092 CB SER A 400 32.404 38.379 -42.903 1.00 61.84 C
ATOM 3093 OG SER A 400 32.475 37.812 -44.202 1.00 61.45 O
ATOM 3094 N ALA A 401 30.633 39.283 -40.297 1.00 62.16 N
ATOM 3095 CA ALA A 401 30.627 39.783 -38.922 1.00 62.63 C
ATOM 3096 C ALA A 401 29.796 38.939 -37.957 1.00 63.70 C
ATOM 3097 O ALA A 401 29.964 39.024 -36.743 1.00 64.90 O
ATOM 3098 CB ALA A 401 30.125 41.217 -38.894 1.00 60.86 C
ATOM 3099 N VAL A 402 28.904 38.119 -38.501 1.00 64.15 N
ATOM 3100 CA VAL A 402 28.034 37.285 -37.685 1.00 62.76 C
ATOM 3101 C VAL A 402 28.734 36.118 -36.987 1.00 62.49 C
ATOM 3102 O VAL A 402 29.503 35.381 -37.602 1.00 60.05 O
ATOM 3103 CB VAL A 402 26.869 36.715 -38.539 1.00 61.93 C
ATOM 3104 CG1 VAL A 402 25.865 36.003 -37.649 1.00 61.99 C
ATOM 3105 CG2 VAL A 402 26.186 37.832 -39.301 1.00 61.28 C
ATOM 3106 N ASP A 403 28.461 35.973 -35.692 1.00 63.82 N
ATOM 3107 CA ASP A 403 29.003 34.867 -34.898 1.00 65.28 C
ATOM 3108 C ASP A 403 27.906 34.210 -34.046 1.00 65.05 C
ATOM 3109 O ASP A 403 26.789 34.728 -33.935 1.00 64.49 O
ATOM 3110 CB ASP A 403 30.155 35.331 -33.992 1.00 66.08 C
ATOM 3111 CG ASP A 403 29.777 36.500 -33.098 1.00 67.61 C
ATOM 3112 OD1 ASP A 403 28.571 36.778 -32.921 1.00 68.52 O
ATOM 3113 OD2 ASP A 403 30.700 37.140 -32.558 1.00 67.99 O
ATOM 3114 N ALA A 404 28.229 33.063 -33.452 1.00 64.57 N
ATOM 3115 CA ALA A 404 27.269 32.347 -32.625 1.00 63.33 C
ATOM 3116 C ALA A 404 26.563 33.291 -31.645 1.00 63.09 C
ATOM 3117 O ALA A 404 25.338 33.385 -31.653 1.00 63.69 O
ATOM 3118 CB ALA A 404 27.960 31.223 -31.877 1.00 61.29 C
ATOM 3119 N ARG A 405 27.325 34.009 -30.825 1.00 62.83 N
ATOM 3120 CA ARG A 405 26.727 34.917 -29.851 1.00 63.22 C
ATOM 3121 C ARG A 405 25.712 35.858 -30.467 1.00 61.94 C
ATOM 3122 O ARG A 405 24.656 36.109 -29.889 1.00 60.68 O
ATOM 3123 CB ARG A 405 27.797 35.745 -29.139 1.00 66.26 C
ATOM 3124 CG ARG A 405 27.220 36.803 -28.205 1.00 71.75 C
ATOM 3125 CD ARG A 405 28.265 37.344 -27.228 1.00 78.10 C
ATOM 3126 NE ARG A 405 27.830 37.234 -25.829 1.00 83.25 N
ATOM 3127 CZ ARG A 405 26.883 37.983 -25.265 1.00 84.74 C
ATOM 3128 NH1 ARG A 405 26.256 38.914 -25.974 1.00 85.53 N
ATOM 3129 NH2 ARG A 405 26.564 37.798 -23.987 1.00 85.82 N
ATOM 3130 N MET A 406 26.040 36.378 -31.642 1.00 61.15 N
ATOM 3131 CA MET A 406 25.158 37.304 -32.332 1.00 60.24 C
ATOM 3132 C MET A 406 23.859 36.608 -32.738 1.00 59.29 C
ATOM 3133 O MET A 406 22.773 37.173 -32.608 1.00 58.58 O
ATOM 3134 CB MET A 406 25.874 37.860 -33.562 1.00 62.38 C
ATOM 3135 CG MET A 406 25.276 39.142 -34.121 1.00 65.15 C
ATOM 3136 SD MET A 406 26.448 39.996 -35.216 1.00 68.19 S
ATOM 3137 CE MET A 406 25.542 40.043 -36.710 1.00 68.86 C
ATOM 3138 N VAL A 407 23.971 35.377 -33.230 1.00 57.99 N
ATOM 3139 CA VAL A 407 22.792 34.624 -33.636 1.00 55.84 C
ATOM 3140 C VAL A 407 21.888 34.423 -32.425 1.00 54.84 C
ATOM 3141 O VAL A 407 20.679 34.646 -32.495 1.00 54.51 O
ATOM 3142 CB VAL A 407 23.186 33.260 -34.234 1.00 54.93 C
ATOM 3143 CG1 VAL A 407 21.962 32.401 -34.450 1.00 54.83 C
ATOM 3144 CG2 VAL A 407 23.881 33.476 -35.553 1.00 54.32 C
ATOM 3145 N ARG A 408 22.487 34.024 -31.312 1.00 53.56 N
ATOM 3146 CA ARG A 408 21.735 33.816 -30.087 1.00 53.17 C
ATOM 3147 C ARG A 408 20.994 35.062 -29.632 1.00 52.33 C
ATOM 3148 O ARG A 408 19.803 35.007 -29.375 1.00 53.85 O
ATOM 3149 CB ARG A 408 22.654 33.338 -28.969 1.00 52.91 C
ATOM 3150 CG ARG A 408 23.142 31.928 -29.165 1.00 54.24 C
ATOM 3151 CD ARG A 408 23.674 31.380 -27.870 1.00 57.22 C
ATOM 3152 NE ARG A 408 24.873 32.082 -27.434 1.00 60.77 N
ATOM 3153 CZ ARG A 408 26.102 31.742 -27.808 1.00 63.81 C
ATOM 3154 NH1 ARG A 408 26.279 30.705 -28.623 1.00 63.92 N
ATOM 3155 NH2 ARG A 408 27.153 32.436 -27.371 1.00 64.45 N
ATOM 3156 N ASP A 409 21.686 36.185 -29.530 1.00 52.02 N
ATOM 3157 CA ASP A 409 21.026 37.407 -29.091 1.00 53.39 C
ATOM 3158 C ASP A 409 19.923 37.857 -30.041 1.00 51.86 C
ATOM 3159 O ASP A 409 18.833 38.213 -29.606 1.00 51.56 O
ATOM 3160 CB ASP A 409 22.036 38.545 -28.921 1.00 57.19 C
ATOM 3161 CG ASP A 409 23.174 38.180 -27.982 1.00 61.35 C
ATOM 3162 OD1 ASP A 409 23.012 37.228 -27.178 1.00 61.45 O
ATOM 3163 OD2 ASP A 409 24.229 38.854 -28.047 1.00 63.95 O
ATOM 3164 N VAL A 410 20.197 37.852 -31.339 1.00 51.37 N
ATOM 3165 CA VAL A 410 19.182 38.273 -32.302 1.00 51.16 C
ATOM 3166 C VAL A 410 17.991 37.314 -32.261 1.00 49.84 C
ATOM 3167 O VAL A 410 16.845 37.747 -32.163 1.00 48.29 O
ATOM 3168 CB VAL A 410 19.764 38.361 -33.751 1.00 51.15 C
ATOM 3169 CG1 VAL A 410 18.678 38.747 -34.743 1.00 49.01 C
ATOM 3170 CG2 VAL A 410 20.856 39.413 -33.793 1.00 50.37 C
ATOM 3171 N CYS A 411 18.268 36.016 -32.327 1.00 49.01 N
ATOM 3172 CA CYS A 411 17.208 35.013 -32.260 1.00 49.05 C
ATOM 3173 C CYS A 411 16.436 35.097 -30.942 1.00 47.45 C
ATOM 3174 O CYS A 411 15.209 34.995 -30.927 1.00 47.16 O
ATOM 3175 CB CYS A 411 17.798 33.619 -32.426 1.00 50.21 C
ATOM 3176 SG CYS A 411 18.266 33.272 -34.128 1.00 53.47 S
ATOM 3177 N SER A 412 17.154 35.273 -29.840 1.00 45.02 N
ATOM 3178 CA SER A 412 16.502 35.403 -28.559 1.00 45.23 C
ATOM 3179 C SER A 412 15.596 36.611 -28.666 1.00 46.97 C
ATOM 3180 O SER A 412 14.473 36.613 -28.163 1.00 50.27 O
ATOM 3181 CB SER A 412 17.522 35.637 -27.457 1.00 42.58 C
ATOM 3182 OG SER A 412 18.355 34.505 -27.306 1.00 45.29 O
ATOM 3183 N LYS A 413 16.081 37.636 -29.352 1.00 47.98 N
ATOM 3184 CA LYS A 413 15.332 38.870 -29.505 1.00 48.32 C
ATOM 3185 C LYS A 413 13.982 38.736 -30.204 1.00 48.67 C
ATOM 3186 O LYS A 413 12.981 39.274 -29.732 1.00 50.29 O
ATOM 3187 CB LYS A 413 16.186 39.898 -30.245 1.00 50.15 C
ATOM 3188 CG LYS A 413 15.472 41.231 -30.490 1.00 52.74 C
ATOM 3189 CD LYS A 413 16.396 42.243 -31.121 1.00 53.95 C
ATOM 3190 CE LYS A 413 15.715 43.584 -31.341 1.00 56.13 C
ATOM 3191 NZ LYS A 413 16.685 44.545 -31.976 1.00 59.57 N
ATOM 3192 N TYR A 414 13.942 38.020 -31.320 1.00 48.03 N
ATOM 3193 CA TYR A 414 12.700 37.878 -32.066 1.00 47.38 C
ATOM 3194 C TYR A 414 11.885 36.625 -31.767 1.00 48.10 C
ATOM 3195 O TYR A 414 10.680 36.599 -32.031 1.00 48.93 O
ATOM 3196 CB TYR A 414 12.984 37.948 -33.581 1.00 46.60 C
ATOM 3197 CG TYR A 414 13.471 39.310 -34.043 1.00 45.33 C
ATOM 3198 CD1 TYR A 414 14.819 39.654 -33.956 1.00 44.37 C
ATOM 3199 CD2 TYR A 414 12.564 40.299 -34.450 1.00 45.38 C
ATOM 3200 CE1 TYR A 414 15.255 40.943 -34.247 1.00 44.72 C
ATOM 3201 CE2 TYR A 414 12.989 41.602 -34.744 1.00 44.54 C
ATOM 3202 CZ TYR A 414 14.336 41.918 -34.636 1.00 45.45 C
ATOM 3203 OH TYR A 414 14.759 43.207 -34.882 1.00 44.38 O
ATOM 3204 N ILE A 415 12.527 35.606 -31.197 1.00 46.34 N
ATOM 3205 CA ILE A 415 11.860 34.334 -30.918 1.00 44.61 C
ATOM 3206 C ILE A 415 11.498 33.983 -29.474 1.00 42.96 C
ATOM 3207 O ILE A 415 10.348 33.683 -29.157 1.00 42.30 O
ATOM 3208 CB ILE A 415 12.721 33.169 -31.416 1.00 45.71 C
ATOM 3209 CG1 ILE A 415 13.093 33.394 -32.879 1.00 48.01 C
ATOM 3210 CG2 ILE A 415 11.986 31.857 -31.211 1.00 45.65 C
ATOM 3211 CD1 ILE A 415 14.157 32.437 -33.388 1.00 48.52 C
ATOM 3212 N TYR A 416 12.496 33.997 -28.605 1.00 40.77 N
ATOM 3213 CA TYR A 416 12.285 33.598 -27.240 1.00 37.87 C
ATOM 3214 C TYR A 416 11.103 34.214 -26.512 1.00 38.38 C
ATOM 3215 O TYR A 416 10.952 35.434 -26.428 1.00 39.21 O
ATOM 3216 CB TYR A 416 13.548 33.795 -26.428 1.00 34.64 C
ATOM 3217 CG TYR A 416 13.506 32.977 -25.163 1.00 35.33 C
ATOM 3218 CD1 TYR A 416 13.840 31.618 -25.172 1.00 34.58 C
ATOM 3219 CD2 TYR A 416 13.074 33.546 -23.967 1.00 34.33 C
ATOM 3220 CE1 TYR A 416 13.740 30.846 -24.015 1.00 35.47 C
ATOM 3221 CE2 TYR A 416 12.971 32.794 -22.815 1.00 36.31 C
ATOM 3222 CZ TYR A 416 13.298 31.443 -22.837 1.00 37.23 C
ATOM 3223 OH TYR A 416 13.118 30.707 -21.679 1.00 40.45 O
ATOM 3224 N ASP A 417 10.276 33.322 -25.977 1.00 36.78 N
ATOM 3225 CA ASP A 417 9.087 33.660 -25.228 1.00 36.60 C
ATOM 3226 C ASP A 417 8.159 34.628 -25.937 1.00 36.65 C
ATOM 3227 O ASP A 417 7.571 35.502 -25.304 1.00 37.75 O
ATOM 3228 CB ASP A 417 9.440 34.218 -23.844 1.00 34.66 C
ATOM 3229 CG ASP A 417 8.206 34.328 -22.927 1.00 35.20 C
ATOM 3230 OD1 ASP A 417 8.273 35.098 -21.935 1.00 33.24 O
ATOM 3231 OD2 ASP A 417 7.180 33.638 -23.197 1.00 31.06 O
ATOM 3232 N LYS A 418 8.018 34.468 -27.246 1.00 36.38 N
ATOM 3233 CA LYS A 418 7.134 35.327 -28.019 1.00 36.51 C
ATOM 3234 C LYS A 418 5.854 34.578 -28.293 1.00 36.83 C
ATOM 3235 O LYS A 418 5.825 33.365 -28.193 1.00 38.79 O
ATOM 3236 CB LYS A 418 7.770 35.683 -29.358 1.00 36.71 C
ATOM 3237 CG LYS A 418 8.884 36.684 -29.261 1.00 37.98 C
ATOM 3238 CD LYS A 418 8.349 38.067 -28.979 1.00 36.41 C
ATOM 3239 CE LYS A 418 9.478 39.074 -28.892 1.00 38.98 C
ATOM 3240 NZ LYS A 418 8.959 40.466 -28.730 1.00 43.13 N
ATOM 3241 N CYS A 419 4.801 35.294 -28.656 1.00 37.08 N
ATOM 3242 CA CYS A 419 3.533 34.657 -28.973 1.00 36.57 C
ATOM 3243 C CYS A 419 3.505 34.559 -30.473 1.00 36.72 C
ATOM 3244 O CYS A 419 3.413 35.574 -31.155 1.00 40.08 O
ATOM 3245 CB CYS A 419 2.362 35.504 -28.491 1.00 34.74 C
ATOM 3246 SG CYS A 419 2.360 35.663 -26.729 1.00 34.79 S
ATOM 3247 N PRO A 420 3.589 33.339 -31.009 1.00 35.39 N
ATOM 3248 CA PRO A 420 3.580 33.107 -32.454 1.00 34.36 C
ATOM 3249 C PRO A 420 2.227 33.177 -33.139 1.00 34.79 C
ATOM 3250 O PRO A 420 1.163 33.281 -32.510 1.00 35.05 O
ATOM 3251 CB PRO A 420 4.176 31.716 -32.572 1.00 34.57 C
ATOM 3252 CG PRO A 420 3.587 31.034 -31.382 1.00 33.58 C
ATOM 3253 CD PRO A 420 3.795 32.073 -30.286 1.00 33.95 C
ATOM 3254 N ALA A 421 2.294 33.110 -34.459 1.00 33.52 N
ATOM 3255 CA ALA A 421 1.115 33.130 -35.288 1.00 32.68 C
ATOM 3256 C ALA A 421 1.155 31.742 -35.901 1.00 33.22 C
ATOM 3257 O ALA A 421 2.211 31.273 -36.351 1.00 33.15 O
ATOM 3258 CB ALA A 421 1.227 34.201 -36.355 1.00 31.48 C
ATOM 3259 N LEU A 422 0.007 31.084 -35.900 1.00 32.11 N
ATOM 3260 CA LEU A 422 -0.076 29.736 -36.400 1.00 31.39 C
ATOM 3261 C LEU A 422 -1.193 29.519 -37.402 1.00 31.32 C
ATOM 3262 O LEU A 422 -2.312 30.011 -37.232 1.00 32.45 O
ATOM 3263 CB LEU A 422 -0.270 28.780 -35.226 1.00 32.42 C
ATOM 3264 CG LEU A 422 -0.508 27.323 -35.608 1.00 33.40 C
ATOM 3265 CD1 LEU A 422 0.834 26.659 -35.815 1.00 34.58 C
ATOM 3266 CD2 LEU A 422 -1.288 26.605 -34.518 1.00 35.60 C
ATOM 3267 N ALA A 423 -0.875 28.776 -38.454 1.00 30.22 N
ATOM 3268 CA ALA A 423 -1.849 28.436 -39.471 1.00 29.24 C
ATOM 3269 C ALA A 423 -1.700 26.937 -39.721 1.00 29.49 C
ATOM 3270 O ALA A 423 -0.606 26.452 -40.042 1.00 29.21 O
ATOM 3271 CB ALA A 423 -1.602 29.227 -40.743 1.00 24.78 C
ATOM 3272 N ALA A 424 -2.793 26.200 -39.525 1.00 29.25 N
ATOM 3273 CA ALA A 424 -2.786 24.763 -39.749 1.00 28.96 C
ATOM 3274 C ALA A 424 -3.928 24.410 -40.704 1.00 30.62 C
ATOM 3275 O ALA A 424 -5.065 24.849 -40.516 1.00 31.01 O
ATOM 3276 CB ALA A 424 -2.941 24.044 -38.447 1.00 25.47 C
ATOM 3277 N VAL A 425 -3.617 23.645 -41.748 1.00 31.51 N
ATOM 3278 CA VAL A 425 -4.625 23.243 -42.720 1.00 31.95 C
ATOM 3279 C VAL A 425 -4.543 21.740 -42.964 1.00 31.37 C
ATOM 3280 O VAL A 425 -3.461 21.173 -42.935 1.00 32.38 O
ATOM 3281 CB VAL A 425 -4.433 23.971 -44.064 1.00 32.82 C
ATOM 3282 CG1 VAL A 425 -5.695 23.846 -44.917 1.00 32.88 C
ATOM 3283 CG2 VAL A 425 -4.113 25.423 -43.826 1.00 34.27 C
ATOM 3284 N GLY A 426 -5.690 21.109 -43.198 1.00 30.83 N
ATOM 3285 CA GLY A 426 -5.728 19.680 -43.442 1.00 33.34 C
ATOM 3286 C GLY A 426 -6.129 18.825 -42.244 1.00 34.94 C
ATOM 3287 O GLY A 426 -6.945 19.253 -41.410 1.00 35.14 O
ATOM 3288 N PRO A 427 -5.591 17.588 -42.149 1.00 34.92 N
ATOM 3289 CA PRO A 427 -5.875 16.643 -41.052 1.00 34.36 C
ATOM 3290 C PRO A 427 -5.006 16.988 -39.860 1.00 33.70 C
ATOM 3291 O PRO A 427 -4.060 16.273 -39.553 1.00 33.70 O
ATOM 3292 CB PRO A 427 -5.508 15.302 -41.661 1.00 33.77 C
ATOM 3293 CG PRO A 427 -4.343 15.658 -42.527 1.00 33.62 C
ATOM 3294 CD PRO A 427 -4.788 16.939 -43.200 1.00 32.53 C
ATOM 3295 N ILE A 428 -5.347 18.094 -39.200 1.00 34.16 N
ATOM 3296 CA ILE A 428 -4.599 18.620 -38.059 1.00 33.56 C
ATOM 3297 C ILE A 428 -5.017 18.259 -36.624 1.00 34.09 C
ATOM 3298 O ILE A 428 -4.647 18.964 -35.691 1.00 35.54 O
ATOM 3299 CB ILE A 428 -4.543 20.148 -38.149 1.00 31.73 C
ATOM 3300 CG1 ILE A 428 -5.964 20.700 -38.237 1.00 30.83 C
ATOM 3301 CG2 ILE A 428 -3.736 20.567 -39.383 1.00 33.80 C
ATOM 3302 CD1 ILE A 428 -6.051 22.201 -38.175 1.00 27.52 C
ATOM 3303 N GLU A 429 -5.745 17.171 -36.418 1.00 34.67 N
ATOM 3304 CA GLU A 429 -6.146 16.829 -35.059 1.00 36.45 C
ATOM 3305 C GLU A 429 -5.010 16.602 -34.078 1.00 35.28 C
ATOM 3306 O GLU A 429 -5.122 16.941 -32.910 1.00 35.48 O
ATOM 3307 CB GLU A 429 -7.036 15.594 -35.034 1.00 39.11 C
ATOM 3308 CG GLU A 429 -7.567 15.297 -33.649 1.00 44.85 C
ATOM 3309 CD GLU A 429 -8.561 14.151 -33.632 1.00 51.45 C
ATOM 3310 OE1 GLU A 429 -8.113 12.991 -33.501 1.00 51.63 O
ATOM 3311 OE2 GLU A 429 -9.791 14.412 -33.758 1.00 54.26 O
ATOM 3312 N GLN A 430 -3.913 16.026 -34.533 1.00 36.64 N
ATOM 3313 CA GLN A 430 -2.814 15.756 -33.622 1.00 37.72 C
ATOM 3314 C GLN A 430 -2.028 17.011 -33.168 1.00 37.11 C
ATOM 3315 O GLN A 430 -1.303 16.965 -32.178 1.00 36.08 O
ATOM 3316 CB GLN A 430 -1.867 14.723 -34.251 1.00 40.11 C
ATOM 3317 CG GLN A 430 -1.043 13.947 -33.224 1.00 45.82 C
ATOM 3318 CD GLN A 430 0.054 13.093 -33.848 1.00 49.50 C
ATOM 3319 OE1 GLN A 430 1.081 13.602 -34.322 1.00 51.86 O
ATOM 3320 NE2 GLN A 430 -0.162 11.784 -33.851 1.00 51.33 N
ATOM 3321 N LEU A 431 -2.171 18.127 -33.879 1.00 36.13 N
ATOM 3322 CA LEU A 431 -1.457 19.339 -33.499 1.00 35.42 C
ATOM 3323 C LEU A 431 -2.024 19.884 -32.193 1.00 37.25 C
ATOM 3324 O LEU A 431 -3.164 20.331 -32.149 1.00 38.03 O
ATOM 3325 CB LEU A 431 -1.584 20.396 -34.589 1.00 33.49 C
ATOM 3326 CG LEU A 431 -0.854 21.698 -34.271 1.00 33.30 C
ATOM 3327 CD1 LEU A 431 0.624 21.435 -34.256 1.00 31.78 C
ATOM 3328 CD2 LEU A 431 -1.200 22.763 -35.287 1.00 31.77 C
ATOM 3329 N LEU A 432 -1.225 19.879 -31.132 1.00 39.65 N
ATOM 3330 CA LEU A 432 -1.719 20.358 -29.847 1.00 41.57 C
ATOM 3331 C LEU A 432 -2.115 21.818 -29.830 1.00 41.44 C
ATOM 3332 O LEU A 432 -1.744 22.582 -30.721 1.00 42.58 O
ATOM 3333 CB LEU A 432 -0.716 20.050 -28.728 1.00 44.14 C
ATOM 3334 CG LEU A 432 -0.645 18.540 -28.382 1.00 45.59 C
ATOM 3335 CD1 LEU A 432 0.027 18.342 -27.027 1.00 45.40 C
ATOM 3336 CD2 LEU A 432 -2.057 17.941 -28.341 1.00 44.63 C
ATOM 3337 N ASP A 433 -2.879 22.199 -28.811 1.00 40.00 N
ATOM 3338 CA ASP A 433 -3.378 23.565 -28.706 1.00 39.05 C
ATOM 3339 C ASP A 433 -2.324 24.678 -28.602 1.00 37.45 C
ATOM 3340 O ASP A 433 -1.144 24.436 -28.344 1.00 34.65 O
ATOM 3341 CB ASP A 433 -4.330 23.680 -27.522 1.00 38.45 C
ATOM 3342 CG ASP A 433 -3.597 23.839 -26.232 1.00 40.22 C
ATOM 3343 OD1 ASP A 433 -2.965 22.854 -25.808 1.00 43.44 O
ATOM 3344 OD2 ASP A 433 -3.627 24.947 -25.655 1.00 39.85 O
ATOM 3345 N TYR A 434 -2.800 25.910 -28.781 1.00 37.70 N
ATOM 3346 CA TYR A 434 -1.975 27.110 -28.742 1.00 35.84 C
ATOM 3347 C TYR A 434 -1.155 27.217 -27.489 1.00 35.95 C
ATOM 3348 O TYR A 434 0.026 27.556 -27.549 1.00 37.14 O
ATOM 3349 CB TYR A 434 -2.837 28.371 -28.841 1.00 36.10 C
ATOM 3350 CG TYR A 434 -2.017 29.591 -29.163 1.00 36.17 C
ATOM 3351 CD1 TYR A 434 -1.626 29.860 -30.478 1.00 35.00 C
ATOM 3352 CD2 TYR A 434 -1.536 30.418 -28.149 1.00 36.89 C
ATOM 3353 CE1 TYR A 434 -0.772 30.908 -30.776 1.00 35.35 C
ATOM 3354 CE2 TYR A 434 -0.673 31.478 -28.439 1.00 38.68 C
ATOM 3355 CZ TYR A 434 -0.296 31.710 -29.758 1.00 37.77 C
ATOM 3356 OH TYR A 434 0.569 32.734 -30.055 1.00 40.19 O
ATOM 3357 N ASN A 435 -1.787 26.963 -26.343 1.00 35.14 N
ATOM 3358 CA ASN A 435 -1.080 27.041 -25.070 1.00 32.01 C
ATOM 3359 C ASN A 435 0.088 26.087 -25.073 1.00 30.64 C
ATOM 3360 O ASN A 435 1.172 26.456 -24.666 1.00 29.97 O
ATOM 3361 CB ASN A 435 -2.011 26.724 -23.899 1.00 34.35 C
ATOM 3362 CG ASN A 435 -2.883 27.903 -23.507 1.00 35.57 C
ATOM 3363 OD1 ASN A 435 -2.383 28.980 -23.157 1.00 36.93 O
ATOM 3364 ND2 ASN A 435 -4.193 27.705 -23.552 1.00 34.47 N
ATOM 3365 N ARG A 436 -0.115 24.859 -25.537 1.00 31.33 N
ATOM 3366 CA ARG A 436 0.999 23.924 -25.586 1.00 34.42 C
ATOM 3367 C ARG A 436 2.086 24.440 -26.513 1.00 36.18 C
ATOM 3368 O ARG A 436 3.264 24.419 -26.164 1.00 39.48 O
ATOM 3369 CB ARG A 436 0.540 22.547 -26.032 1.00 34.97 C
ATOM 3370 CG ARG A 436 -0.169 21.810 -24.919 1.00 37.32 C
ATOM 3371 CD ARG A 436 0.762 21.644 -23.731 1.00 38.54 C
ATOM 3372 NE ARG A 436 1.525 20.410 -23.855 1.00 40.40 N
ATOM 3373 CZ ARG A 436 1.012 19.209 -23.633 1.00 41.97 C
ATOM 3374 NH1 ARG A 436 -0.258 19.098 -23.267 1.00 43.86 N
ATOM 3375 NH2 ARG A 436 1.752 18.122 -23.801 1.00 42.29 N
ATOM 3376 N ILE A 437 1.700 24.922 -27.686 1.00 35.53 N
ATOM 3377 CA ILE A 437 2.677 25.462 -28.609 1.00 36.19 C
ATOM 3378 C ILE A 437 3.393 26.665 -27.987 1.00 38.41 C
ATOM 3379 O ILE A 437 4.622 26.779 -28.058 1.00 40.07 O
ATOM 3380 CB ILE A 437 2.000 25.892 -29.929 1.00 36.75 C
ATOM 3381 CG1 ILE A 437 1.451 24.646 -30.635 1.00 37.20 C
ATOM 3382 CG2 ILE A 437 3.000 26.626 -30.823 1.00 35.02 C
ATOM 3383 CD1 ILE A 437 0.751 24.912 -31.939 1.00 40.09 C
ATOM 3384 N ARG A 438 2.621 27.563 -27.379 1.00 37.76 N
ATOM 3385 CA ARG A 438 3.175 28.756 -26.764 1.00 35.93 C
ATOM 3386 C ARG A 438 4.257 28.417 -25.763 1.00 36.31 C
ATOM 3387 O ARG A 438 5.173 29.197 -25.551 1.00 35.60 O
ATOM 3388 CB ARG A 438 2.076 29.542 -26.066 1.00 36.03 C
ATOM 3389 CG ARG A 438 2.569 30.790 -25.343 1.00 34.55 C
ATOM 3390 CD ARG A 438 2.962 31.864 -26.315 1.00 34.05 C
ATOM 3391 NE ARG A 438 3.383 33.079 -25.627 1.00 35.73 N
ATOM 3392 CZ ARG A 438 4.508 33.206 -24.925 1.00 38.02 C
ATOM 3393 NH1 ARG A 438 5.368 32.192 -24.796 1.00 34.63 N
ATOM 3394 NH2 ARG A 438 4.776 34.362 -24.342 1.00 39.09 N
ATOM 3395 N SER A 439 4.141 27.255 -25.132 1.00 38.22 N
ATOM 3396 CA SER A 439 5.136 26.825 -24.156 1.00 40.38 C
ATOM 3397 C SER A 439 6.395 26.335 -24.824 1.00 39.67 C
ATOM 3398 O SER A 439 7.440 26.285 -24.207 1.00 40.20 O
ATOM 3399 CB SER A 439 4.576 25.733 -23.268 1.00 40.38 C
ATOM 3400 OG SER A 439 3.651 26.318 -22.385 1.00 45.73 O
ATOM 3401 N GLY A 440 6.286 25.958 -26.087 1.00 39.91 N
ATOM 3402 CA GLY A 440 7.461 25.517 -26.797 1.00 43.20 C
ATOM 3403 C GLY A 440 8.284 26.734 -27.194 1.00 45.93 C
ATOM 3404 O GLY A 440 9.274 26.617 -27.919 1.00 48.44 O
ATOM 3405 N MET A 441 7.880 27.909 -26.716 1.00 46.36 N
ATOM 3406 CA MET A 441 8.583 29.134 -27.047 1.00 45.52 C
ATOM 3407 C MET A 441 9.596 29.537 -25.997 1.00 47.02 C
ATOM 3408 O MET A 441 10.181 30.613 -26.089 1.00 45.58 O
ATOM 3409 CB MET A 441 7.596 30.278 -27.277 1.00 44.99 C
ATOM 3410 CG MET A 441 6.649 30.062 -28.454 1.00 44.73 C
ATOM 3411 SD MET A 441 7.424 29.969 -30.097 1.00 42.36 S
ATOM 3412 CE MET A 441 7.780 31.663 -30.361 1.00 43.18 C
ATOM 3413 N TYR A 442 9.797 28.687 -24.990 1.00 50.24 N
ATOM 3414 CA TYR A 442 10.807 28.974 -23.969 1.00 53.89 C
ATOM 3415 C TYR A 442 11.440 27.747 -23.324 1.00 55.83 C
ATOM 3416 O TYR A 442 10.840 26.677 -23.244 1.00 52.97 O
ATOM 3417 CB TYR A 442 10.276 29.929 -22.892 1.00 54.70 C
ATOM 3418 CG TYR A 442 9.058 29.454 -22.181 1.00 57.74 C
ATOM 3419 CD1 TYR A 442 9.154 28.562 -21.118 1.00 59.52 C
ATOM 3420 CD2 TYR A 442 7.799 29.848 -22.605 1.00 59.35 C
ATOM 3421 CE1 TYR A 442 8.016 28.064 -20.494 1.00 61.87 C
ATOM 3422 CE2 TYR A 442 6.656 29.361 -21.997 1.00 62.74 C
ATOM 3423 CZ TYR A 442 6.763 28.467 -20.944 1.00 63.77 C
ATOM 3424 OH TYR A 442 5.607 27.967 -20.368 1.00 66.33 O
ATOM 3425 N TRP A 443 12.693 27.935 -22.906 1.00 61.65 N
ATOM 3426 CA TRP A 443 13.539 26.922 -22.271 1.00 64.97 C
ATOM 3427 C TRP A 443 13.884 25.756 -23.229 1.00 66.37 C
ATOM 3428 O TRP A 443 13.027 24.930 -23.545 1.00 66.87 O
ATOM 3429 CB TRP A 443 12.860 26.403 -21.000 1.00 66.88 C
ATOM 3430 CG TRP A 443 13.801 25.930 -19.934 1.00 70.28 C
ATOM 3431 CD1 TRP A 443 13.482 25.156 -18.856 1.00 71.53 C
ATOM 3432 CD2 TRP A 443 15.215 26.178 -19.845 1.00 72.93 C
ATOM 3433 NE1 TRP A 443 14.605 24.900 -18.104 1.00 72.63 N
ATOM 3434 CE2 TRP A 443 15.683 25.513 -18.688 1.00 73.67 C
ATOM 3435 CE3 TRP A 443 16.136 26.895 -20.632 1.00 75.53 C
ATOM 3436 CZ2 TRP A 443 17.031 25.543 -18.296 1.00 73.56 C
ATOM 3437 CZ3 TRP A 443 17.484 26.924 -20.239 1.00 74.62 C
ATOM 3438 CH2 TRP A 443 17.910 26.250 -19.082 1.00 74.45 C
ATOM 3439 N ILE A 444 15.134 25.713 -23.702 1.00 67.17 N
ATOM 3440 CA ILE A 444 15.591 24.663 -24.618 1.00 66.52 C
HETATM31817 C2 PEE A2005 4.344 27.066 -14.151 1.00 86.73 C
HETATM31818 C1 PEE A2005 3.787 28.378 -14.804 1.00 85.10 C
HETATM31819 N PEE A2005 8.964 31.569 -18.136 1.00 74.35 N
HETATM31820 C3 PEE A2005 5.532 27.295 -13.149 1.00 87.64 C
HETATM31821 C4 PEE A2005 6.642 30.719 -17.806 1.00 78.63 C
HETATM31822 C5 PEE A2005 7.681 31.805 -17.450 1.00 76.67 C
HETATM31823 C10 PEE A2005 2.481 26.748 -12.471 1.00 89.63 C
HETATM31824 C11 PEE A2005 2.816 26.130 -11.071 1.00 89.64 C
HETATM31825 C12 PEE A2005 2.673 27.104 -9.863 1.00 88.71 C
HETATM31826 C13 PEE A2005 1.324 26.938 -9.125 1.00 87.63 C
HETATM31827 C14 PEE A2005 1.391 26.130 -7.811 1.00 87.72 C
HETATM31828 C15 PEE A2005 0.169 25.214 -7.561 1.00 87.43 C
HETATM31829 C16 PEE A2005 -0.068 24.851 -6.077 1.00 87.65 C
HETATM31830 C17 PEE A2005 -1.385 25.393 -5.472 1.00 87.57 C
HETATM31831 C18 PEE A2005 -1.873 24.532 -4.316 1.00 87.67 C
HETATM31832 C19 PEE A2005 -2.010 24.892 -3.029 1.00 87.60 C
HETATM31833 C20 PEE A2005 -1.879 24.021 -1.786 1.00 88.05 C
HETATM31834 C21 PEE A2005 -0.830 24.519 -0.781 1.00 87.04 C
HETATM31835 C22 PEE A2005 0.360 23.946 -0.491 1.00 84.86 C
HETATM31836 C23 PEE A2005 0.646 22.943 0.624 1.00 81.86 C
HETATM31837 C24 PEE A2005 1.752 21.911 0.289 1.00 81.11 C
HETATM31838 C25 PEE A2005 1.602 20.545 1.004 1.00 80.95 C
HETATM31839 C26 PEE A2005 2.542 19.466 0.418 1.00 81.36 C
HETATM31840 C27 PEE A2005 3.172 18.592 1.515 1.00 81.88 C
HETATM31841 C30 PEE A2005 7.481 27.705 -14.542 1.00 89.91 C
HETATM31842 C31 PEE A2005 8.618 26.849 -13.873 1.00 89.02 C
HETATM31843 C32 PEE A2005 9.488 27.601 -12.831 1.00 87.19 C
HETATM31844 C33 PEE A2005 9.122 27.236 -11.383 1.00 85.76 C
HETATM31845 C34 PEE A2005 9.892 28.092 -10.362 1.00 85.45 C
HETATM31846 C35 PEE A2005 9.843 27.501 -8.939 1.00 84.95 C
HETATM31847 C36 PEE A2005 11.243 27.366 -8.313 1.00 84.11 C
HETATM31848 C37 PEE A2005 11.234 26.518 -7.030 1.00 84.04 C
HETATM31849 C38 PEE A2005 11.178 27.390 -5.761 1.00 85.22 C
HETATM31850 C39 PEE A2005 10.787 26.635 -4.463 1.00 86.16 C
HETATM31851 C40 PEE A2005 11.762 26.869 -3.277 1.00 85.88 C
HETATM31852 C41 PEE A2005 11.145 26.547 -1.901 1.00 85.43 C
HETATM31853 C42 PEE A2005 11.853 27.313 -0.761 1.00 84.81 C
HETATM31854 C43 PEE A2005 11.078 28.539 -0.234 1.00 83.97 C
HETATM31855 C44 PEE A2005 11.556 29.139 1.108 1.00 83.74 C
HETATM31856 C45 PEE A2005 10.431 29.739 1.979 1.00 82.80 C
HETATM31857 C46 PEE A2005 10.888 31.001 2.726 1.00 81.47 C
HETATM31858 O4 PEE A2005 1.593 27.604 -12.607 1.00 90.65 O
HETATM31859 O5 PEE A2005 7.409 27.884 -15.777 1.00 90.15 O
HETATM31860 O2 PEE A2005 3.258 26.225 -13.551 1.00 88.18 O
HETATM31861 O3 PEE A2005 6.550 28.243 -13.625 1.00 89.63 O
HETATM31862 O1P PEE A2005 3.844 29.651 -18.606 1.00 81.72 O
HETATM31863 O2P PEE A2005 2.983 30.956 -16.502 1.00 80.21 O
HETATM31864 O3P PEE A2005 3.904 28.453 -16.261 1.00 82.75 O
HETATM31865 O4P PEE A2005 5.615 30.501 -16.768 1.00 80.99 O
HETATM31866 P PEE A2005 4.085 29.896 -17.030 1.00 82.61 P
HETATM31867 O1 UNL A3015 22.079 7.845 -47.890 1.00 45.40 O
HETATM32696 O HOH A1231 18.414 31.834 -45.199 1.00 41.15 O
HETATM32697 O HOH A1284 -5.829 19.877 -30.263 1.00 44.18 O
TER 32698 HOH A1284
ATOM 3442 N PRO B 19 38.484 42.176 -66.126 1.00103.53 N
ATOM 3443 CA PRO B 19 38.996 41.165 -67.086 1.00103.52 C
ATOM 3444 C PRO B 19 37.896 40.241 -67.628 1.00103.17 C
ATOM 3445 O PRO B 19 38.063 39.021 -67.669 1.00103.84 O
ATOM 3446 CB PRO B 19 40.064 40.367 -66.346 1.00103.47 C
ATOM 3447 CG PRO B 19 40.544 41.394 -65.316 1.00103.64 C
ATOM 3448 CD PRO B 19 39.273 42.139 -64.880 1.00103.09 C
ATOM 3449 N GLY B 20 36.780 40.824 -68.054 1.00101.94 N
ATOM 3450 CA GLY B 20 35.684 40.023 -68.573 1.00100.69 C
ATOM 3451 C GLY B 20 35.905 39.486 -69.977 1.00 99.94 C
ATOM 3452 O GLY B 20 34.945 39.213 -70.699 1.00 99.58 O
ATOM 3453 N ALA B 21 37.168 39.333 -70.368 1.00 99.18 N
ATOM 3454 CA ALA B 21 37.511 38.818 -71.696 1.00 97.89 C
ATOM 3455 C ALA B 21 38.479 37.635 -71.614 1.00 97.05 C
ATOM 3456 O ALA B 21 39.610 37.713 -72.105 1.00 96.30 O
ATOM 3457 CB ALA B 21 38.111 39.926 -72.550 1.00 97.77 C
ATOM 3458 N GLU B 22 38.021 36.552 -70.984 1.00 95.84 N
ATOM 3459 CA GLU B 22 38.794 35.322 -70.816 1.00 94.02 C
ATOM 3460 C GLU B 22 38.480 34.350 -71.954 1.00 93.57 C
ATOM 3461 O GLU B 22 37.462 34.480 -72.634 1.00 92.19 O
ATOM 3462 CB GLU B 22 38.440 34.661 -69.484 1.00 93.80 C
ATOM 3463 CG GLU B 22 39.423 33.603 -68.995 1.00 93.30 C
ATOM 3464 CD GLU B 22 40.626 34.213 -68.295 1.00 93.71 C
ATOM 3465 OE1 GLU B 22 40.557 35.408 -67.924 1.00 92.80 O
ATOM 3466 OE2 GLU B 22 41.631 33.493 -68.099 1.00 93.88 O
ATOM 3467 N ASP B 23 39.353 33.368 -72.152 1.00 93.82 N
ATOM 3468 CA ASP B 23 39.162 32.389 -73.214 1.00 94.23 C
ATOM 3469 C ASP B 23 38.524 31.108 -72.722 1.00 93.40 C
ATOM 3470 O ASP B 23 38.705 30.714 -71.572 1.00 93.76 O
ATOM 3471 CB ASP B 23 40.497 32.042 -73.879 1.00 96.27 C
ATOM 3472 CG ASP B 23 41.006 33.147 -74.789 1.00 97.73 C
ATOM 3473 OD1 ASP B 23 40.202 33.661 -75.598 1.00 97.45 O
ATOM 3474 OD2 ASP B 23 42.210 33.491 -74.704 1.00 98.81 O
ATOM 3475 N LEU B 24 37.786 30.460 -73.614 1.00 91.82 N
ATOM 3476 CA LEU B 24 37.121 29.209 -73.303 1.00 91.02 C
ATOM 3477 C LEU B 24 37.984 28.034 -73.748 1.00 90.64 C
ATOM 3478 O LEU B 24 37.662 27.350 -74.715 1.00 90.30 O
ATOM 3479 CB LEU B 24 35.755 29.164 -73.995 1.00 90.45 C
ATOM 3480 CG LEU B 24 34.975 27.844 -74.071 1.00 90.39 C
ATOM 3481 CD1 LEU B 24 34.900 27.154 -72.723 1.00 90.38 C
ATOM 3482 CD2 LEU B 24 33.592 28.150 -74.577 1.00 89.99 C
ATOM 3483 N GLU B 25 39.079 27.801 -73.031 1.00 90.81 N
ATOM 3484 CA GLU B 25 39.997 26.710 -73.349 1.00 91.57 C
ATOM 3485 C GLU B 25 39.290 25.355 -73.414 1.00 90.82 C
ATOM 3486 O GLU B 25 38.105 25.255 -73.097 1.00 90.63 O
ATOM 3487 CB GLU B 25 41.129 26.684 -72.324 1.00 93.58 C
ATOM 3488 CG GLU B 25 41.831 28.032 -72.198 1.00 97.83 C
ATOM 3489 CD GLU B 25 43.024 28.004 -71.261 1.00100.41 C
ATOM 3490 OE1 GLU B 25 43.952 27.191 -71.487 1.00101.21 O
ATOM 3491 OE2 GLU B 25 43.033 28.807 -70.299 1.00102.27 O
ATOM 3492 N ILE B 26 40.010 24.314 -73.826 1.00 90.00 N
ATOM 3493 CA ILE B 26 39.402 22.994 -73.955 1.00 88.80 C
ATOM 3494 C ILE B 26 40.390 21.909 -74.398 1.00 88.92 C
ATOM 3495 O ILE B 26 40.412 21.514 -75.556 1.00 89.29 O
ATOM 3496 CB ILE B 26 38.207 23.070 -74.947 1.00 87.77 C
ATOM 3497 CG1 ILE B 26 37.660 21.683 -75.255 1.00 86.52 C
ATOM 3498 CG2 ILE B 26 38.636 23.783 -76.216 1.00 88.70 C
ATOM 3499 CD1 ILE B 26 36.564 21.705 -76.299 1.00 85.13 C
ATOM 3500 N THR B 27 41.203 21.427 -73.462 1.00 89.46 N
ATOM 3501 CA THR B 27 42.193 20.384 -73.734 1.00 89.96 C
ATOM 3502 C THR B 27 41.498 19.080 -74.118 1.00 89.86 C
ATOM 3503 O THR B 27 40.288 19.061 -74.322 1.00 89.49 O
ATOM 3504 CB THR B 27 43.076 20.139 -72.483 1.00 90.89 C
ATOM 3505 OG1 THR B 27 43.672 21.378 -72.075 1.00 92.98 O
ATOM 3506 CG2 THR B 27 44.189 19.143 -72.780 1.00 91.73 C
ATOM 3507 N LYS B 28 42.269 18.000 -74.234 1.00 90.45 N
ATOM 3508 CA LYS B 28 41.733 16.682 -74.572 1.00 91.00 C
ATOM 3509 C LYS B 28 42.777 15.586 -74.394 1.00 91.97 C
ATOM 3510 O LYS B 28 43.309 15.070 -75.369 1.00 92.78 O
ATOM 3511 CB LYS B 28 41.214 16.651 -76.012 1.00 89.05 C
ATOM 3512 CG LYS B 28 40.664 15.289 -76.413 1.00 88.37 C
ATOM 3513 CD LYS B 28 39.945 15.338 -77.750 1.00 88.45 C
ATOM 3514 CE LYS B 28 39.333 13.985 -78.108 1.00 87.71 C
ATOM 3515 NZ LYS B 28 38.508 14.055 -79.349 1.00 86.45 N
ATOM 3516 N LEU B 29 43.054 15.226 -73.146 1.00 93.01 N
ATOM 3517 CA LEU B 29 44.033 14.191 -72.823 1.00 94.26 C
ATOM 3518 C LEU B 29 44.095 13.015 -73.800 1.00 94.28 C
ATOM 3519 O LEU B 29 43.141 12.732 -74.526 1.00 93.20 O
ATOM 3520 CB LEU B 29 43.778 13.648 -71.412 1.00 95.56 C
ATOM 3521 CG LEU B 29 43.988 14.605 -70.235 1.00 96.90 C
ATOM 3522 CD1 LEU B 29 43.706 13.855 -68.945 1.00 96.73 C
ATOM 3523 CD2 LEU B 29 45.418 15.151 -70.230 1.00 97.69 C
ATOM 3524 N PRO B 30 45.236 12.305 -73.814 1.00 95.00 N
ATOM 3525 CA PRO B 30 45.456 11.149 -74.687 1.00 95.11 C
ATOM 3526 C PRO B 30 44.454 10.009 -74.515 1.00 95.26 C
ATOM 3527 O PRO B 30 44.143 9.306 -75.477 1.00 95.42 O
ATOM 3528 CB PRO B 30 46.885 10.721 -74.342 1.00 95.76 C
ATOM 3529 CG PRO B 30 47.064 11.191 -72.920 1.00 95.73 C
ATOM 3530 CD PRO B 30 46.425 12.555 -72.975 1.00 95.55 C
ATOM 3531 N ASN B 31 43.943 9.819 -73.301 1.00 94.88 N
ATOM 3532 CA ASN B 31 42.990 8.739 -73.075 1.00 94.37 C
ATOM 3533 C ASN B 31 41.588 9.053 -73.590 1.00 93.34 C
ATOM 3534 O ASN B 31 40.687 8.226 -73.483 1.00 93.83 O
ATOM 3535 CB ASN B 31 42.928 8.372 -71.592 1.00 95.27 C
ATOM 3536 CG ASN B 31 42.234 9.419 -70.758 1.00 95.81 C
ATOM 3537 OD1 ASN B 31 42.110 9.265 -69.543 1.00 97.25 O
ATOM 3538 ND2 ASN B 31 41.776 10.487 -71.398 1.00 95.03 N
ATOM 3539 N GLY B 32 41.407 10.248 -74.145 1.00 92.06 N
ATOM 3540 CA GLY B 32 40.109 10.619 -74.680 1.00 90.62 C
ATOM 3541 C GLY B 32 39.288 11.545 -73.801 1.00 90.09 C
ATOM 3542 O GLY B 32 38.271 12.084 -74.238 1.00 89.82 O
ATOM 3543 N LEU B 33 39.712 11.723 -72.556 1.00 89.48 N
ATOM 3544 CA LEU B 33 38.994 12.601 -71.640 1.00 88.89 C
ATOM 3545 C LEU B 33 39.056 14.039 -72.137 1.00 88.73 C
ATOM 3546 O LEU B 33 40.133 14.560 -72.418 1.00 89.23 O
ATOM 3547 CB LEU B 33 39.606 12.529 -70.243 1.00 88.74 C
ATOM 3548 CG LEU B 33 39.000 13.496 -69.228 1.00 87.61 C
ATOM 3549 CD1 LEU B 33 37.539 13.147 -69.001 1.00 88.22 C
ATOM 3550 CD2 LEU B 33 39.775 13.417 -67.935 1.00 87.70 C
ATOM 3551 N ILE B 34 37.901 14.683 -72.241 1.00 87.64 N
ATOM 3552 CA ILE B 34 37.856 16.061 -72.708 1.00 86.21 C
ATOM 3553 C ILE B 34 37.752 17.006 -71.523 1.00 85.26 C
ATOM 3554 O ILE B 34 37.023 16.740 -70.574 1.00 86.09 O
ATOM 3555 CB ILE B 34 36.670 16.269 -73.669 1.00 86.55 C
ATOM 3556 CG1 ILE B 34 36.898 15.429 -74.931 1.00 87.44 C
ATOM 3557 CG2 ILE B 34 36.512 17.745 -74.008 1.00 84.91 C
ATOM 3558 CD1 ILE B 34 35.731 15.399 -75.890 1.00 88.80 C
ATOM 3559 N ILE B 35 38.496 18.105 -71.582 1.00 83.76 N
ATOM 3560 CA ILE B 35 38.509 19.091 -70.512 1.00 82.19 C
ATOM 3561 C ILE B 35 38.200 20.473 -71.044 1.00 81.41 C
ATOM 3562 O ILE B 35 38.998 21.040 -71.778 1.00 81.87 O
ATOM 3563 CB ILE B 35 39.886 19.160 -69.847 1.00 82.49 C
ATOM 3564 CG1 ILE B 35 40.284 17.779 -69.329 1.00 84.06 C
ATOM 3565 CG2 ILE B 35 39.864 20.169 -68.719 1.00 82.35 C
ATOM 3566 CD1 ILE B 35 41.682 17.728 -68.753 1.00 85.67 C
ATOM 3567 N ALA B 36 37.049 21.022 -70.673 1.00 80.72 N
ATOM 3568 CA ALA B 36 36.670 22.358 -71.122 1.00 80.38 C
ATOM 3569 C ALA B 36 36.466 23.260 -69.912 1.00 80.43 C
ATOM 3570 O ALA B 36 35.713 22.921 -69.010 1.00 81.92 O
ATOM 3571 CB ALA B 36 35.399 22.288 -71.941 1.00 78.91 C
ATOM 3572 N SER B 37 37.141 24.401 -69.877 1.00 80.60 N
ATOM 3573 CA SER B 37 36.984 25.309 -68.749 1.00 81.12 C
ATOM 3574 C SER B 37 36.644 26.698 -69.251 1.00 81.09 C
ATOM 3575 O SER B 37 36.571 26.927 -70.447 1.00 80.63 O
ATOM 3576 CB SER B 37 38.264 25.378 -67.912 1.00 81.62 C
ATOM 3577 OG SER B 37 39.131 26.385 -68.403 1.00 83.41 O
ATOM 3578 N LEU B 38 36.434 27.624 -68.328 1.00 82.16 N
ATOM 3579 CA LEU B 38 36.103 28.995 -68.686 1.00 82.67 C
ATOM 3580 C LEU B 38 36.043 29.880 -67.457 1.00 82.84 C
ATOM 3581 O LEU B 38 35.229 29.666 -66.568 1.00 84.16 O
ATOM 3582 CB LEU B 38 34.760 29.059 -69.419 1.00 81.78 C
ATOM 3583 CG LEU B 38 34.115 30.452 -69.462 1.00 83.23 C
ATOM 3584 CD1 LEU B 38 35.066 31.492 -70.044 1.00 82.57 C
ATOM 3585 CD2 LEU B 38 32.853 30.379 -70.287 1.00 83.11 C
ATOM 3586 N GLU B 39 36.913 30.876 -67.411 1.00 83.38 N
ATOM 3587 CA GLU B 39 36.939 31.800 -66.291 1.00 83.62 C
ATOM 3588 C GLU B 39 36.028 32.989 -66.585 1.00 83.40 C
ATOM 3589 O GLU B 39 36.204 33.690 -67.577 1.00 83.42 O
ATOM 3590 CB GLU B 39 38.367 32.287 -66.047 1.00 83.61 C
ATOM 3591 CG GLU B 39 38.492 33.319 -64.946 1.00 83.87 C
ATOM 3592 CD GLU B 39 37.931 32.821 -63.638 1.00 84.94 C
ATOM 3593 OE1 GLU B 39 36.693 32.863 -63.468 1.00 84.63 O
ATOM 3594 OE2 GLU B 39 38.727 32.368 -62.788 1.00 84.95 O
ATOM 3595 N ASN B 40 35.037 33.200 -65.734 1.00 83.72 N
ATOM 3596 CA ASN B 40 34.130 34.323 -65.916 1.00 84.06 C
ATOM 3597 C ASN B 40 34.229 35.180 -64.678 1.00 84.39 C
ATOM 3598 O ASN B 40 33.454 36.113 -64.488 1.00 83.58 O
ATOM 3599 CB ASN B 40 32.698 33.841 -66.095 1.00 84.01 C
ATOM 3600 CG ASN B 40 32.311 32.806 -65.079 1.00 83.94 C
ATOM 3601 OD1 ASN B 40 33.017 32.583 -64.096 1.00 83.25 O
ATOM 3602 ND2 ASN B 40 31.177 32.165 -65.306 1.00 84.80 N
ATOM 3603 N PHE B 41 35.201 34.840 -63.839 1.00 86.03 N
ATOM 3604 CA PHE B 41 35.463 35.552 -62.594 1.00 87.88 C
ATOM 3605 C PHE B 41 34.254 35.643 -61.657 1.00 87.52 C
ATOM 3606 O PHE B 41 34.225 36.467 -60.737 1.00 87.67 O
ATOM 3607 CB PHE B 41 36.019 36.951 -62.900 1.00 89.53 C
ATOM 3608 CG PHE B 41 37.355 36.929 -63.597 1.00 92.53 C
ATOM 3609 CD1 PHE B 41 37.482 37.391 -64.905 1.00 93.12 C
ATOM 3610 CD2 PHE B 41 38.480 36.409 -62.956 1.00 93.75 C
ATOM 3611 CE1 PHE B 41 38.711 37.333 -65.565 1.00 94.47 C
ATOM 3612 CE2 PHE B 41 39.712 36.349 -63.608 1.00 94.35 C
ATOM 3613 CZ PHE B 41 39.827 36.811 -64.915 1.00 94.82 C
ATOM 3614 N SER B 42 33.257 34.794 -61.894 1.00 86.62 N
ATOM 3615 CA SER B 42 32.070 34.762 -61.049 1.00 84.79 C
ATOM 3616 C SER B 42 32.499 34.274 -59.673 1.00 83.44 C
ATOM 3617 O SER B 42 33.368 33.410 -59.561 1.00 83.83 O
ATOM 3618 CB SER B 42 31.026 33.802 -61.616 1.00 85.12 C
ATOM 3619 OG SER B 42 30.024 33.533 -60.652 1.00 84.74 O
ATOM 3620 N PRO B 43 31.898 34.820 -58.608 1.00 81.44 N
ATOM 3621 CA PRO B 43 32.269 34.391 -57.257 1.00 80.30 C
ATOM 3622 C PRO B 43 31.936 32.924 -56.987 1.00 79.95 C
ATOM 3623 O PRO B 43 32.355 32.354 -55.980 1.00 79.05 O
ATOM 3624 CB PRO B 43 31.489 35.355 -56.366 1.00 79.68 C
ATOM 3625 CG PRO B 43 30.291 35.691 -57.199 1.00 79.79 C
ATOM 3626 CD PRO B 43 30.865 35.868 -58.567 1.00 79.59 C
ATOM 3627 N ALA B 44 31.199 32.311 -57.905 1.00 79.99 N
ATOM 3628 CA ALA B 44 30.808 30.923 -57.750 1.00 80.21 C
ATOM 3629 C ALA B 44 31.280 30.064 -58.912 1.00 80.63 C
ATOM 3630 O ALA B 44 31.154 30.450 -60.075 1.00 81.41 O
ATOM 3631 CB ALA B 44 29.297 30.831 -57.621 1.00 80.20 C
ATOM 3632 N SER B 45 31.816 28.894 -58.588 1.00 79.92 N
ATOM 3633 CA SER B 45 32.292 27.955 -59.591 1.00 79.43 C
ATOM 3634 C SER B 45 31.295 26.812 -59.700 1.00 79.31 C
ATOM 3635 O SER B 45 30.660 26.446 -58.723 1.00 80.19 O
ATOM 3636 CB SER B 45 33.650 27.393 -59.181 1.00 79.18 C
ATOM 3637 OG SER B 45 34.543 28.441 -58.861 1.00 81.50 O
ATOM 3638 N ARG B 46 31.158 26.241 -60.884 1.00 79.16 N
ATOM 3639 CA ARG B 46 30.233 25.138 -61.073 1.00 78.91 C
ATOM 3640 C ARG B 46 30.858 24.094 -61.979 1.00 78.37 C
ATOM 3641 O ARG B 46 30.717 24.153 -63.198 1.00 79.96 O
ATOM 3642 CB ARG B 46 28.925 25.643 -61.682 1.00 80.28 C
ATOM 3643 CG ARG B 46 27.915 24.549 -62.017 1.00 82.12 C
ATOM 3644 CD ARG B 46 26.577 25.180 -62.390 1.00 84.32 C
ATOM 3645 NE ARG B 46 25.610 24.245 -62.969 1.00 85.59 N
ATOM 3646 CZ ARG B 46 24.901 23.351 -62.285 1.00 85.21 C
ATOM 3647 NH1 ARG B 46 25.037 23.251 -60.969 1.00 84.94 N
ATOM 3648 NH2 ARG B 46 24.040 22.566 -62.928 1.00 85.19 N
ATOM 3649 N ILE B 47 31.551 23.140 -61.370 1.00 76.45 N
ATOM 3650 CA ILE B 47 32.213 22.066 -62.096 1.00 73.21 C
ATOM 3651 C ILE B 47 31.234 20.930 -62.345 1.00 72.57 C
ATOM 3652 O ILE B 47 30.242 20.802 -61.642 1.00 74.33 O
ATOM 3653 CB ILE B 47 33.405 21.550 -61.289 1.00 71.37 C
ATOM 3654 CG1 ILE B 47 34.303 22.729 -60.933 1.00 70.30 C
ATOM 3655 CG2 ILE B 47 34.189 20.528 -62.087 1.00 70.78 C
ATOM 3656 CD1 ILE B 47 35.346 22.404 -59.930 1.00 68.34 C
ATOM 3657 N GLY B 48 31.510 20.118 -63.359 1.00 71.51 N
ATOM 3658 CA GLY B 48 30.643 19.003 -63.683 1.00 68.06 C
ATOM 3659 C GLY B 48 31.353 17.911 -64.465 1.00 66.42 C
ATOM 3660 O GLY B 48 32.361 18.152 -65.132 1.00 67.73 O
ATOM 3661 N VAL B 49 30.827 16.698 -64.372 1.00 63.18 N
ATOM 3662 CA VAL B 49 31.380 15.549 -65.068 1.00 59.90 C
ATOM 3663 C VAL B 49 30.321 15.015 -66.030 1.00 59.27 C
ATOM 3664 O VAL B 49 29.452 14.242 -65.637 1.00 60.04 O
ATOM 3665 CB VAL B 49 31.779 14.450 -64.064 1.00 58.24 C
ATOM 3666 CG1 VAL B 49 32.130 13.167 -64.790 1.00 56.94 C
ATOM 3667 CG2 VAL B 49 32.945 14.930 -63.227 1.00 56.40 C
ATOM 3668 N PHE B 50 30.380 15.444 -67.286 1.00 58.05 N
ATOM 3669 CA PHE B 50 29.418 14.987 -68.276 1.00 58.11 C
ATOM 3670 C PHE B 50 29.797 13.596 -68.742 1.00 59.93 C
ATOM 3671 O PHE B 50 30.972 13.279 -68.849 1.00 61.43 O
ATOM 3672 CB PHE B 50 29.369 15.958 -69.447 1.00 55.36 C
ATOM 3673 CG PHE B 50 28.890 17.332 -69.064 1.00 54.39 C
ATOM 3674 CD1 PHE B 50 29.660 18.147 -68.234 1.00 52.82 C
ATOM 3675 CD2 PHE B 50 27.650 17.795 -69.499 1.00 52.48 C
ATOM 3676 CE1 PHE B 50 29.200 19.406 -67.842 1.00 53.14 C
ATOM 3677 CE2 PHE B 50 27.178 19.048 -69.116 1.00 52.70 C
ATOM 3678 CZ PHE B 50 27.953 19.858 -68.285 1.00 53.35 C
ATOM 3679 N ILE B 51 28.805 12.754 -69.000 1.00 61.72 N
ATOM 3680 CA ILE B 51 29.075 11.389 -69.421 1.00 63.47 C
ATOM 3681 C ILE B 51 28.008 10.864 -70.370 1.00 66.51 C
ATOM 3682 O ILE B 51 26.836 11.217 -70.260 1.00 66.80 O
ATOM 3683 CB ILE B 51 29.117 10.454 -68.221 1.00 62.45 C
ATOM 3684 CG1 ILE B 51 30.024 11.034 -67.142 1.00 61.74 C
ATOM 3685 CG2 ILE B 51 29.598 9.087 -68.661 1.00 63.36 C
ATOM 3686 CD1 ILE B 51 29.972 10.286 -65.833 1.00 61.94 C
ATOM 3687 N LYS B 52 28.422 10.014 -71.301 1.00 69.87 N
ATOM 3688 CA LYS B 52 27.492 9.426 -72.251 1.00 73.14 C
ATOM 3689 C LYS B 52 26.970 8.136 -71.627 1.00 74.71 C
ATOM 3690 O LYS B 52 27.461 7.049 -71.931 1.00 75.93 O
ATOM 3691 CB LYS B 52 28.192 9.108 -73.581 1.00 74.06 C
ATOM 3692 CG LYS B 52 28.835 10.302 -74.259 1.00 75.54 C
ATOM 3693 CD LYS B 52 29.371 9.911 -75.629 1.00 77.34 C
ATOM 3694 CE LYS B 52 30.049 11.081 -76.340 1.00 77.87 C
ATOM 3695 NZ LYS B 52 30.515 10.678 -77.693 1.00 77.63 N
ATOM 3696 N ALA B 53 25.989 8.261 -70.740 1.00 75.56 N
ATOM 3697 CA ALA B 53 25.403 7.100 -70.078 1.00 75.65 C
ATOM 3698 C ALA B 53 23.910 7.346 -69.930 1.00 75.30 C
ATOM 3699 O ALA B 53 23.444 8.456 -70.176 1.00 75.51 O
ATOM 3700 CB ALA B 53 26.050 6.895 -68.715 1.00 75.88 C
ATOM 3701 N GLY B 54 23.158 6.321 -69.541 1.00 74.53 N
ATOM 3702 CA GLY B 54 21.727 6.502 -69.390 1.00 73.46 C
ATOM 3703 C GLY B 54 20.932 5.230 -69.567 1.00 73.09 C
ATOM 3704 O GLY B 54 21.488 4.176 -69.842 1.00 72.25 O
ATOM 3705 N SER B 55 19.621 5.333 -69.399 1.00 74.25 N
ATOM 3706 CA SER B 55 18.735 4.183 -69.537 1.00 75.85 C
ATOM 3707 C SER B 55 18.854 3.568 -70.928 1.00 76.00 C
ATOM 3708 O SER B 55 18.473 2.414 -71.153 1.00 75.39 O
ATOM 3709 CB SER B 55 17.290 4.620 -69.282 1.00 77.04 C
ATOM 3710 OG SER B 55 16.952 5.749 -70.080 1.00 76.09 O
ATOM 3711 N ARG B 56 19.378 4.364 -71.851 1.00 76.48 N
ATOM 3712 CA ARG B 56 19.586 3.966 -73.236 1.00 77.62 C
ATOM 3713 C ARG B 56 20.460 2.708 -73.342 1.00 77.76 C
ATOM 3714 O ARG B 56 20.202 1.817 -74.158 1.00 77.39 O
ATOM 3715 CB ARG B 56 20.242 5.136 -73.973 1.00 78.48 C
ATOM 3716 CG ARG B 56 20.716 4.851 -75.368 1.00 80.32 C
ATOM 3717 CD ARG B 56 21.423 6.071 -75.932 1.00 81.20 C
ATOM 3718 NE ARG B 56 21.805 5.873 -77.323 1.00 83.96 N
ATOM 3719 CZ ARG B 56 20.965 5.486 -78.279 1.00 84.98 C
ATOM 3720 NH1 ARG B 56 19.691 5.253 -77.998 1.00 85.93 N
ATOM 3721 NH2 ARG B 56 21.397 5.327 -79.517 1.00 86.61 N
ATOM 3722 N TYR B 57 21.484 2.638 -72.496 1.00 77.63 N
ATOM 3723 CA TYR B 57 22.414 1.518 -72.477 1.00 77.65 C
ATOM 3724 C TYR B 57 21.952 0.331 -71.628 1.00 78.23 C
ATOM 3725 O TYR B 57 22.655 -0.674 -71.511 1.00 79.35 O
ATOM 3726 CB TYR B 57 23.777 2.004 -71.988 1.00 77.59 C
ATOM 3727 CG TYR B 57 24.313 3.152 -72.807 1.00 78.69 C
ATOM 3728 CD1 TYR B 57 23.711 4.409 -72.759 1.00 79.41 C
ATOM 3729 CD2 TYR B 57 25.393 2.974 -73.670 1.00 79.29 C
ATOM 3730 CE1 TYR B 57 24.166 5.460 -73.551 1.00 80.24 C
ATOM 3731 CE2 TYR B 57 25.857 4.021 -74.470 1.00 79.87 C
ATOM 3732 CZ TYR B 57 25.234 5.260 -74.406 1.00 80.00 C
ATOM 3733 OH TYR B 57 25.662 6.293 -75.208 1.00 80.01 O
ATOM 3734 N GLU B 58 20.776 0.439 -71.030 1.00 78.49 N
ATOM 3735 CA GLU B 58 20.263 -0.652 -70.214 1.00 78.26 C
ATOM 3736 C GLU B 58 19.648 -1.666 -71.152 1.00 76.19 C
ATOM 3737 O GLU B 58 19.311 -1.341 -72.284 1.00 75.87 O
ATOM 3738 CB GLU B 58 19.169 -0.158 -69.256 1.00 80.67 C
ATOM 3739 CG GLU B 58 19.626 0.723 -68.085 1.00 83.35 C
ATOM 3740 CD GLU B 58 18.447 1.406 -67.391 1.00 85.32 C
ATOM 3741 OE1 GLU B 58 17.293 0.958 -67.594 1.00 87.13 O
ATOM 3742 OE2 GLU B 58 18.664 2.382 -66.640 1.00 85.85 O
ATOM 3743 N THR B 59 19.520 -2.896 -70.682 1.00 74.35 N
ATOM 3744 CA THR B 59 18.885 -3.939 -71.466 1.00 73.42 C
ATOM 3745 C THR B 59 17.802 -4.464 -70.541 1.00 72.33 C
ATOM 3746 O THR B 59 17.748 -4.084 -69.373 1.00 72.34 O
ATOM 3747 CB THR B 59 19.846 -5.089 -71.812 1.00 74.53 C
ATOM 3748 OG1 THR B 59 20.056 -5.918 -70.660 1.00 75.19 O
ATOM 3749 CG2 THR B 59 21.173 -4.531 -72.274 1.00 74.76 C
ATOM 3750 N THR B 60 16.949 -5.340 -71.049 1.00 70.53 N
ATOM 3751 CA THR B 60 15.870 -5.880 -70.245 1.00 69.28 C
ATOM 3752 C THR B 60 16.349 -6.283 -68.848 1.00 68.26 C
ATOM 3753 O THR B 60 15.745 -5.915 -67.832 1.00 69.12 O
ATOM 3754 CB THR B 60 15.235 -7.106 -70.947 1.00 70.10 C
ATOM 3755 OG1 THR B 60 13.884 -7.262 -70.504 1.00 71.85 O
ATOM 3756 CG2 THR B 60 16.010 -8.388 -70.629 1.00 70.20 C
ATOM 3757 N ALA B 61 17.460 -7.009 -68.807 1.00 66.04 N
ATOM 3758 CA ALA B 61 18.018 -7.520 -67.561 1.00 63.16 C
ATOM 3759 C ALA B 61 18.369 -6.512 -66.477 1.00 61.58 C
ATOM 3760 O ALA B 61 18.224 -6.810 -65.292 1.00 61.52 O
ATOM 3761 CB ALA B 61 19.225 -8.368 -67.868 1.00 63.19 C
ATOM 3762 N ASN B 62 18.836 -5.329 -66.856 1.00 58.61 N
ATOM 3763 CA ASN B 62 19.205 -4.354 -65.849 1.00 55.91 C
ATOM 3764 C ASN B 62 18.421 -3.040 -65.897 1.00 56.17 C
ATOM 3765 O ASN B 62 18.900 -2.012 -65.417 1.00 55.01 O
ATOM 3766 CB ASN B 62 20.723 -4.104 -65.908 1.00 54.85 C
ATOM 3767 CG ASN B 62 21.174 -3.338 -67.155 1.00 55.41 C
ATOM 3768 OD1 ASN B 62 20.563 -3.412 -68.228 1.00 56.65 O
ATOM 3769 ND2 ASN B 62 22.276 -2.613 -67.015 1.00 54.52 N
ATOM 3770 N LEU B 63 17.206 -3.087 -66.448 1.00 56.28 N
ATOM 3771 CA LEU B 63 16.340 -1.901 -66.546 1.00 55.83 C
ATOM 3772 C LEU B 63 16.312 -1.139 -65.230 1.00 56.29 C
ATOM 3773 O LEU B 63 16.364 -1.738 -64.156 1.00 56.38 O
ATOM 3774 CB LEU B 63 14.910 -2.303 -66.914 1.00 54.49 C
ATOM 3775 CG LEU B 63 14.630 -2.780 -68.342 1.00 54.10 C
ATOM 3776 CD1 LEU B 63 13.262 -3.431 -68.427 1.00 54.54 C
ATOM 3777 CD2 LEU B 63 14.709 -1.604 -69.286 1.00 53.24 C
ATOM 3778 N GLY B 64 16.233 0.186 -65.327 1.00 57.15 N
ATOM 3779 CA GLY B 64 16.198 1.036 -64.148 1.00 57.18 C
ATOM 3780 C GLY B 64 17.509 1.210 -63.392 1.00 57.75 C
ATOM 3781 O GLY B 64 17.609 2.068 -62.509 1.00 58.99 O
ATOM 3782 N THR B 65 18.520 0.416 -63.724 1.00 57.34 N
ATOM 3783 CA THR B 65 19.799 0.513 -63.029 1.00 57.69 C
ATOM 3784 C THR B 65 20.417 1.920 -63.127 1.00 57.38 C
ATOM 3785 O THR B 65 21.085 2.380 -62.193 1.00 59.05 O
ATOM 3786 CB THR B 65 20.780 -0.541 -63.555 1.00 57.26 C
ATOM 3787 OG1 THR B 65 22.000 -0.482 -62.816 1.00 57.66 O
ATOM 3788 CG2 THR B 65 21.075 -0.285 -65.000 1.00 61.80 C
ATOM 3789 N ALA B 66 20.181 2.618 -64.233 1.00 56.54 N
ATOM 3790 CA ALA B 66 20.718 3.969 -64.390 1.00 56.14 C
ATOM 3791 C ALA B 66 19.974 4.967 -63.498 1.00 57.19 C
ATOM 3792 O ALA B 66 20.548 5.978 -63.080 1.00 58.37 O
ATOM 3793 CB ALA B 66 20.635 4.410 -65.841 1.00 55.04 C
ATOM 3794 N HIS B 67 18.696 4.698 -63.222 1.00 56.34 N
ATOM 3795 CA HIS B 67 17.908 5.566 -62.352 1.00 54.85 C
ATOM 3796 C HIS B 67 18.479 5.466 -60.937 1.00 54.19 C
ATOM 3797 O HIS B 67 18.810 6.479 -60.314 1.00 52.85 O
ATOM 3798 CB HIS B 67 16.434 5.134 -62.357 1.00 57.15 C
ATOM 3799 CG HIS B 67 15.554 5.919 -61.422 1.00 58.56 C
ATOM 3800 ND1 HIS B 67 14.216 5.630 -61.244 1.00 57.61 N
ATOM 3801 CD2 HIS B 67 15.823 6.960 -60.593 1.00 58.27 C
ATOM 3802 CE1 HIS B 67 13.705 6.452 -60.346 1.00 57.10 C
ATOM 3803 NE2 HIS B 67 14.658 7.268 -59.934 1.00 56.78 N
ATOM 3804 N LEU B 68 18.591 4.239 -60.434 1.00 53.26 N
ATOM 3805 CA LEU B 68 19.135 4.012 -59.100 1.00 53.52 C
ATOM 3806 C LEU B 68 20.544 4.595 -58.948 1.00 53.96 C
ATOM 3807 O LEU B 68 20.918 5.105 -57.886 1.00 53.15 O
ATOM 3808 CB LEU B 68 19.177 2.515 -58.796 1.00 52.48 C
ATOM 3809 CG LEU B 68 19.787 2.191 -57.429 1.00 52.34 C
ATOM 3810 CD1 LEU B 68 19.115 3.027 -56.368 1.00 53.10 C
ATOM 3811 CD2 LEU B 68 19.628 0.720 -57.115 1.00 52.89 C
ATOM 3812 N LEU B 69 21.330 4.496 -60.013 1.00 54.92 N
ATOM 3813 CA LEU B 69 22.691 5.009 -60.002 1.00 56.11 C
ATOM 3814 C LEU B 69 22.675 6.524 -59.798 1.00 56.32 C
ATOM 3815 O LEU B 69 23.568 7.100 -59.170 1.00 56.43 O
ATOM 3816 CB LEU B 69 23.379 4.644 -61.318 1.00 55.77 C
ATOM 3817 CG LEU B 69 24.802 5.163 -61.553 1.00 56.48 C
ATOM 3818 CD1 LEU B 69 25.725 4.794 -60.393 1.00 54.10 C
ATOM 3819 CD2 LEU B 69 25.308 4.592 -62.869 1.00 57.07 C
ATOM 3820 N ARG B 70 21.647 7.158 -60.342 1.00 56.95 N
ATOM 3821 CA ARG B 70 21.462 8.599 -60.233 1.00 58.18 C
ATOM 3822 C ARG B 70 21.244 8.973 -58.756 1.00 59.08 C
ATOM 3823 O ARG B 70 21.758 9.991 -58.264 1.00 59.01 O
ATOM 3824 CB ARG B 70 20.250 9.006 -61.086 1.00 57.98 C
ATOM 3825 CG ARG B 70 19.869 10.454 -60.986 1.00 59.20 C
ATOM 3826 CD ARG B 70 18.971 10.902 -62.144 1.00 61.25 C
ATOM 3827 NE ARG B 70 17.605 10.371 -62.138 1.00 61.16 N
ATOM 3828 CZ ARG B 70 17.176 9.406 -62.945 1.00 63.06 C
ATOM 3829 NH1 ARG B 70 18.010 8.852 -63.820 1.00 64.50 N
ATOM 3830 NH2 ARG B 70 15.906 9.016 -62.909 1.00 62.46 N
ATOM 3831 N LEU B 71 20.491 8.125 -58.055 1.00 57.81 N
ATOM 3832 CA LEU B 71 20.185 8.337 -56.647 1.00 56.73 C
ATOM 3833 C LEU B 71 21.308 7.886 -55.729 1.00 56.54 C
ATOM 3834 O LEU B 71 21.349 8.274 -54.560 1.00 56.99 O
ATOM 3835 CB LEU B 71 18.923 7.567 -56.247 1.00 56.19 C
ATOM 3836 CG LEU B 71 17.609 7.808 -56.990 1.00 56.68 C
ATOM 3837 CD1 LEU B 71 16.553 6.862 -56.419 1.00 55.39 C
ATOM 3838 CD2 LEU B 71 17.183 9.269 -56.879 1.00 53.17 C
ATOM 3839 N ALA B 72 22.208 7.054 -56.246 1.00 55.79 N
ATOM 3840 CA ALA B 72 23.300 6.534 -55.434 1.00 55.02 C
ATOM 3841 C ALA B 72 24.468 7.490 -55.260 1.00 56.05 C
ATOM 3842 O ALA B 72 25.465 7.140 -54.634 1.00 56.79 O
ATOM 3843 CB ALA B 72 23.782 5.225 -56.008 1.00 54.10 C
ATOM 3844 N SER B 73 24.349 8.698 -55.796 1.00 57.33 N
ATOM 3845 CA SER B 73 25.420 9.682 -55.677 1.00 60.63 C
ATOM 3846 C SER B 73 25.918 9.940 -54.255 1.00 62.48 C
ATOM 3847 O SER B 73 27.096 10.248 -54.059 1.00 63.71 O
ATOM 3848 CB SER B 73 25.005 11.011 -56.323 1.00 61.98 C
ATOM 3849 OG SER B 73 23.651 11.337 -56.050 1.00 66.15 O
ATOM 3850 N PRO B 74 25.037 9.823 -53.241 1.00 64.37 N
ATOM 3851 CA PRO B 74 25.511 10.075 -51.873 1.00 63.96 C
ATOM 3852 C PRO B 74 26.085 8.889 -51.101 1.00 62.70 C
ATOM 3853 O PRO B 74 26.509 9.063 -49.960 1.00 63.36 O
ATOM 3854 CB PRO B 74 24.278 10.671 -51.193 1.00 64.29 C
ATOM 3855 CG PRO B 74 23.168 9.902 -51.826 1.00 64.76 C
ATOM 3856 CD PRO B 74 23.561 9.895 -53.296 1.00 64.93 C
ATOM 3857 N LEU B 75 26.106 7.702 -51.708 1.00 61.86 N
ATOM 3858 CA LEU B 75 26.641 6.509 -51.041 1.00 61.57 C
ATOM 3859 C LEU B 75 28.151 6.603 -50.815 1.00 62.75 C
ATOM 3860 O LEU B 75 28.818 7.449 -51.417 1.00 62.49 O
ATOM 3861 CB LEU B 75 26.300 5.258 -51.847 1.00 59.49 C
ATOM 3862 CG LEU B 75 24.790 5.037 -51.923 1.00 59.67 C
ATOM 3863 CD1 LEU B 75 24.470 3.827 -52.783 1.00 59.62 C
ATOM 3864 CD2 LEU B 75 24.251 4.853 -50.519 1.00 60.29 C
ATOM 3865 N THR B 76 28.695 5.747 -49.950 1.00 65.28 N
ATOM 3866 CA THR B 76 30.132 5.807 -49.665 1.00 67.32 C
ATOM 3867 C THR B 76 30.994 5.357 -50.840 1.00 69.07 C
ATOM 3868 O THR B 76 30.614 4.490 -51.638 1.00 69.05 O
ATOM 3869 CB THR B 76 30.544 4.970 -48.417 1.00 66.37 C
ATOM 3870 OG1 THR B 76 30.595 3.584 -48.764 1.00 66.93 O
ATOM 3871 CG2 THR B 76 29.562 5.163 -47.281 1.00 66.04 C
ATOM 3872 N THR B 77 32.165 5.976 -50.929 1.00 70.58 N
ATOM 3873 CA THR B 77 33.133 5.714 -51.978 1.00 71.32 C
ATOM 3874 C THR B 77 34.401 5.216 -51.312 1.00 72.43 C
ATOM 3875 O THR B 77 34.449 5.081 -50.089 1.00 73.91 O
ATOM 3876 CB THR B 77 33.451 7.004 -52.745 1.00 71.29 C
ATOM 3877 OG1 THR B 77 33.859 8.017 -51.815 1.00 70.50 O
ATOM 3878 CG2 THR B 77 32.224 7.489 -53.503 1.00 71.10 C
ATOM 3879 N LYS B 78 35.432 4.954 -52.107 1.00 72.68 N
ATOM 3880 CA LYS B 78 36.692 4.469 -51.557 1.00 72.18 C
ATOM 3881 C LYS B 78 37.437 5.602 -50.866 1.00 70.19 C
ATOM 3882 O LYS B 78 38.249 5.368 -49.975 1.00 69.75 O
ATOM 3883 CB LYS B 78 37.553 3.864 -52.669 1.00 74.58 C
ATOM 3884 CG LYS B 78 36.927 2.632 -53.315 1.00 77.11 C
ATOM 3885 CD LYS B 78 37.647 2.230 -54.599 1.00 79.60 C
ATOM 3886 CE LYS B 78 36.933 1.069 -55.284 1.00 81.13 C
ATOM 3887 NZ LYS B 78 37.538 0.733 -56.607 1.00 83.16 N
ATOM 3888 N GLY B 79 37.136 6.831 -51.261 1.00 68.41 N
ATOM 3889 CA GLY B 79 37.813 7.967 -50.671 1.00 67.09 C
ATOM 3890 C GLY B 79 37.020 8.745 -49.644 1.00 66.85 C
ATOM 3891 O GLY B 79 37.595 9.420 -48.789 1.00 66.72 O
ATOM 3892 N ALA B 80 35.699 8.668 -49.717 1.00 66.40 N
ATOM 3893 CA ALA B 80 34.874 9.398 -48.770 1.00 65.38 C
ATOM 3894 C ALA B 80 33.679 8.561 -48.366 1.00 65.21 C
ATOM 3895 O ALA B 80 33.166 7.776 -49.164 1.00 65.56 O
ATOM 3896 CB ALA B 80 34.411 10.719 -49.387 1.00 63.39 C
ATOM 3897 N SER B 81 33.243 8.720 -47.122 1.00 64.86 N
ATOM 3898 CA SER B 81 32.086 7.984 -46.637 1.00 64.00 C
ATOM 3899 C SER B 81 30.826 8.791 -46.907 1.00 63.63 C
ATOM 3900 O SER B 81 30.861 10.026 -47.022 1.00 62.12 O
ATOM 3901 CB SER B 81 32.196 7.721 -45.135 1.00 64.64 C
ATOM 3902 OG SER B 81 32.159 8.935 -44.400 1.00 65.22 O
ATOM 3903 N SER B 82 29.715 8.070 -47.005 1.00 63.69 N
ATOM 3904 CA SER B 82 28.397 8.654 -47.242 1.00 62.72 C
ATOM 3905 C SER B 82 28.218 9.882 -46.350 1.00 62.00 C
ATOM 3906 O SER B 82 27.705 10.926 -46.775 1.00 61.26 O
ATOM 3907 CB SER B 82 27.330 7.609 -46.915 1.00 61.67 C
ATOM 3908 OG SER B 82 26.037 8.104 -47.167 1.00 64.05 O
ATOM 3909 N PHE B 83 28.659 9.725 -45.106 1.00 61.23 N
ATOM 3910 CA PHE B 83 28.588 10.764 -44.097 1.00 60.31 C
ATOM 3911 C PHE B 83 29.414 11.987 -44.479 1.00 61.51 C
ATOM 3912 O PHE B 83 28.900 13.117 -44.460 1.00 61.35 O
ATOM 3913 CB PHE B 83 29.080 10.209 -42.757 1.00 59.43 C
ATOM 3914 CG PHE B 83 29.188 11.241 -41.674 1.00 59.84 C
ATOM 3915 CD1 PHE B 83 28.050 11.785 -41.093 1.00 59.40 C
ATOM 3916 CD2 PHE B 83 30.432 11.699 -41.258 1.00 60.11 C
ATOM 3917 CE1 PHE B 83 28.149 12.777 -40.113 1.00 58.95 C
ATOM 3918 CE2 PHE B 83 30.541 12.691 -40.280 1.00 60.13 C
ATOM 3919 CZ PHE B 83 29.395 13.229 -39.708 1.00 59.10 C
ATOM 3920 N ARG B 84 30.684 11.772 -44.835 1.00 62.04 N
ATOM 3921 CA ARG B 84 31.554 12.898 -45.179 1.00 61.88 C
ATOM 3922 C ARG B 84 31.222 13.571 -46.498 1.00 59.25 C
ATOM 3923 O ARG B 84 31.443 14.769 -46.660 1.00 57.30 O
ATOM 3924 CB ARG B 84 33.031 12.502 -45.164 1.00 64.33 C
ATOM 3925 CG ARG B 84 33.927 13.728 -45.262 1.00 67.44 C
ATOM 3926 CD ARG B 84 35.361 13.473 -44.855 1.00 69.90 C
ATOM 3927 NE ARG B 84 36.238 13.400 -46.015 1.00 71.90 N
ATOM 3928 CZ ARG B 84 36.464 12.286 -46.694 1.00 74.59 C
ATOM 3929 NH1 ARG B 84 35.878 11.151 -46.318 1.00 75.59 N
ATOM 3930 NH2 ARG B 84 37.275 12.306 -47.747 1.00 75.64 N
ATOM 3931 N ILE B 85 30.692 12.806 -47.440 1.00 57.94 N
ATOM 3932 CA ILE B 85 30.318 13.387 -48.716 1.00 58.05 C
ATOM 3933 C ILE B 85 29.270 14.481 -48.488 1.00 58.77 C
ATOM 3934 O ILE B 85 29.383 15.589 -49.032 1.00 59.31 O
ATOM 3935 CB ILE B 85 29.731 12.333 -49.659 1.00 57.09 C
ATOM 3936 CG1 ILE B 85 30.808 11.321 -50.034 1.00 56.41 C
ATOM 3937 CG2 ILE B 85 29.156 13.009 -50.888 1.00 56.81 C
ATOM 3938 CD1 ILE B 85 30.305 10.175 -50.890 1.00 57.21 C
ATOM 3939 N THR B 86 28.260 14.166 -47.674 1.00 58.15 N
ATOM 3940 CA THR B 86 27.196 15.117 -47.375 1.00 56.86 C
ATOM 3941 C THR B 86 27.666 16.209 -46.419 1.00 55.77 C
ATOM 3942 O THR B 86 27.460 17.400 -46.671 1.00 54.49 O
ATOM 3943 CB THR B 86 25.963 14.416 -46.765 1.00 56.92 C
ATOM 3944 OG1 THR B 86 25.442 13.466 -47.705 1.00 58.44 O
ATOM 3945 CG2 THR B 86 24.873 15.438 -46.438 1.00 55.74 C
ATOM 3946 N ARG B 87 28.299 15.817 -45.322 1.00 54.78 N
ATOM 3947 CA ARG B 87 28.768 16.814 -44.373 1.00 56.65 C
ATOM 3948 C ARG B 87 29.834 17.720 -44.992 1.00 57.27 C
ATOM 3949 O ARG B 87 29.822 18.944 -44.803 1.00 55.79 O
ATOM 3950 CB ARG B 87 29.330 16.136 -43.125 1.00 56.83 C
ATOM 3951 CG ARG B 87 28.281 15.468 -42.264 1.00 57.97 C
ATOM 3952 CD ARG B 87 27.174 16.440 -41.826 1.00 56.85 C
ATOM 3953 NE ARG B 87 26.266 15.794 -40.879 1.00 56.07 N
ATOM 3954 CZ ARG B 87 26.528 15.616 -39.586 1.00 55.08 C
ATOM 3955 NH1 ARG B 87 27.670 16.048 -39.066 1.00 53.94 N
ATOM 3956 NH2 ARG B 87 25.658 14.974 -38.818 1.00 52.95 N
ATOM 3957 N GLY B 88 30.750 17.097 -45.733 1.00 57.84 N
ATOM 3958 CA GLY B 88 31.823 17.825 -46.377 1.00 55.86 C
ATOM 3959 C GLY B 88 31.321 18.910 -47.300 1.00 55.13 C
ATOM 3960 O GLY B 88 31.683 20.079 -47.140 1.00 55.79 O
ATOM 3961 N ILE B 89 30.492 18.535 -48.268 1.00 53.38 N
ATOM 3962 CA ILE B 89 29.966 19.512 -49.207 1.00 53.45 C
ATOM 3963 C ILE B 89 29.155 20.609 -48.526 1.00 55.48 C
ATOM 3964 O ILE B 89 29.241 21.786 -48.910 1.00 55.60 O
ATOM 3965 CB ILE B 89 29.105 18.837 -50.273 1.00 52.97 C
ATOM 3966 CG1 ILE B 89 29.996 17.970 -51.165 1.00 54.12 C
ATOM 3967 CG2 ILE B 89 28.357 19.885 -51.080 1.00 51.58 C
ATOM 3968 CD1 ILE B 89 29.269 17.234 -52.276 1.00 54.42 C
ATOM 3969 N GLU B 90 28.373 20.231 -47.513 1.00 56.70 N
ATOM 3970 CA GLU B 90 27.556 21.202 -46.799 1.00 57.48 C
ATOM 3971 C GLU B 90 28.409 22.127 -45.954 1.00 58.01 C
ATOM 3972 O GLU B 90 28.061 23.298 -45.768 1.00 58.55 O
ATOM 3973 CB GLU B 90 26.527 20.502 -45.916 1.00 57.35 C
ATOM 3974 CG GLU B 90 25.424 19.815 -46.703 1.00 60.55 C
ATOM 3975 CD GLU B 90 24.244 19.385 -45.838 1.00 61.28 C
ATOM 3976 OE1 GLU B 90 24.469 18.649 -44.854 1.00 60.82 O
ATOM 3977 OE2 GLU B 90 23.095 19.780 -46.149 1.00 61.22 O
ATOM 3978 N ALA B 91 29.528 21.606 -45.460 1.00 57.70 N
ATOM 3979 CA ALA B 91 30.430 22.383 -44.620 1.00 57.63 C
ATOM 3980 C ALA B 91 30.796 23.706 -45.270 1.00 59.06 C
ATOM 3981 O ALA B 91 30.993 24.711 -44.586 1.00 59.09 O
ATOM 3982 CB ALA B 91 31.682 21.591 -44.330 1.00 56.62 C
ATOM 3983 N VAL B 92 30.870 23.710 -46.598 1.00 61.11 N
ATOM 3984 CA VAL B 92 31.237 24.923 -47.326 1.00 61.55 C
ATOM 3985 C VAL B 92 30.132 25.431 -48.250 1.00 61.92 C
ATOM 3986 O VAL B 92 30.387 25.820 -49.387 1.00 62.81 O
ATOM 3987 CB VAL B 92 32.525 24.689 -48.146 1.00 61.03 C
ATOM 3988 CG1 VAL B 92 33.694 24.429 -47.201 1.00 59.81 C
ATOM 3989 CG2 VAL B 92 32.330 23.511 -49.104 1.00 59.58 C
ATOM 3990 N GLY B 93 28.901 25.428 -47.752 1.00 61.55 N
ATOM 3991 CA GLY B 93 27.785 25.904 -48.548 1.00 59.16 C
ATOM 3992 C GLY B 93 27.735 25.371 -49.968 1.00 57.37 C
ATOM 3993 O GLY B 93 27.162 26.014 -50.848 1.00 55.47 O
ATOM 3994 N GLY B 94 28.325 24.202 -50.197 1.00 56.88 N
ATOM 3995 CA GLY B 94 28.304 23.630 -51.533 1.00 57.06 C
ATOM 3996 C GLY B 94 27.089 22.753 -51.799 1.00 57.14 C
ATOM 3997 O GLY B 94 26.287 22.489 -50.899 1.00 57.16 O
ATOM 3998 N SER B 95 26.947 22.307 -53.044 1.00 56.40 N
ATOM 3999 CA SER B 95 25.843 21.436 -53.422 1.00 56.30 C
ATOM 4000 C SER B 95 26.328 20.354 -54.376 1.00 55.29 C
ATOM 4001 O SER B 95 27.355 20.505 -55.026 1.00 56.26 O
ATOM 4002 CB SER B 95 24.715 22.242 -54.078 1.00 57.35 C
ATOM 4003 OG SER B 95 25.054 22.698 -55.375 1.00 59.06 O
ATOM 4004 N LEU B 96 25.593 19.256 -54.446 1.00 54.57 N
ATOM 4005 CA LEU B 96 25.950 18.163 -55.328 1.00 55.09 C
ATOM 4006 C LEU B 96 24.670 17.618 -55.924 1.00 56.89 C
ATOM 4007 O LEU B 96 23.740 17.293 -55.201 1.00 57.84 O
ATOM 4008 CB LEU B 96 26.659 17.056 -54.554 1.00 54.37 C
ATOM 4009 CG LEU B 96 26.807 15.728 -55.305 1.00 54.73 C
ATOM 4010 CD1 LEU B 96 27.749 15.912 -56.478 1.00 55.63 C
ATOM 4011 CD2 LEU B 96 27.332 14.660 -54.367 1.00 55.24 C
ATOM 4012 N SER B 97 24.606 17.531 -57.241 1.00 58.48 N
ATOM 4013 CA SER B 97 23.413 17.005 -57.872 1.00 60.98 C
ATOM 4014 C SER B 97 23.771 16.196 -59.116 1.00 62.17 C
ATOM 4015 O SER B 97 24.909 16.223 -59.576 1.00 62.92 O
ATOM 4016 CB SER B 97 22.455 18.152 -58.208 1.00 60.65 C
ATOM 4017 OG SER B 97 23.135 19.208 -58.859 1.00 61.92 O
ATOM 4018 N VAL B 98 22.799 15.466 -59.647 1.00 62.46 N
ATOM 4019 CA VAL B 98 23.024 14.643 -60.816 1.00 62.61 C
ATOM 4020 C VAL B 98 21.822 14.708 -61.741 1.00 64.38 C
ATOM 4021 O VAL B 98 20.723 14.312 -61.366 1.00 66.44 O
ATOM 4022 CB VAL B 98 23.246 13.178 -60.410 1.00 61.86 C
ATOM 4023 CG1 VAL B 98 23.442 12.309 -61.648 1.00 62.74 C
ATOM 4024 CG2 VAL B 98 24.432 13.082 -59.482 1.00 60.38 C
ATOM 4025 N TYR B 99 22.021 15.215 -62.948 1.00 64.91 N
ATOM 4026 CA TYR B 99 20.931 15.281 -63.901 1.00 65.04 C
ATOM 4027 C TYR B 99 21.195 14.234 -64.977 1.00 65.85 C
ATOM 4028 O TYR B 99 22.340 13.876 -65.233 1.00 65.58 O
ATOM 4029 CB TYR B 99 20.857 16.667 -64.535 1.00 64.76 C
ATOM 4030 CG TYR B 99 20.909 17.801 -63.544 1.00 65.60 C
ATOM 4031 CD1 TYR B 99 22.108 18.166 -62.949 1.00 65.28 C
ATOM 4032 CD2 TYR B 99 19.750 18.504 -63.196 1.00 65.92 C
ATOM 4033 CE1 TYR B 99 22.163 19.204 -62.030 1.00 66.38 C
ATOM 4034 CE2 TYR B 99 19.791 19.544 -62.280 1.00 65.86 C
ATOM 4035 CZ TYR B 99 21.005 19.891 -61.698 1.00 66.58 C
ATOM 4036 OH TYR B 99 21.075 20.924 -60.785 1.00 66.64 O
ATOM 4037 N SER B 100 20.138 13.729 -65.601 1.00 66.53 N
ATOM 4038 CA SER B 100 20.327 12.750 -66.648 1.00 68.15 C
ATOM 4039 C SER B 100 19.170 12.645 -67.640 1.00 69.71 C
ATOM 4040 O SER B 100 18.021 12.948 -67.316 1.00 70.59 O
ATOM 4041 CB SER B 100 20.629 11.383 -66.030 1.00 67.23 C
ATOM 4042 OG SER B 100 19.570 10.937 -65.223 1.00 67.79 O
ATOM 4043 N THR B 101 19.506 12.253 -68.867 1.00 70.63 N
ATOM 4044 CA THR B 101 18.534 12.058 -69.936 1.00 71.75 C
ATOM 4045 C THR B 101 18.670 10.586 -70.311 1.00 72.39 C
ATOM 4046 O THR B 101 19.486 9.871 -69.720 1.00 72.29 O
ATOM 4047 CB THR B 101 18.855 12.927 -71.172 1.00 72.20 C
ATOM 4048 OG1 THR B 101 20.204 12.681 -71.597 1.00 73.80 O
ATOM 4049 CG2 THR B 101 18.690 14.398 -70.847 1.00 71.75 C
ATOM 4050 N ARG B 102 17.894 10.123 -71.285 1.00 72.59 N
ATOM 4051 CA ARG B 102 17.992 8.723 -71.669 1.00 72.95 C
ATOM 4052 C ARG B 102 19.412 8.402 -72.125 1.00 72.88 C
ATOM 4053 O ARG B 102 19.831 7.245 -72.084 1.00 72.21 O
ATOM 4054 CB ARG B 102 17.010 8.392 -72.796 1.00 72.92 C
ATOM 4055 CG ARG B 102 15.664 9.041 -72.629 1.00 74.15 C
ATOM 4056 CD ARG B 102 14.517 8.067 -72.797 1.00 75.17 C
ATOM 4057 NE ARG B 102 13.286 8.711 -72.351 1.00 77.33 N
ATOM 4058 CZ ARG B 102 12.152 8.079 -72.057 1.00 78.21 C
ATOM 4059 NH1 ARG B 102 12.063 6.756 -72.163 1.00 78.70 N
ATOM 4060 NH2 ARG B 102 11.108 8.777 -71.627 1.00 77.95 N
ATOM 4061 N GLU B 103 20.166 9.422 -72.533 1.00 73.49 N
ATOM 4062 CA GLU B 103 21.514 9.161 -73.018 1.00 74.15 C
ATOM 4063 C GLU B 103 22.696 9.941 -72.465 1.00 73.26 C
ATOM 4064 O GLU B 103 23.787 9.858 -73.019 1.00 73.57 O
ATOM 4065 CB GLU B 103 21.538 9.243 -74.548 1.00 75.27 C
ATOM 4066 CG GLU B 103 21.426 10.637 -75.137 1.00 75.69 C
ATOM 4067 CD GLU B 103 21.269 10.595 -76.651 1.00 76.14 C
ATOM 4068 OE1 GLU B 103 21.303 11.668 -77.288 1.00 75.52 O
ATOM 4069 OE2 GLU B 103 21.107 9.480 -77.204 1.00 76.61 O
ATOM 4070 N LYS B 104 22.508 10.696 -71.393 1.00 72.75 N
ATOM 4071 CA LYS B 104 23.642 11.411 -70.807 1.00 72.70 C
ATOM 4072 C LYS B 104 23.433 11.703 -69.322 1.00 70.95 C
ATOM 4073 O LYS B 104 22.329 12.026 -68.894 1.00 70.93 O
ATOM 4074 CB LYS B 104 23.942 12.710 -71.571 1.00 74.34 C
ATOM 4075 CG LYS B 104 23.064 13.884 -71.225 1.00 78.40 C
ATOM 4076 CD LYS B 104 23.708 15.187 -71.693 1.00 80.89 C
ATOM 4077 CE LYS B 104 22.976 16.408 -71.131 1.00 82.98 C
ATOM 4078 NZ LYS B 104 23.679 17.684 -71.459 1.00 82.70 N
ATOM 4079 N MET B 105 24.498 11.570 -68.541 1.00 68.69 N
ATOM 4080 CA MET B 105 24.435 11.808 -67.108 1.00 67.09 C
ATOM 4081 C MET B 105 25.427 12.880 -66.688 1.00 67.07 C
ATOM 4082 O MET B 105 26.616 12.786 -66.975 1.00 67.78 O
ATOM 4083 CB MET B 105 24.722 10.512 -66.346 1.00 66.06 C
ATOM 4084 CG MET B 105 23.583 9.511 -66.393 1.00 64.83 C
ATOM 4085 SD MET B 105 23.933 7.955 -65.532 1.00 66.85 S
ATOM 4086 CE MET B 105 24.334 8.548 -63.904 1.00 65.64 C
ATOM 4087 N THR B 106 24.939 13.895 -65.991 1.00 66.50 N
ATOM 4088 CA THR B 106 25.803 14.979 -65.559 1.00 65.76 C
ATOM 4089 C THR B 106 25.881 15.108 -64.033 1.00 65.07 C
ATOM 4090 O THR B 106 24.868 15.281 -63.364 1.00 64.81 O
ATOM 4091 CB THR B 106 25.310 16.316 -66.147 1.00 66.73 C
ATOM 4092 OG1 THR B 106 24.894 16.116 -67.506 1.00 67.40 O
ATOM 4093 CG2 THR B 106 26.423 17.361 -66.112 1.00 66.51 C
ATOM 4094 N TYR B 107 27.094 15.018 -63.496 1.00 64.11 N
ATOM 4095 CA TYR B 107 27.328 15.147 -62.066 1.00 63.87 C
ATOM 4096 C TYR B 107 27.975 16.491 -61.810 1.00 65.70 C
ATOM 4097 O TYR B 107 29.166 16.641 -62.046 1.00 67.55 O
ATOM 4098 CB TYR B 107 28.298 14.084 -61.573 1.00 61.46 C
ATOM 4099 CG TYR B 107 27.759 12.689 -61.515 1.00 60.87 C
ATOM 4100 CD1 TYR B 107 27.312 12.040 -62.661 1.00 60.59 C
ATOM 4101 CD2 TYR B 107 27.736 11.990 -60.309 1.00 60.98 C
ATOM 4102 CE1 TYR B 107 26.856 10.728 -62.608 1.00 60.26 C
ATOM 4103 CE2 TYR B 107 27.287 10.676 -60.243 1.00 59.87 C
ATOM 4104 CZ TYR B 107 26.848 10.051 -61.394 1.00 59.82 C
ATOM 4105 OH TYR B 107 26.402 8.754 -61.325 1.00 59.78 O
ATOM 4106 N CYS B 108 27.228 17.468 -61.317 1.00 67.55 N
ATOM 4107 CA CYS B 108 27.833 18.767 -61.060 1.00 70.39 C
ATOM 4108 C CYS B 108 27.748 19.238 -59.617 1.00 70.05 C
ATOM 4109 O CYS B 108 26.833 18.882 -58.882 1.00 70.73 O
ATOM 4110 CB CYS B 108 27.224 19.822 -61.978 1.00 72.74 C
ATOM 4111 SG CYS B 108 25.440 19.770 -62.036 1.00 79.69 S
ATOM 4112 N VAL B 109 28.723 20.050 -59.231 1.00 69.90 N
ATOM 4113 CA VAL B 109 28.812 20.605 -57.891 1.00 69.77 C
ATOM 4114 C VAL B 109 28.986 22.113 -58.008 1.00 70.30 C
ATOM 4115 O VAL B 109 29.678 22.594 -58.908 1.00 69.54 O
ATOM 4116 CB VAL B 109 30.026 20.040 -57.150 1.00 69.54 C
ATOM 4117 CG1 VAL B 109 29.861 18.553 -56.937 1.00 69.98 C
ATOM 4118 CG2 VAL B 109 31.280 20.297 -57.966 1.00 70.51 C
ATOM 4119 N GLU B 110 28.343 22.859 -57.118 1.00 70.79 N
ATOM 4120 CA GLU B 110 28.467 24.310 -57.126 1.00 72.19 C
ATOM 4121 C GLU B 110 28.945 24.743 -55.763 1.00 72.63 C
ATOM 4122 O GLU B 110 28.600 24.127 -54.764 1.00 73.32 O
ATOM 4123 CB GLU B 110 27.130 24.998 -57.438 1.00 73.05 C
ATOM 4124 CG GLU B 110 26.729 24.962 -58.913 1.00 75.10 C
ATOM 4125 CD GLU B 110 25.962 26.207 -59.360 1.00 76.08 C
ATOM 4126 OE1 GLU B 110 26.461 27.332 -59.122 1.00 75.57 O
ATOM 4127 OE2 GLU B 110 24.870 26.056 -59.957 1.00 76.05 O
ATOM 4128 N CYS B 111 29.764 25.785 -55.726 1.00 73.83 N
ATOM 4129 CA CYS B 111 30.273 26.304 -54.467 1.00 75.80 C
ATOM 4130 C CYS B 111 31.045 27.589 -54.705 1.00 77.02 C
ATOM 4131 O CYS B 111 31.323 27.965 -55.844 1.00 76.70 O
ATOM 4132 CB CYS B 111 31.186 25.290 -53.787 1.00 76.03 C
ATOM 4133 SG CYS B 111 32.750 25.068 -54.615 1.00 77.40 S
ATOM 4134 N LEU B 112 31.388 28.268 -53.621 1.00 78.29 N
ATOM 4135 CA LEU B 112 32.119 29.510 -53.737 1.00 79.04 C
ATOM 4136 C LEU B 112 33.537 29.188 -54.178 1.00 79.96 C
ATOM 4137 O LEU B 112 34.112 28.187 -53.743 1.00 80.56 O
ATOM 4138 CB LEU B 112 32.105 30.247 -52.397 1.00 78.81 C
ATOM 4139 CG LEU B 112 30.691 30.528 -51.870 1.00 78.85 C
ATOM 4140 CD1 LEU B 112 30.778 31.183 -50.489 1.00 78.43 C
ATOM 4141 CD2 LEU B 112 29.924 31.413 -52.869 1.00 76.16 C
ATOM 4142 N ARG B 113 34.075 30.037 -55.056 1.00 80.73 N
ATOM 4143 CA ARG B 113 35.424 29.902 -55.624 1.00 79.71 C
ATOM 4144 C ARG B 113 36.462 29.277 -54.716 1.00 78.78 C
ATOM 4145 O ARG B 113 37.089 28.280 -55.082 1.00 78.27 O
ATOM 4146 CB ARG B 113 35.966 31.265 -56.054 1.00 80.40 C
ATOM 4147 CG ARG B 113 35.086 32.025 -57.019 1.00 82.90 C
ATOM 4148 CD ARG B 113 35.774 33.308 -57.451 1.00 83.22 C
ATOM 4149 NE ARG B 113 36.938 33.022 -58.279 1.00 84.79 N
ATOM 4150 CZ ARG B 113 36.875 32.620 -59.544 1.00 85.24 C
ATOM 4151 NH1 ARG B 113 35.703 32.465 -60.144 1.00 84.98 N
ATOM 4152 NH2 ARG B 113 37.989 32.348 -60.207 1.00 86.59 N
ATOM 4153 N ASP B 114 36.646 29.876 -53.542 1.00 77.52 N
ATOM 4154 CA ASP B 114 37.641 29.416 -52.582 1.00 76.64 C
ATOM 4155 C ASP B 114 37.465 28.004 -52.039 1.00 76.04 C
ATOM 4156 O ASP B 114 38.222 27.587 -51.168 1.00 76.94 O
ATOM 4157 CB ASP B 114 37.733 30.391 -51.403 1.00 77.84 C
ATOM 4158 CG ASP B 114 38.083 31.808 -51.837 1.00 79.53 C
ATOM 4159 OD1 ASP B 114 38.801 31.973 -52.851 1.00 80.02 O
ATOM 4160 OD2 ASP B 114 37.653 32.760 -51.154 1.00 80.02 O
ATOM 4161 N HIS B 115 36.492 27.255 -52.545 1.00 75.13 N
ATOM 4162 CA HIS B 115 36.285 25.905 -52.041 1.00 73.76 C
ATOM 4163 C HIS B 115 36.305 24.837 -53.111 1.00 74.09 C
ATOM 4164 O HIS B 115 36.080 23.663 -52.814 1.00 74.57 O
ATOM 4165 CB HIS B 115 34.968 25.830 -51.271 1.00 72.86 C
ATOM 4166 CG HIS B 115 34.932 26.712 -50.064 1.00 71.65 C
ATOM 4167 ND1 HIS B 115 35.847 26.602 -49.038 1.00 70.91 N
ATOM 4168 CD2 HIS B 115 34.114 27.739 -49.733 1.00 70.74 C
ATOM 4169 CE1 HIS B 115 35.596 27.527 -48.129 1.00 69.97 C
ATOM 4170 NE2 HIS B 115 34.550 28.230 -48.527 1.00 70.30 N
ATOM 4171 N VAL B 116 36.577 25.233 -54.349 1.00 73.91 N
ATOM 4172 CA VAL B 116 36.619 24.282 -55.455 1.00 73.93 C
ATOM 4173 C VAL B 116 37.466 23.033 -55.155 1.00 75.05 C
ATOM 4174 O VAL B 116 37.092 21.923 -55.533 1.00 73.81 O
ATOM 4175 CB VAL B 116 37.159 24.951 -56.725 1.00 73.19 C
ATOM 4176 CG1 VAL B 116 37.023 24.010 -57.890 1.00 72.14 C
ATOM 4177 CG2 VAL B 116 36.411 26.243 -56.995 1.00 73.58 C
ATOM 4178 N ASP B 117 38.600 23.217 -54.478 1.00 77.04 N
ATOM 4179 CA ASP B 117 39.491 22.103 -54.129 1.00 79.00 C
ATOM 4180 C ASP B 117 38.773 21.103 -53.245 1.00 78.37 C
ATOM 4181 O ASP B 117 38.855 19.890 -53.454 1.00 78.27 O
ATOM 4182 CB ASP B 117 40.718 22.606 -53.368 1.00 83.46 C
ATOM 4183 CG ASP B 117 41.626 23.468 -54.221 1.00 88.03 C
ATOM 4184 OD1 ASP B 117 42.105 22.968 -55.267 1.00 90.85 O
ATOM 4185 OD2 ASP B 117 41.864 24.643 -53.845 1.00 90.16 O
ATOM 4186 N THR B 118 38.093 21.642 -52.237 1.00 77.28 N
ATOM 4187 CA THR B 118 37.328 20.863 -51.273 1.00 75.38 C
ATOM 4188 C THR B 118 36.285 20.002 -51.992 1.00 74.06 C
ATOM 4189 O THR B 118 36.389 18.771 -52.044 1.00 73.34 O
ATOM 4190 CB THR B 118 36.607 21.815 -50.286 1.00 75.34 C
ATOM 4191 OG1 THR B 118 37.565 22.690 -49.678 1.00 73.71 O
ATOM 4192 CG2 THR B 118 35.879 21.022 -49.202 1.00 76.02 C
ATOM 4193 N VAL B 119 35.286 20.684 -52.544 1.00 72.24 N
ATOM 4194 CA VAL B 119 34.184 20.073 -53.276 1.00 71.06 C
ATOM 4195 C VAL B 119 34.609 19.089 -54.352 1.00 69.99 C
ATOM 4196 O VAL B 119 33.913 18.111 -54.617 1.00 68.80 O
ATOM 4197 CB VAL B 119 33.313 21.174 -53.934 1.00 71.44 C
ATOM 4198 CG1 VAL B 119 32.536 20.610 -55.097 1.00 71.14 C
ATOM 4199 CG2 VAL B 119 32.357 21.756 -52.908 1.00 72.36 C
ATOM 4200 N MET B 120 35.753 19.354 -54.970 1.00 70.70 N
ATOM 4201 CA MET B 120 36.249 18.508 -56.046 1.00 71.41 C
ATOM 4202 C MET B 120 36.535 17.068 -55.632 1.00 69.94 C
ATOM 4203 O MET B 120 36.204 16.127 -56.364 1.00 68.53 O
ATOM 4204 CB MET B 120 37.503 19.123 -56.654 1.00 74.75 C
ATOM 4205 CG MET B 120 37.779 18.627 -58.056 1.00 79.36 C
ATOM 4206 SD MET B 120 36.549 19.245 -59.232 1.00 84.22 S
ATOM 4207 CE MET B 120 37.605 20.299 -60.225 1.00 85.78 C
ATOM 4208 N GLU B 121 37.153 16.898 -54.465 1.00 68.68 N
ATOM 4209 CA GLU B 121 37.469 15.560 -53.965 1.00 67.76 C
ATOM 4210 C GLU B 121 36.246 14.663 -54.038 1.00 65.62 C
ATOM 4211 O GLU B 121 36.320 13.503 -54.457 1.00 63.36 O
ATOM 4212 CB GLU B 121 37.949 15.620 -52.509 1.00 68.85 C
ATOM 4213 CG GLU B 121 37.772 14.292 -51.769 1.00 69.90 C
ATOM 4214 CD GLU B 121 38.321 14.308 -50.353 1.00 71.70 C
ATOM 4215 OE1 GLU B 121 38.109 15.307 -49.626 1.00 71.55 O
ATOM 4216 OE2 GLU B 121 38.954 13.303 -49.961 1.00 73.17 O
ATOM 4217 N TYR B 122 35.118 15.225 -53.617 1.00 64.75 N
ATOM 4218 CA TYR B 122 33.858 14.505 -53.596 1.00 63.48 C
ATOM 4219 C TYR B 122 33.353 14.208 -55.001 1.00 62.63 C
ATOM 4220 O TYR B 122 33.036 13.062 -55.315 1.00 61.87 O
ATOM 4221 CB TYR B 122 32.825 15.297 -52.772 1.00 61.54 C
ATOM 4222 CG TYR B 122 33.273 15.529 -51.336 1.00 58.03 C
ATOM 4223 CD1 TYR B 122 33.418 16.825 -50.828 1.00 57.25 C
ATOM 4224 CD2 TYR B 122 33.632 14.454 -50.514 1.00 55.59 C
ATOM 4225 CE1 TYR B 122 33.920 17.045 -49.536 1.00 55.77 C
ATOM 4226 CE2 TYR B 122 34.135 14.661 -49.226 1.00 54.10 C
ATOM 4227 CZ TYR B 122 34.281 15.956 -48.747 1.00 55.24 C
ATOM 4228 OH TYR B 122 34.828 16.167 -47.499 1.00 55.59 O
ATOM 4229 N LEU B 123 33.301 15.222 -55.855 1.00 63.15 N
ATOM 4230 CA LEU B 123 32.827 14.996 -57.211 1.00 65.01 C
ATOM 4231 C LEU B 123 33.616 13.856 -57.817 1.00 65.90 C
ATOM 4232 O LEU B 123 33.063 13.000 -58.499 1.00 66.44 O
ATOM 4233 CB LEU B 123 32.993 16.252 -58.068 1.00 64.94 C
ATOM 4234 CG LEU B 123 32.580 16.100 -59.537 1.00 64.36 C
ATOM 4235 CD1 LEU B 123 31.121 15.708 -59.634 1.00 64.04 C
ATOM 4236 CD2 LEU B 123 32.827 17.409 -60.270 1.00 64.42 C
ATOM 4237 N LEU B 124 34.915 13.847 -57.542 1.00 68.24 N
ATOM 4238 CA LEU B 124 35.816 12.819 -58.053 1.00 69.28 C
ATOM 4239 C LEU B 124 35.419 11.423 -57.570 1.00 67.74 C
ATOM 4240 O LEU B 124 35.115 10.540 -58.371 1.00 66.62 O
ATOM 4241 CB LEU B 124 37.245 13.119 -57.604 1.00 72.49 C
ATOM 4242 CG LEU B 124 38.333 12.256 -58.257 1.00 75.96 C
ATOM 4243 CD1 LEU B 124 38.720 12.905 -59.594 1.00 76.33 C
ATOM 4244 CD2 LEU B 124 39.561 12.122 -57.325 1.00 75.05 C
ATOM 4245 N ASN B 125 35.444 11.247 -56.252 1.00 67.35 N
ATOM 4246 CA ASN B 125 35.100 9.984 -55.596 1.00 67.26 C
ATOM 4247 C ASN B 125 33.771 9.378 -56.049 1.00 68.30 C
ATOM 4248 O ASN B 125 33.656 8.169 -56.282 1.00 67.49 O
ATOM 4249 CB ASN B 125 35.062 10.202 -54.088 1.00 64.57 C
ATOM 4250 CG ASN B 125 36.388 9.921 -53.430 1.00 63.91 C
ATOM 4251 OD1 ASN B 125 36.780 8.767 -53.299 1.00 63.95 O
ATOM 4252 ND2 ASN B 125 37.092 10.973 -53.016 1.00 62.66 N
ATOM 4253 N VAL B 126 32.764 10.229 -56.171 1.00 68.98 N
ATOM 4254 CA VAL B 126 31.452 9.776 -56.579 1.00 69.82 C
ATOM 4255 C VAL B 126 31.418 9.179 -57.981 1.00 70.69 C
ATOM 4256 O VAL B 126 30.817 8.129 -58.194 1.00 71.21 O
ATOM 4257 CB VAL B 126 30.438 10.929 -56.486 1.00 69.30 C
ATOM 4258 CG1 VAL B 126 29.116 10.517 -57.103 1.00 69.42 C
ATOM 4259 CG2 VAL B 126 30.238 11.308 -55.030 1.00 68.70 C
ATOM 4260 N THR B 127 32.074 9.834 -58.932 1.00 71.99 N
ATOM 4261 CA THR B 127 32.080 9.368 -60.323 1.00 72.09 C
ATOM 4262 C THR B 127 33.101 8.285 -60.665 1.00 72.25 C
ATOM 4263 O THR B 127 32.904 7.525 -61.611 1.00 71.88 O
ATOM 4264 CB THR B 127 32.329 10.534 -61.302 1.00 71.77 C
ATOM 4265 OG1 THR B 127 33.620 11.096 -61.042 1.00 71.64 O
ATOM 4266 CG2 THR B 127 31.261 11.614 -61.150 1.00 70.86 C
ATOM 4267 N THR B 128 34.183 8.201 -59.900 1.00 72.97 N
ATOM 4268 CA THR B 128 35.213 7.218 -60.205 1.00 73.11 C
ATOM 4269 C THR B 128 35.487 6.153 -59.147 1.00 72.93 C
ATOM 4270 O THR B 128 35.983 5.076 -59.473 1.00 72.12 O
ATOM 4271 CB THR B 128 36.532 7.927 -60.522 1.00 73.44 C
ATOM 4272 OG1 THR B 128 36.987 8.631 -59.361 1.00 74.36 O
ATOM 4273 CG2 THR B 128 36.330 8.923 -61.650 1.00 74.21 C
ATOM 4274 N ALA B 129 35.159 6.431 -57.891 1.00 73.39 N
ATOM 4275 CA ALA B 129 35.427 5.457 -56.836 1.00 73.29 C
ATOM 4276 C ALA B 129 34.239 4.980 -56.006 1.00 72.75 C
ATOM 4277 O ALA B 129 34.358 4.817 -54.794 1.00 73.13 O
ATOM 4278 CB ALA B 129 36.507 6.004 -55.908 1.00 74.17 C
ATOM 4279 N PRO B 130 33.077 4.743 -56.640 1.00 71.97 N
ATOM 4280 CA PRO B 130 31.930 4.278 -55.859 1.00 70.48 C
ATOM 4281 C PRO B 130 32.144 2.863 -55.326 1.00 69.10 C
ATOM 4282 O PRO B 130 32.765 2.043 -55.987 1.00 68.47 O
ATOM 4283 CB PRO B 130 30.782 4.351 -56.865 1.00 70.40 C
ATOM 4284 CG PRO B 130 31.451 4.066 -58.153 1.00 71.34 C
ATOM 4285 CD PRO B 130 32.703 4.911 -58.055 1.00 72.33 C
ATOM 4286 N GLU B 131 31.633 2.588 -54.127 1.00 69.10 N
ATOM 4287 CA GLU B 131 31.757 1.262 -53.524 1.00 68.62 C
ATOM 4288 C GLU B 131 30.468 0.443 -53.573 1.00 68.35 C
ATOM 4289 O GLU B 131 30.506 -0.771 -53.366 1.00 68.56 O
ATOM 4290 CB GLU B 131 32.223 1.373 -52.075 1.00 68.04 C
ATOM 4291 CG GLU B 131 33.688 1.735 -51.929 1.00 70.28 C
ATOM 4292 CD GLU B 131 34.181 1.595 -50.501 1.00 70.54 C
ATOM 4293 OE1 GLU B 131 33.608 0.779 -49.756 1.00 71.22 O
ATOM 4294 OE2 GLU B 131 35.151 2.283 -50.127 1.00 70.85 O
ATOM 4295 N PHE B 132 29.340 1.106 -53.848 1.00 67.86 N
ATOM 4296 CA PHE B 132 28.026 0.456 -53.921 1.00 66.81 C
ATOM 4297 C PHE B 132 27.873 -0.689 -52.922 1.00 66.01 C
ATOM 4298 O PHE B 132 27.519 -1.812 -53.295 1.00 64.52 O
ATOM 4299 CB PHE B 132 27.764 -0.066 -55.335 1.00 67.32 C
ATOM 4300 CG PHE B 132 27.745 1.008 -56.381 1.00 68.72 C
ATOM 4301 CD1 PHE B 132 28.187 0.741 -57.673 1.00 69.36 C
ATOM 4302 CD2 PHE B 132 27.292 2.290 -56.076 1.00 69.33 C
ATOM 4303 CE1 PHE B 132 28.182 1.734 -58.652 1.00 70.77 C
ATOM 4304 CE2 PHE B 132 27.279 3.296 -57.048 1.00 70.60 C
ATOM 4305 CZ PHE B 132 27.727 3.018 -58.340 1.00 70.79 C
ATOM 4306 N ARG B 133 28.148 -0.388 -51.653 1.00 65.43 N
ATOM 4307 CA ARG B 133 28.046 -1.368 -50.578 1.00 64.48 C
ATOM 4308 C ARG B 133 26.656 -1.980 -50.614 1.00 64.43 C
ATOM 4309 O ARG B 133 25.654 -1.267 -50.687 1.00 65.38 O
ATOM 4310 CB ARG B 133 28.300 -0.695 -49.233 1.00 62.78 C
ATOM 4311 CG ARG B 133 29.653 -0.047 -49.154 1.00 61.11 C
ATOM 4312 CD ARG B 133 29.920 0.493 -47.785 1.00 62.11 C
ATOM 4313 NE ARG B 133 31.289 0.976 -47.656 1.00 62.86 N
ATOM 4314 CZ ARG B 133 31.854 1.313 -46.501 1.00 64.60 C
ATOM 4315 NH1 ARG B 133 31.163 1.226 -45.370 1.00 66.84 N
ATOM 4316 NH2 ARG B 133 33.114 1.717 -46.471 1.00 64.72 N
ATOM 4317 N PRO B 134 26.575 -3.313 -50.554 1.00 63.73 N
ATOM 4318 CA PRO B 134 25.294 -4.030 -50.592 1.00 63.62 C
ATOM 4319 C PRO B 134 24.206 -3.447 -49.699 1.00 63.41 C
ATOM 4320 O PRO B 134 23.103 -3.152 -50.163 1.00 63.56 O
ATOM 4321 CB PRO B 134 25.679 -5.449 -50.188 1.00 62.57 C
ATOM 4322 CG PRO B 134 27.078 -5.556 -50.681 1.00 63.16 C
ATOM 4323 CD PRO B 134 27.676 -4.239 -50.257 1.00 63.04 C
ATOM 4324 N TRP B 135 24.515 -3.274 -48.420 1.00 62.34 N
ATOM 4325 CA TRP B 135 23.532 -2.741 -47.497 1.00 61.25 C
ATOM 4326 C TRP B 135 23.069 -1.321 -47.835 1.00 60.61 C
ATOM 4327 O TRP B 135 21.874 -1.047 -47.808 1.00 61.58 O
ATOM 4328 CB TRP B 135 24.062 -2.827 -46.061 1.00 60.47 C
ATOM 4329 CG TRP B 135 25.382 -2.179 -45.827 1.00 58.89 C
ATOM 4330 CD1 TRP B 135 25.605 -0.900 -45.421 1.00 59.12 C
ATOM 4331 CD2 TRP B 135 26.670 -2.778 -45.992 1.00 59.60 C
ATOM 4332 NE1 TRP B 135 26.953 -0.659 -45.319 1.00 59.19 N
ATOM 4333 CE2 TRP B 135 27.630 -1.798 -45.666 1.00 60.10 C
ATOM 4334 CE3 TRP B 135 27.107 -4.050 -46.386 1.00 58.35 C
ATOM 4335 CZ2 TRP B 135 29.008 -2.050 -45.723 1.00 59.82 C
ATOM 4336 CZ3 TRP B 135 28.470 -4.300 -46.441 1.00 56.35 C
ATOM 4337 CH2 TRP B 135 29.405 -3.305 -46.112 1.00 57.74 C
ATOM 4338 N GLU B 136 23.991 -0.424 -48.172 1.00 59.67 N
ATOM 4339 CA GLU B 136 23.609 0.947 -48.516 1.00 57.73 C
ATOM 4340 C GLU B 136 22.698 0.939 -49.737 1.00 57.54 C
ATOM 4341 O GLU B 136 21.777 1.750 -49.851 1.00 58.36 O
ATOM 4342 CB GLU B 136 24.846 1.824 -48.789 1.00 54.53 C
ATOM 4343 CG GLU B 136 25.687 2.105 -47.550 1.00 52.41 C
ATOM 4344 CD GLU B 136 26.894 2.997 -47.813 1.00 52.89 C
ATOM 4345 OE1 GLU B 136 27.719 3.144 -46.887 1.00 51.99 O
ATOM 4346 OE2 GLU B 136 27.028 3.552 -48.927 1.00 53.28 O
ATOM 4347 N VAL B 137 22.945 0.007 -50.646 1.00 57.86 N
ATOM 4348 CA VAL B 137 22.136 -0.086 -51.856 1.00 57.82 C
ATOM 4349 C VAL B 137 20.734 -0.588 -51.533 1.00 58.08 C
ATOM 4350 O VAL B 137 19.744 -0.025 -51.995 1.00 56.88 O
ATOM 4351 CB VAL B 137 22.822 -1.009 -52.907 1.00 55.75 C
ATOM 4352 CG1 VAL B 137 21.873 -1.313 -54.054 1.00 54.05 C
ATOM 4353 CG2 VAL B 137 24.071 -0.325 -53.434 1.00 53.23 C
ATOM 4354 N THR B 138 20.658 -1.639 -50.727 1.00 59.56 N
ATOM 4355 CA THR B 138 19.380 -2.212 -50.332 1.00 61.10 C
ATOM 4356 C THR B 138 18.504 -1.143 -49.675 1.00 61.68 C
ATOM 4357 O THR B 138 17.303 -1.056 -49.939 1.00 62.33 O
ATOM 4358 CB THR B 138 19.579 -3.342 -49.328 1.00 60.61 C
ATOM 4359 OG1 THR B 138 20.715 -4.126 -49.707 1.00 61.79 O
ATOM 4360 CG2 THR B 138 18.373 -4.233 -49.315 1.00 60.88 C
ATOM 4361 N ASP B 139 19.125 -0.336 -48.823 1.00 61.15 N
ATOM 4362 CA ASP B 139 18.450 0.740 -48.111 1.00 61.82 C
ATOM 4363 C ASP B 139 17.922 1.841 -49.002 1.00 61.16 C
ATOM 4364 O ASP B 139 16.887 2.436 -48.718 1.00 62.19 O
ATOM 4365 CB ASP B 139 19.406 1.360 -47.100 1.00 64.01 C
ATOM 4366 CG ASP B 139 19.358 0.664 -45.760 1.00 68.15 C
ATOM 4367 OD1 ASP B 139 19.269 -0.589 -45.740 1.00 70.39 O
ATOM 4368 OD2 ASP B 139 19.411 1.368 -44.727 1.00 68.75 O
ATOM 4369 N LEU B 140 18.648 2.107 -50.078 1.00 60.33 N
ATOM 4370 CA LEU B 140 18.310 3.166 -51.013 1.00 58.32 C
ATOM 4371 C LEU B 140 17.224 2.831 -52.024 1.00 57.71 C
ATOM 4372 O LEU B 140 16.467 3.705 -52.441 1.00 57.25 O
ATOM 4373 CB LEU B 140 19.578 3.588 -51.753 1.00 58.04 C
ATOM 4374 CG LEU B 140 19.450 4.668 -52.821 1.00 57.75 C
ATOM 4375 CD1 LEU B 140 18.947 5.954 -52.204 1.00 56.92 C
ATOM 4376 CD2 LEU B 140 20.795 4.890 -53.458 1.00 57.95 C
ATOM 4377 N GLN B 141 17.133 1.570 -52.417 1.00 57.63 N
ATOM 4378 CA GLN B 141 16.155 1.191 -53.421 1.00 57.60 C
ATOM 4379 C GLN B 141 14.724 1.590 -53.162 1.00 56.76 C
ATOM 4380 O GLN B 141 14.003 1.939 -54.089 1.00 57.45 O
ATOM 4381 CB GLN B 141 16.254 -0.301 -53.715 1.00 58.80 C
ATOM 4382 CG GLN B 141 17.495 -0.594 -54.535 1.00 61.03 C
ATOM 4383 CD GLN B 141 17.400 -1.872 -55.313 1.00 62.18 C
ATOM 4384 OE1 GLN B 141 16.550 -2.020 -56.187 1.00 61.79 O
ATOM 4385 NE2 GLN B 141 18.281 -2.812 -55.001 1.00 65.40 N
ATOM 4386 N PRO B 142 14.273 1.539 -51.909 1.00 56.36 N
ATOM 4387 CA PRO B 142 12.877 1.952 -51.757 1.00 54.76 C
ATOM 4388 C PRO B 142 12.662 3.407 -52.185 1.00 53.23 C
ATOM 4389 O PRO B 142 11.547 3.813 -52.516 1.00 54.14 O
ATOM 4390 CB PRO B 142 12.595 1.690 -50.279 1.00 54.42 C
ATOM 4391 CG PRO B 142 13.953 1.636 -49.652 1.00 56.03 C
ATOM 4392 CD PRO B 142 14.790 0.945 -50.669 1.00 55.57 C
ATOM 4393 N GLN B 143 13.741 4.179 -52.213 1.00 51.20 N
ATOM 4394 CA GLN B 143 13.664 5.573 -52.627 1.00 50.80 C
ATOM 4395 C GLN B 143 13.177 5.725 -54.065 1.00 51.02 C
ATOM 4396 O GLN B 143 12.559 6.721 -54.420 1.00 51.12 O
ATOM 4397 CB GLN B 143 15.023 6.240 -52.515 1.00 50.70 C
ATOM 4398 CG GLN B 143 14.963 7.716 -52.794 1.00 53.32 C
ATOM 4399 CD GLN B 143 14.257 8.477 -51.691 1.00 55.92 C
ATOM 4400 OE1 GLN B 143 13.242 8.029 -51.160 1.00 58.67 O
ATOM 4401 NE2 GLN B 143 14.790 9.636 -51.345 1.00 58.31 N
ATOM 4402 N LEU B 144 13.480 4.744 -54.900 1.00 51.68 N
ATOM 4403 CA LEU B 144 13.061 4.780 -56.286 1.00 52.05 C
ATOM 4404 C LEU B 144 11.550 4.979 -56.366 1.00 52.92 C
ATOM 4405 O LEU B 144 11.061 5.694 -57.245 1.00 51.96 O
ATOM 4406 CB LEU B 144 13.470 3.482 -56.990 1.00 52.58 C
ATOM 4407 CG LEU B 144 14.973 3.184 -57.060 1.00 53.33 C
ATOM 4408 CD1 LEU B 144 15.191 1.720 -57.440 1.00 52.18 C
ATOM 4409 CD2 LEU B 144 15.640 4.131 -58.055 1.00 53.71 C
ATOM 4410 N LYS B 145 10.806 4.355 -55.451 1.00 53.92 N
ATOM 4411 CA LYS B 145 9.344 4.514 -55.448 1.00 54.16 C
ATOM 4412 C LYS B 145 8.984 5.975 -55.215 1.00 52.59 C
ATOM 4413 O LYS B 145 8.190 6.570 -55.951 1.00 51.29 O
ATOM 4414 CB LYS B 145 8.690 3.671 -54.346 1.00 54.75 C
ATOM 4415 CG LYS B 145 8.268 2.298 -54.804 1.00 58.94 C
ATOM 4416 CD LYS B 145 7.781 1.434 -53.651 1.00 61.32 C
ATOM 4417 CE LYS B 145 7.756 -0.042 -54.050 1.00 62.72 C
ATOM 4418 NZ LYS B 145 7.234 -0.902 -52.950 1.00 65.23 N
ATOM 4419 N VAL B 146 9.587 6.543 -54.179 1.00 50.60 N
ATOM 4420 CA VAL B 146 9.337 7.926 -53.809 1.00 49.56 C
ATOM 4421 C VAL B 146 9.711 8.884 -54.928 1.00 49.90 C
ATOM 4422 O VAL B 146 8.887 9.669 -55.391 1.00 50.66 O
ATOM 4423 CB VAL B 146 10.130 8.320 -52.533 1.00 46.93 C
ATOM 4424 CG1 VAL B 146 9.795 9.737 -52.127 1.00 45.46 C
ATOM 4425 CG2 VAL B 146 9.814 7.365 -51.407 1.00 44.79 C
ATOM 4426 N ASP B 147 10.962 8.815 -55.355 1.00 49.90 N
ATOM 4427 CA ASP B 147 11.452 9.686 -56.404 1.00 49.85 C
ATOM 4428 C ASP B 147 10.540 9.642 -57.619 1.00 48.41 C
ATOM 4429 O ASP B 147 10.201 10.679 -58.208 1.00 47.65 O
ATOM 4430 CB ASP B 147 12.867 9.265 -56.805 1.00 54.08 C
ATOM 4431 CG ASP B 147 13.533 10.277 -57.731 1.00 57.85 C
ATOM 4432 OD1 ASP B 147 13.645 11.454 -57.314 1.00 59.44 O
ATOM 4433 OD2 ASP B 147 13.935 9.901 -58.867 1.00 58.63 O
ATOM 4434 N LYS B 148 10.150 8.427 -57.984 1.00 46.00 N
ATOM 4435 CA LYS B 148 9.287 8.206 -59.126 1.00 45.24 C
ATOM 4436 C LYS B 148 7.873 8.755 -58.888 1.00 45.31 C
ATOM 4437 O LYS B 148 7.287 9.381 -59.778 1.00 43.51 O
ATOM 4438 CB LYS B 148 9.251 6.709 -59.447 1.00 43.85 C
ATOM 4439 CG LYS B 148 8.356 6.342 -60.618 1.00 45.62 C
ATOM 4440 CD LYS B 148 8.658 4.940 -61.127 1.00 45.97 C
ATOM 4441 CE LYS B 148 7.750 4.560 -62.273 1.00 46.03 C
ATOM 4442 NZ LYS B 148 8.069 3.202 -62.779 1.00 49.91 N
ATOM 4443 N ALA B 149 7.336 8.525 -57.687 1.00 45.85 N
ATOM 4444 CA ALA B 149 5.997 8.999 -57.328 1.00 44.79 C
ATOM 4445 C ALA B 149 5.881 10.525 -57.450 1.00 44.72 C
ATOM 4446 O ALA B 149 4.877 11.039 -57.950 1.00 44.88 O
ATOM 4447 CB ALA B 149 5.644 8.558 -55.916 1.00 40.42 C
ATOM 4448 N VAL B 150 6.893 11.258 -56.999 1.00 44.02 N
ATOM 4449 CA VAL B 150 6.810 12.699 -57.112 1.00 47.56 C
ATOM 4450 C VAL B 150 6.940 13.129 -58.582 1.00 48.64 C
ATOM 4451 O VAL B 150 6.221 14.017 -59.044 1.00 49.03 O
ATOM 4452 CB VAL B 150 7.885 13.416 -56.247 1.00 48.31 C
ATOM 4453 CG1 VAL B 150 7.806 12.924 -54.820 1.00 50.82 C
ATOM 4454 CG2 VAL B 150 9.274 13.182 -56.804 1.00 51.95 C
ATOM 4455 N ALA B 151 7.844 12.497 -59.323 1.00 49.21 N
ATOM 4456 CA ALA B 151 8.029 12.847 -60.724 1.00 49.29 C
ATOM 4457 C ALA B 151 6.729 12.689 -61.517 1.00 49.44 C
ATOM 4458 O ALA B 151 6.345 13.573 -62.283 1.00 48.84 O
ATOM 4459 CB ALA B 151 9.112 11.985 -61.328 1.00 48.85 C
ATOM 4460 N PHE B 152 6.045 11.570 -61.308 1.00 50.13 N
ATOM 4461 CA PHE B 152 4.806 11.290 -62.016 1.00 51.69 C
ATOM 4462 C PHE B 152 3.600 12.134 -61.658 1.00 52.39 C
ATOM 4463 O PHE B 152 2.499 11.879 -62.144 1.00 52.36 O
ATOM 4464 CB PHE B 152 4.453 9.811 -61.891 1.00 52.40 C
ATOM 4465 CG PHE B 152 5.187 8.940 -62.868 1.00 55.38 C
ATOM 4466 CD1 PHE B 152 6.581 8.884 -62.864 1.00 56.33 C
ATOM 4467 CD2 PHE B 152 4.489 8.198 -63.818 1.00 56.30 C
ATOM 4468 CE1 PHE B 152 7.266 8.103 -63.797 1.00 56.86 C
ATOM 4469 CE2 PHE B 152 5.169 7.417 -64.752 1.00 56.65 C
ATOM 4470 CZ PHE B 152 6.558 7.371 -64.742 1.00 56.09 C
ATOM 4471 N GLN B 153 3.792 13.144 -60.819 1.00 54.79 N
ATOM 4472 CA GLN B 153 2.676 14.011 -60.456 1.00 55.66 C
ATOM 4473 C GLN B 153 2.344 14.910 -61.635 1.00 55.89 C
ATOM 4474 O GLN B 153 1.223 15.423 -61.737 1.00 57.87 O
ATOM 4475 CB GLN B 153 3.013 14.846 -59.232 1.00 54.73 C
ATOM 4476 CG GLN B 153 3.447 13.997 -58.071 1.00 58.26 C
ATOM 4477 CD GLN B 153 3.242 14.683 -56.741 1.00 60.40 C
ATOM 4478 OE1 GLN B 153 2.110 14.845 -56.285 1.00 62.37 O
ATOM 4479 NE2 GLN B 153 4.335 15.097 -56.110 1.00 59.90 N
ATOM 4480 N SER B 154 3.328 15.091 -62.519 1.00 54.69 N
ATOM 4481 CA SER B 154 3.162 15.881 -63.737 1.00 52.57 C
ATOM 4482 C SER B 154 2.783 14.838 -64.787 1.00 52.48 C
ATOM 4483 O SER B 154 3.540 13.895 -65.023 1.00 52.57 O
ATOM 4484 CB SER B 154 4.483 16.536 -64.138 1.00 53.07 C
ATOM 4485 OG SER B 154 5.136 17.151 -63.041 1.00 49.81 O
ATOM 4486 N PRO B 155 1.600 14.972 -65.414 1.00 52.16 N
ATOM 4487 CA PRO B 155 1.185 13.992 -66.431 1.00 52.28 C
ATOM 4488 C PRO B 155 2.195 13.965 -67.570 1.00 52.52 C
ATOM 4489 O PRO B 155 2.402 12.945 -68.218 1.00 50.44 O
ATOM 4490 CB PRO B 155 -0.181 14.515 -66.876 1.00 51.04 C
ATOM 4491 CG PRO B 155 -0.673 15.245 -65.673 1.00 49.61 C
ATOM 4492 CD PRO B 155 0.556 15.988 -65.222 1.00 50.32 C
ATOM 4493 N GLN B 156 2.800 15.127 -67.785 1.00 55.04 N
ATOM 4494 CA GLN B 156 3.818 15.358 -68.788 1.00 57.96 C
ATOM 4495 C GLN B 156 4.778 14.162 -68.791 1.00 58.09 C
ATOM 4496 O GLN B 156 4.913 13.456 -69.784 1.00 58.42 O
ATOM 4497 CB GLN B 156 4.535 16.666 -68.421 1.00 62.20 C
ATOM 4498 CG GLN B 156 5.796 17.024 -69.226 1.00 67.91 C
ATOM 4499 CD GLN B 156 6.751 17.988 -68.473 1.00 69.73 C
ATOM 4500 OE1 GLN B 156 6.346 19.059 -67.992 1.00 69.72 O
ATOM 4501 NE2 GLN B 156 8.021 17.596 -68.377 1.00 69.72 N
ATOM 4502 N VAL B 157 5.415 13.917 -67.657 1.00 59.15 N
ATOM 4503 CA VAL B 157 6.361 12.814 -67.511 1.00 60.16 C
ATOM 4504 C VAL B 157 5.833 11.428 -67.919 1.00 60.42 C
ATOM 4505 O VAL B 157 6.535 10.657 -68.571 1.00 62.07 O
ATOM 4506 CB VAL B 157 6.854 12.729 -66.056 1.00 60.72 C
ATOM 4507 CG1 VAL B 157 5.786 12.090 -65.198 1.00 62.52 C
ATOM 4508 CG2 VAL B 157 8.159 11.954 -65.978 1.00 61.08 C
ATOM 4509 N GLY B 158 4.604 11.108 -67.535 1.00 60.26 N
ATOM 4510 CA GLY B 158 4.046 9.811 -67.866 1.00 59.36 C
ATOM 4511 C GLY B 158 3.876 9.558 -69.346 1.00 60.02 C
ATOM 4512 O GLY B 158 4.223 8.485 -69.836 1.00 60.93 O
ATOM 4513 N VAL B 159 3.344 10.531 -70.073 1.00 60.46 N
ATOM 4514 CA VAL B 159 3.146 10.343 -71.503 1.00 61.70 C
ATOM 4515 C VAL B 159 4.462 10.325 -72.277 1.00 62.63 C
ATOM 4516 O VAL B 159 4.584 9.618 -73.276 1.00 62.60 O
ATOM 4517 CB VAL B 159 2.232 11.421 -72.094 1.00 61.16 C
ATOM 4518 CG1 VAL B 159 0.908 11.419 -71.366 1.00 62.78 C
ATOM 4519 CG2 VAL B 159 2.889 12.762 -71.996 1.00 62.09 C
ATOM 4520 N LEU B 160 5.448 11.095 -71.830 1.00 63.22 N
ATOM 4521 CA LEU B 160 6.733 11.094 -72.517 1.00 63.86 C
ATOM 4522 C LEU B 160 7.393 9.726 -72.370 1.00 64.93 C
ATOM 4523 O LEU B 160 8.077 9.261 -73.287 1.00 64.51 O
ATOM 4524 CB LEU B 160 7.657 12.182 -71.965 1.00 63.80 C
ATOM 4525 CG LEU B 160 7.214 13.615 -72.284 1.00 63.86 C
ATOM 4526 CD1 LEU B 160 8.388 14.561 -72.062 1.00 61.94 C
ATOM 4527 CD2 LEU B 160 6.714 13.705 -73.727 1.00 61.55 C
ATOM 4528 N GLU B 161 7.187 9.088 -71.218 1.00 65.61 N
ATOM 4529 CA GLU B 161 7.742 7.760 -70.973 1.00 65.15 C
ATOM 4530 C GLU B 161 7.117 6.816 -71.977 1.00 63.87 C
ATOM 4531 O GLU B 161 7.823 6.088 -72.668 1.00 64.05 O
ATOM 4532 CB GLU B 161 7.413 7.273 -69.562 1.00 66.41 C
ATOM 4533 CG GLU B 161 8.224 7.921 -68.448 1.00 71.16 C
ATOM 4534 CD GLU B 161 9.659 7.412 -68.369 1.00 73.25 C
ATOM 4535 OE1 GLU B 161 10.491 7.846 -69.196 1.00 73.52 O
ATOM 4536 OE2 GLU B 161 9.946 6.571 -67.477 1.00 75.17 O
ATOM 4537 N ASN B 162 5.788 6.842 -72.051 1.00 62.81 N
ATOM 4538 CA ASN B 162 5.046 5.993 -72.974 1.00 62.03 C
ATOM 4539 C ASN B 162 5.342 6.355 -74.418 1.00 61.24 C
ATOM 4540 O ASN B 162 5.307 5.496 -75.300 1.00 60.31 O
ATOM 4541 CB ASN B 162 3.541 6.116 -72.736 1.00 63.03 C
ATOM 4542 CG ASN B 162 3.106 5.467 -71.445 1.00 63.64 C
ATOM 4543 OD1 ASN B 162 3.602 4.405 -71.083 1.00 65.10 O
ATOM 4544 ND2 ASN B 162 2.163 6.091 -70.750 1.00 63.92 N
ATOM 4545 N LEU B 163 5.618 7.634 -74.657 1.00 60.65 N
ATOM 4546 CA LEU B 163 5.925 8.104 -76.000 1.00 59.52 C
ATOM 4547 C LEU B 163 7.165 7.381 -76.506 1.00 59.37 C
ATOM 4548 O LEU B 163 7.113 6.716 -77.537 1.00 60.13 O
ATOM 4549 CB LEU B 163 6.170 9.610 -76.001 1.00 59.29 C
ATOM 4550 CG LEU B 163 6.235 10.240 -77.393 1.00 59.29 C
ATOM 4551 CD1 LEU B 163 4.876 10.137 -78.071 1.00 59.41 C
ATOM 4552 CD2 LEU B 163 6.656 11.688 -77.277 1.00 58.26 C
ATOM 4553 N HIS B 164 8.278 7.503 -75.784 1.00 57.74 N
ATOM 4554 CA HIS B 164 9.510 6.825 -76.174 1.00 57.14 C
ATOM 4555 C HIS B 164 9.313 5.304 -76.276 1.00 57.52 C
ATOM 4556 O HIS B 164 10.012 4.625 -77.018 1.00 57.91 O
ATOM 4557 CB HIS B 164 10.624 7.121 -75.172 1.00 56.79 C
ATOM 4558 CG HIS B 164 11.084 8.547 -75.179 1.00 58.60 C
ATOM 4559 ND1 HIS B 164 10.226 9.607 -74.978 1.00 60.22 N
ATOM 4560 CD2 HIS B 164 12.314 9.087 -75.350 1.00 58.35 C
ATOM 4561 CE1 HIS B 164 10.908 10.738 -75.027 1.00 59.33 C
ATOM 4562 NE2 HIS B 164 12.177 10.450 -75.252 1.00 58.28 N
ATOM 4563 N ALA B 165 8.362 4.766 -75.528 1.00 57.18 N
ATOM 4564 CA ALA B 165 8.105 3.339 -75.569 1.00 57.35 C
ATOM 4565 C ALA B 165 7.335 2.987 -76.835 1.00 57.97 C
ATOM 4566 O ALA B 165 7.357 1.845 -77.287 1.00 57.77 O
ATOM 4567 CB ALA B 165 7.310 2.911 -74.337 1.00 57.20 C
ATOM 4568 N ALA B 166 6.641 3.969 -77.399 1.00 59.05 N
ATOM 4569 CA ALA B 166 5.870 3.743 -78.617 1.00 61.04 C
ATOM 4570 C ALA B 166 6.706 4.138 -79.825 1.00 62.04 C
ATOM 4571 O ALA B 166 6.555 3.586 -80.908 1.00 62.58 O
ATOM 4572 CB ALA B 166 4.580 4.558 -78.588 1.00 60.63 C
ATOM 4573 N ALA B 167 7.602 5.091 -79.626 1.00 62.99 N
ATOM 4574 CA ALA B 167 8.444 5.555 -80.709 1.00 64.19 C
ATOM 4575 C ALA B 167 9.536 4.557 -81.039 1.00 65.78 C
ATOM 4576 O ALA B 167 9.896 4.401 -82.201 1.00 67.51 O
ATOM 4577 CB ALA B 167 9.062 6.891 -80.354 1.00 62.95 C
ATOM 4578 N TYR B 168 10.066 3.870 -80.035 1.00 66.29 N
ATOM 4579 CA TYR B 168 11.142 2.924 -80.299 1.00 67.39 C
ATOM 4580 C TYR B 168 10.865 1.503 -79.842 1.00 68.59 C
ATOM 4581 O TYR B 168 9.907 1.246 -79.118 1.00 69.43 O
ATOM 4582 CB TYR B 168 12.437 3.417 -79.657 1.00 66.19 C
ATOM 4583 CG TYR B 168 12.824 4.813 -80.080 1.00 67.21 C
ATOM 4584 CD1 TYR B 168 12.173 5.926 -79.562 1.00 67.68 C
ATOM 4585 CD2 TYR B 168 13.826 5.023 -81.024 1.00 68.45 C
ATOM 4586 CE1 TYR B 168 12.511 7.221 -79.975 1.00 67.85 C
ATOM 4587 CE2 TYR B 168 14.171 6.314 -81.447 1.00 67.37 C
ATOM 4588 CZ TYR B 168 13.510 7.404 -80.919 1.00 67.38 C
ATOM 4589 OH TYR B 168 13.843 8.672 -81.344 1.00 65.96 O
ATOM 4590 N LYS B 169 11.709 0.581 -80.294 1.00 69.74 N
ATOM 4591 CA LYS B 169 11.593 -0.823 -79.919 1.00 71.46 C
ATOM 4592 C LYS B 169 12.729 -1.112 -78.954 1.00 72.24 C
ATOM 4593 O LYS B 169 12.689 -2.084 -78.204 1.00 72.95 O
ATOM 4594 CB LYS B 169 11.747 -1.744 -81.133 1.00 72.07 C
ATOM 4595 CG LYS B 169 10.602 -1.722 -82.119 1.00 73.40 C
ATOM 4596 CD LYS B 169 10.854 -2.719 -83.237 1.00 74.45 C
ATOM 4597 CE LYS B 169 9.722 -2.720 -84.251 1.00 75.46 C
ATOM 4598 NZ LYS B 169 9.921 -3.733 -85.339 1.00 75.58 N
ATOM 4599 N THR B 170 13.746 -0.258 -78.975 1.00 72.88 N
ATOM 4600 CA THR B 170 14.897 -0.454 -78.108 1.00 74.00 C
ATOM 4601 C THR B 170 15.602 0.836 -77.696 1.00 73.83 C
ATOM 4602 O THR B 170 15.199 1.939 -78.080 1.00 74.51 O
ATOM 4603 CB THR B 170 15.931 -1.373 -78.789 1.00 74.99 C
ATOM 4604 OG1 THR B 170 16.164 -0.917 -80.129 1.00 76.69 O
ATOM 4605 CG2 THR B 170 15.433 -2.809 -78.818 1.00 74.19 C
ATOM 4606 N ALA B 171 16.665 0.665 -76.908 1.00 73.23 N
ATOM 4607 CA ALA B 171 17.502 1.755 -76.395 1.00 71.87 C
ATOM 4608 C ALA B 171 16.730 2.958 -75.846 1.00 69.69 C
ATOM 4609 O ALA B 171 16.481 3.051 -74.648 1.00 67.82 O
ATOM 4610 CB ALA B 171 18.500 2.215 -77.486 1.00 71.59 C
ATOM 4611 N LEU B 172 16.368 3.877 -76.732 1.00 68.40 N
ATOM 4612 CA LEU B 172 15.644 5.065 -76.329 1.00 67.41 C
ATOM 4613 C LEU B 172 14.246 4.733 -75.826 1.00 67.90 C
ATOM 4614 O LEU B 172 13.591 5.564 -75.182 1.00 67.81 O
ATOM 4615 CB LEU B 172 15.561 6.044 -77.497 1.00 66.06 C
ATOM 4616 CG LEU B 172 16.878 6.709 -77.904 1.00 64.14 C
ATOM 4617 CD1 LEU B 172 16.622 7.586 -79.115 1.00 64.04 C
ATOM 4618 CD2 LEU B 172 17.444 7.535 -76.761 1.00 61.49 C
ATOM 4619 N ALA B 173 13.789 3.518 -76.115 1.00 67.03 N
ATOM 4620 CA ALA B 173 12.462 3.107 -75.683 1.00 65.52 C
ATOM 4621 C ALA B 173 12.462 2.901 -74.183 1.00 64.88 C
ATOM 4622 O ALA B 173 11.421 3.000 -73.544 1.00 65.65 O
ATOM 4623 CB ALA B 173 12.049 1.828 -76.387 1.00 65.25 C
ATOM 4624 N ASN B 174 13.636 2.611 -73.628 1.00 64.48 N
ATOM 4625 CA ASN B 174 13.778 2.401 -72.192 1.00 64.20 C
ATOM 4626 C ASN B 174 13.301 3.610 -71.393 1.00 64.04 C
ATOM 4627 O ASN B 174 13.602 4.754 -71.742 1.00 65.32 O
ATOM 4628 CB ASN B 174 15.234 2.101 -71.840 1.00 63.72 C
ATOM 4629 CG ASN B 174 15.684 0.758 -72.368 1.00 64.09 C
ATOM 4630 OD1 ASN B 174 14.847 -0.097 -72.684 1.00 63.39 O
ATOM 4631 ND2 ASN B 174 17.001 0.552 -72.453 1.00 61.34 N
ATOM 4632 N PRO B 175 12.544 3.371 -70.305 1.00 63.08 N
ATOM 4633 CA PRO B 175 12.019 4.440 -69.446 1.00 61.14 C
ATOM 4634 C PRO B 175 13.116 5.145 -68.651 1.00 59.71 C
ATOM 4635 O PRO B 175 14.129 4.540 -68.302 1.00 59.82 O
ATOM 4636 CB PRO B 175 11.039 3.696 -68.555 1.00 60.57 C
ATOM 4637 CG PRO B 175 11.698 2.367 -68.399 1.00 60.57 C
ATOM 4638 CD PRO B 175 12.122 2.050 -69.805 1.00 61.79 C
ATOM 4639 N LEU B 176 12.906 6.423 -68.369 1.00 59.00 N
ATOM 4640 CA LEU B 176 13.881 7.216 -67.632 1.00 58.81 C
ATOM 4641 C LEU B 176 13.819 6.939 -66.124 1.00 58.80 C
ATOM 4642 O LEU B 176 14.765 7.245 -65.379 1.00 59.05 O
ATOM 4643 CB LEU B 176 13.648 8.701 -67.910 1.00 58.84 C
ATOM 4644 CG LEU B 176 14.720 9.665 -67.396 1.00 61.75 C
ATOM 4645 CD1 LEU B 176 16.081 9.319 -68.008 1.00 61.59 C
ATOM 4646 CD2 LEU B 176 14.316 11.096 -67.741 1.00 61.85 C
ATOM 4647 N TYR B 177 12.698 6.364 -65.682 1.00 57.06 N
ATOM 4648 CA TYR B 177 12.510 6.024 -64.275 1.00 55.03 C
ATOM 4649 C TYR B 177 12.357 4.522 -64.149 1.00 54.91 C
ATOM 4650 O TYR B 177 11.621 3.892 -64.907 1.00 55.16 O
ATOM 4651 CB TYR B 177 11.273 6.732 -63.684 1.00 52.39 C
ATOM 4652 CG TYR B 177 11.424 8.233 -63.572 1.00 48.88 C
ATOM 4653 CD1 TYR B 177 11.057 9.071 -64.619 1.00 48.45 C
ATOM 4654 CD2 TYR B 177 11.986 8.811 -62.441 1.00 48.44 C
ATOM 4655 CE1 TYR B 177 11.247 10.456 -64.547 1.00 47.80 C
ATOM 4656 CE2 TYR B 177 12.186 10.191 -62.356 1.00 48.58 C
ATOM 4657 CZ TYR B 177 11.812 11.008 -63.414 1.00 48.43 C
ATOM 4658 OH TYR B 177 11.980 12.375 -63.338 1.00 48.94 O
ATOM 4659 N CYS B 178 13.063 3.953 -63.183 1.00 55.04 N
ATOM 4660 CA CYS B 178 13.028 2.517 -62.935 1.00 55.85 C
ATOM 4661 C CYS B 178 11.630 1.895 -62.878 1.00 55.86 C
ATOM 4662 O CYS B 178 10.795 2.288 -62.070 1.00 55.57 O
ATOM 4663 CB CYS B 178 13.761 2.209 -61.629 1.00 54.69 C
ATOM 4664 SG CYS B 178 13.621 0.492 -61.113 1.00 56.88 S
ATOM 4665 N PRO B 179 11.354 0.919 -63.750 1.00 56.76 N
ATOM 4666 CA PRO B 179 10.033 0.287 -63.723 1.00 57.59 C
ATOM 4667 C PRO B 179 9.772 -0.303 -62.341 1.00 58.32 C
ATOM 4668 O PRO B 179 10.713 -0.651 -61.617 1.00 58.37 O
ATOM 4669 CB PRO B 179 10.132 -0.788 -64.809 1.00 56.85 C
ATOM 4670 CG PRO B 179 11.599 -1.041 -64.929 1.00 57.32 C
ATOM 4671 CD PRO B 179 12.189 0.340 -64.811 1.00 56.88 C
ATOM 4672 N ASP B 180 8.497 -0.421 -61.989 1.00 58.34 N
ATOM 4673 CA ASP B 180 8.099 -0.925 -60.683 1.00 58.44 C
ATOM 4674 C ASP B 180 8.551 -2.331 -60.325 1.00 57.98 C
ATOM 4675 O ASP B 180 9.026 -2.565 -59.211 1.00 58.75 O
ATOM 4676 CB ASP B 180 6.581 -0.831 -60.531 1.00 60.24 C
ATOM 4677 CG ASP B 180 6.062 0.594 -60.681 1.00 61.41 C
ATOM 4678 OD1 ASP B 180 6.894 1.528 -60.756 1.00 61.87 O
ATOM 4679 OD2 ASP B 180 4.821 0.775 -60.717 1.00 61.33 O
ATOM 4680 N TYR B 181 8.413 -3.273 -61.248 1.00 57.27 N
ATOM 4681 CA TYR B 181 8.804 -4.647 -60.952 1.00 57.17 C
ATOM 4682 C TYR B 181 10.280 -4.784 -60.596 1.00 56.89 C
ATOM 4683 O TYR B 181 10.701 -5.799 -60.047 1.00 56.06 O
ATOM 4684 CB TYR B 181 8.451 -5.576 -62.123 1.00 58.06 C
ATOM 4685 CG TYR B 181 9.442 -5.601 -63.273 1.00 60.44 C
ATOM 4686 CD1 TYR B 181 10.575 -6.412 -63.228 1.00 61.21 C
ATOM 4687 CD2 TYR B 181 9.220 -4.848 -64.428 1.00 61.77 C
ATOM 4688 CE1 TYR B 181 11.459 -6.481 -64.309 1.00 62.61 C
ATOM 4689 CE2 TYR B 181 10.099 -4.908 -65.512 1.00 63.21 C
ATOM 4690 CZ TYR B 181 11.214 -5.727 -65.450 1.00 62.95 C
ATOM 4691 OH TYR B 181 12.062 -5.802 -66.538 1.00 62.35 O
ATOM 4692 N ARG B 182 11.072 -3.763 -60.885 1.00 57.58 N
ATOM 4693 CA ARG B 182 12.485 -3.855 -60.571 1.00 58.52 C
ATOM 4694 C ARG B 182 12.947 -3.097 -59.349 1.00 59.58 C
ATOM 4695 O ARG B 182 14.108 -3.217 -58.957 1.00 59.59 O
ATOM 4696 CB ARG B 182 13.332 -3.474 -61.787 1.00 58.57 C
ATOM 4697 CG ARG B 182 13.547 -4.676 -62.712 1.00 57.75 C
ATOM 4698 CD ARG B 182 14.519 -4.393 -63.826 1.00 56.07 C
ATOM 4699 NE ARG B 182 15.881 -4.135 -63.358 1.00 52.06 N
ATOM 4700 CZ ARG B 182 16.634 -5.007 -62.696 1.00 50.28 C
ATOM 4701 NH1 ARG B 182 16.172 -6.212 -62.395 1.00 48.01 N
ATOM 4702 NH2 ARG B 182 17.872 -4.680 -62.367 1.00 50.92 N
ATOM 4703 N ILE B 183 12.051 -2.319 -58.745 1.00 60.76 N
ATOM 4704 CA ILE B 183 12.403 -1.587 -57.535 1.00 61.07 C
ATOM 4705 C ILE B 183 12.750 -2.669 -56.509 1.00 62.05 C
ATOM 4706 O ILE B 183 11.924 -3.536 -56.208 1.00 61.00 O
ATOM 4707 CB ILE B 183 11.217 -0.779 -56.979 1.00 61.26 C
ATOM 4708 CG1 ILE B 183 10.653 0.163 -58.043 1.00 61.23 C
ATOM 4709 CG2 ILE B 183 11.668 0.016 -55.769 1.00 61.58 C
ATOM 4710 CD1 ILE B 183 11.487 1.387 -58.296 1.00 61.71 C
ATOM 4711 N GLY B 184 13.974 -2.624 -55.993 1.00 63.20 N
ATOM 4712 CA GLY B 184 14.401 -3.605 -55.011 1.00 63.59 C
ATOM 4713 C GLY B 184 15.221 -4.747 -55.587 1.00 64.08 C
ATOM 4714 O GLY B 184 15.894 -5.466 -54.846 1.00 63.62 O
ATOM 4715 N LYS B 185 15.183 -4.904 -56.909 1.00 64.26 N
ATOM 4716 CA LYS B 185 15.905 -5.982 -57.573 1.00 63.52 C
ATOM 4717 C LYS B 185 17.260 -5.635 -58.189 1.00 62.96 C
ATOM 4718 O LYS B 185 18.048 -6.528 -58.495 1.00 62.58 O
ATOM 4719 CB LYS B 185 14.998 -6.601 -58.620 1.00 63.07 C
ATOM 4720 CG LYS B 185 13.782 -7.235 -58.003 1.00 64.50 C
ATOM 4721 CD LYS B 185 12.902 -7.801 -59.067 1.00 67.04 C
ATOM 4722 CE LYS B 185 11.704 -8.496 -58.472 1.00 69.19 C
ATOM 4723 NZ LYS B 185 10.801 -8.953 -59.569 1.00 71.05 N
ATOM 4724 N ILE B 186 17.532 -4.350 -58.375 1.00 63.13 N
ATOM 4725 CA ILE B 186 18.806 -3.914 -58.935 1.00 63.07 C
ATOM 4726 C ILE B 186 19.883 -4.347 -57.944 1.00 65.20 C
ATOM 4727 O ILE B 186 19.654 -4.319 -56.738 1.00 66.12 O
ATOM 4728 CB ILE B 186 18.810 -2.387 -59.107 1.00 61.48 C
ATOM 4729 CG1 ILE B 186 17.679 -1.999 -60.069 1.00 60.25 C
ATOM 4730 CG2 ILE B 186 20.167 -1.909 -59.590 1.00 60.25 C
ATOM 4731 CD1 ILE B 186 17.399 -0.514 -60.168 1.00 58.21 C
ATOM 4732 N THR B 187 21.049 -4.757 -58.434 1.00 66.28 N
ATOM 4733 CA THR B 187 22.109 -5.215 -57.534 1.00 66.86 C
ATOM 4734 C THR B 187 23.344 -4.321 -57.562 1.00 67.86 C
ATOM 4735 O THR B 187 23.483 -3.474 -58.451 1.00 67.40 O
ATOM 4736 CB THR B 187 22.545 -6.648 -57.892 1.00 66.54 C
ATOM 4737 OG1 THR B 187 23.226 -6.642 -59.154 1.00 68.07 O
ATOM 4738 CG2 THR B 187 21.337 -7.549 -58.006 1.00 65.72 C
ATOM 4739 N SER B 188 24.233 -4.507 -56.586 1.00 68.61 N
ATOM 4740 CA SER B 188 25.470 -3.726 -56.526 1.00 69.95 C
ATOM 4741 C SER B 188 26.325 -4.102 -57.733 1.00 70.86 C
ATOM 4742 O SER B 188 27.053 -3.269 -58.289 1.00 71.03 O
ATOM 4743 CB SER B 188 26.242 -4.030 -55.245 1.00 70.13 C
ATOM 4744 OG SER B 188 25.555 -3.555 -54.106 1.00 70.38 O
ATOM 4745 N GLU B 189 26.224 -5.371 -58.123 1.00 70.72 N
ATOM 4746 CA GLU B 189 26.949 -5.895 -59.271 1.00 70.19 C
ATOM 4747 C GLU B 189 26.543 -5.076 -60.492 1.00 67.82 C
ATOM 4748 O GLU B 189 27.389 -4.545 -61.212 1.00 67.41 O
ATOM 4749 CB GLU B 189 26.579 -7.369 -59.487 1.00 73.25 C
ATOM 4750 CG GLU B 189 27.523 -8.136 -60.415 1.00 78.56 C
ATOM 4751 CD GLU B 189 28.934 -8.295 -59.831 1.00 82.87 C
ATOM 4752 OE1 GLU B 189 29.813 -8.870 -60.524 1.00 84.46 O
ATOM 4753 OE2 GLU B 189 29.163 -7.849 -58.677 1.00 84.41 O
ATOM 4754 N GLN B 190 25.238 -4.966 -60.708 1.00 64.88 N
ATOM 4755 CA GLN B 190 24.720 -4.222 -61.839 1.00 63.74 C
ATOM 4756 C GLN B 190 25.156 -2.761 -61.825 1.00 64.22 C
ATOM 4757 O GLN B 190 25.433 -2.180 -62.875 1.00 64.27 O
ATOM 4758 CB GLN B 190 23.196 -4.310 -61.870 1.00 62.29 C
ATOM 4759 CG GLN B 190 22.669 -5.706 -62.114 1.00 61.46 C
ATOM 4760 CD GLN B 190 21.156 -5.745 -62.203 1.00 61.91 C
ATOM 4761 OE1 GLN B 190 20.458 -5.384 -61.259 1.00 64.04 O
ATOM 4762 NE2 GLN B 190 20.638 -6.184 -63.341 1.00 62.37 N
ATOM 4763 N LEU B 191 25.218 -2.164 -60.641 1.00 64.62 N
ATOM 4764 CA LEU B 191 25.636 -0.771 -60.539 1.00 66.26 C
ATOM 4765 C LEU B 191 27.104 -0.654 -60.896 1.00 66.77 C
ATOM 4766 O LEU B 191 27.506 0.273 -61.601 1.00 66.65 O
ATOM 4767 CB LEU B 191 25.399 -0.224 -59.126 1.00 66.32 C
ATOM 4768 CG LEU B 191 23.936 -0.007 -58.710 1.00 65.41 C
ATOM 4769 CD1 LEU B 191 23.898 0.419 -57.256 1.00 64.36 C
ATOM 4770 CD2 LEU B 191 23.268 1.038 -59.611 1.00 62.71 C
ATOM 4771 N HIS B 192 27.904 -1.595 -60.404 1.00 68.19 N
ATOM 4772 CA HIS B 192 29.333 -1.601 -60.702 1.00 68.24 C
ATOM 4773 C HIS B 192 29.557 -1.810 -62.189 1.00 68.32 C
ATOM 4774 O HIS B 192 30.230 -1.004 -62.835 1.00 67.93 O
ATOM 4775 CB HIS B 192 30.055 -2.697 -59.918 1.00 67.74 C
ATOM 4776 CG HIS B 192 30.557 -2.247 -58.585 1.00 67.89 C
ATOM 4777 ND1 HIS B 192 30.030 -2.702 -57.393 1.00 67.94 N
ATOM 4778 CD2 HIS B 192 31.508 -1.340 -58.254 1.00 67.92 C
ATOM 4779 CE1 HIS B 192 30.631 -2.094 -56.387 1.00 68.05 C
ATOM 4780 NE2 HIS B 192 31.531 -1.260 -56.882 1.00 68.36 N
ATOM 4781 N HIS B 193 28.981 -2.879 -62.735 1.00 67.98 N
ATOM 4782 CA HIS B 193 29.149 -3.164 -64.148 1.00 69.08 C
ATOM 4783 C HIS B 193 28.689 -2.010 -65.025 1.00 68.75 C
ATOM 4784 O HIS B 193 29.287 -1.751 -66.066 1.00 70.07 O
ATOM 4785 CB HIS B 193 28.413 -4.449 -64.540 1.00 71.16 C
ATOM 4786 CG HIS B 193 28.939 -5.673 -63.857 1.00 73.76 C
ATOM 4787 ND1 HIS B 193 30.207 -5.739 -63.315 1.00 75.31 N
ATOM 4788 CD2 HIS B 193 28.370 -6.880 -63.624 1.00 74.60 C
ATOM 4789 CE1 HIS B 193 30.395 -6.929 -62.774 1.00 74.65 C
ATOM 4790 NE2 HIS B 193 29.295 -7.642 -62.947 1.00 75.52 N
ATOM 4791 N PHE B 194 27.639 -1.306 -64.615 1.00 67.43 N
ATOM 4792 CA PHE B 194 27.163 -0.187 -65.419 1.00 65.54 C
ATOM 4793 C PHE B 194 28.227 0.901 -65.435 1.00 66.08 C
ATOM 4794 O PHE B 194 28.584 1.415 -66.491 1.00 66.15 O
ATOM 4795 CB PHE B 194 25.862 0.381 -64.859 1.00 62.66 C
ATOM 4796 CG PHE B 194 25.154 1.310 -65.808 1.00 58.60 C
ATOM 4797 CD1 PHE B 194 24.304 0.806 -66.793 1.00 55.94 C
ATOM 4798 CD2 PHE B 194 25.354 2.688 -65.734 1.00 56.86 C
ATOM 4799 CE1 PHE B 194 23.663 1.665 -67.692 1.00 55.26 C
ATOM 4800 CE2 PHE B 194 24.720 3.556 -66.626 1.00 55.07 C
ATOM 4801 CZ PHE B 194 23.874 3.045 -67.608 1.00 54.65 C
ATOM 4802 N VAL B 195 28.738 1.240 -64.258 1.00 67.48 N
ATOM 4803 CA VAL B 195 29.772 2.264 -64.137 1.00 69.05 C
ATOM 4804 C VAL B 195 31.046 1.877 -64.888 1.00 69.65 C
ATOM 4805 O VAL B 195 31.660 2.705 -65.564 1.00 70.18 O
ATOM 4806 CB VAL B 195 30.126 2.515 -62.659 1.00 68.28 C
ATOM 4807 CG1 VAL B 195 31.382 3.372 -62.551 1.00 69.39 C
ATOM 4808 CG2 VAL B 195 28.971 3.203 -61.981 1.00 68.69 C
ATOM 4809 N GLN B 196 31.438 0.616 -64.763 1.00 70.16 N
ATOM 4810 CA GLN B 196 32.642 0.115 -65.415 1.00 69.82 C
ATOM 4811 C GLN B 196 32.510 0.126 -66.927 1.00 69.40 C
ATOM 4812 O GLN B 196 33.440 0.525 -67.631 1.00 69.99 O
ATOM 4813 CB GLN B 196 32.942 -1.316 -64.956 1.00 69.88 C
ATOM 4814 CG GLN B 196 32.992 -1.482 -63.448 1.00 71.25 C
ATOM 4815 CD GLN B 196 33.069 -2.938 -63.005 1.00 72.42 C
ATOM 4816 OE1 GLN B 196 32.495 -3.830 -63.638 1.00 72.52 O
ATOM 4817 NE2 GLN B 196 33.761 -3.181 -61.899 1.00 73.08 N
ATOM 4818 N ASN B 197 31.356 -0.300 -67.427 1.00 68.81 N
ATOM 4819 CA ASN B 197 31.147 -0.360 -68.863 1.00 69.10 C
ATOM 4820 C ASN B 197 30.620 0.919 -69.495 1.00 69.45 C
ATOM 4821 O ASN B 197 30.306 0.921 -70.682 1.00 70.84 O
ATOM 4822 CB ASN B 197 30.205 -1.515 -69.223 1.00 68.81 C
ATOM 4823 CG ASN B 197 30.606 -2.832 -68.569 1.00 69.85 C
ATOM 4824 OD1 ASN B 197 31.751 -3.011 -68.150 1.00 70.17 O
ATOM 4825 ND2 ASN B 197 29.661 -3.764 -68.488 1.00 69.79 N
ATOM 4826 N ASN B 198 30.534 2.006 -68.736 1.00 69.28 N
ATOM 4827 CA ASN B 198 30.009 3.247 -69.306 1.00 70.25 C
ATOM 4828 C ASN B 198 30.735 4.519 -68.868 1.00 72.17 C
ATOM 4829 O ASN B 198 30.830 5.484 -69.630 1.00 71.73 O
ATOM 4830 CB ASN B 198 28.515 3.363 -68.985 1.00 68.67 C
ATOM 4831 CG ASN B 198 27.668 2.379 -69.774 1.00 66.93 C
ATOM 4832 OD1 ASN B 198 27.458 2.555 -70.971 1.00 67.56 O
ATOM 4833 ND2 ASN B 198 27.186 1.334 -69.109 1.00 64.28 N
ATOM 4834 N PHE B 199 31.235 4.527 -67.638 1.00 74.78 N
ATOM 4835 CA PHE B 199 31.953 5.685 -67.118 1.00 78.44 C
ATOM 4836 C PHE B 199 33.433 5.548 -67.480 1.00 80.28 C
ATOM 4837 O PHE B 199 34.297 5.393 -66.613 1.00 80.08 O
ATOM 4838 CB PHE B 199 31.781 5.780 -65.598 1.00 79.93 C
ATOM 4839 CG PHE B 199 30.428 6.281 -65.163 1.00 80.79 C
ATOM 4840 CD1 PHE B 199 29.279 5.959 -65.883 1.00 81.27 C
ATOM 4841 CD2 PHE B 199 30.300 7.060 -64.016 1.00 81.05 C
ATOM 4842 CE1 PHE B 199 28.025 6.408 -65.467 1.00 82.03 C
ATOM 4843 CE2 PHE B 199 29.052 7.511 -63.592 1.00 81.45 C
ATOM 4844 CZ PHE B 199 27.911 7.185 -64.319 1.00 81.49 C
ATOM 4845 N THR B 200 33.703 5.606 -68.779 1.00 82.18 N
ATOM 4846 CA THR B 200 35.051 5.490 -69.325 1.00 82.24 C
ATOM 4847 C THR B 200 35.558 6.870 -69.772 1.00 83.57 C
ATOM 4848 O THR B 200 34.782 7.702 -70.257 1.00 83.21 O
ATOM 4849 CB THR B 200 35.048 4.541 -70.526 1.00 81.33 C
ATOM 4850 OG1 THR B 200 34.281 5.130 -71.585 1.00 81.15 O
ATOM 4851 CG2 THR B 200 34.418 3.205 -70.149 1.00 79.52 C
ATOM 4852 N SER B 201 36.862 7.096 -69.623 1.00 84.86 N
ATOM 4853 CA SER B 201 37.483 8.377 -69.977 1.00 85.15 C
ATOM 4854 C SER B 201 37.150 8.905 -71.364 1.00 84.31 C
ATOM 4855 O SER B 201 37.166 10.111 -71.583 1.00 84.25 O
ATOM 4856 CB SER B 201 39.003 8.281 -69.847 1.00 86.04 C
ATOM 4857 OG SER B 201 39.552 7.516 -70.903 1.00 89.08 O
ATOM 4858 N ALA B 202 36.854 8.004 -72.297 1.00 84.30 N
ATOM 4859 CA ALA B 202 36.528 8.395 -73.668 1.00 84.09 C
ATOM 4860 C ALA B 202 35.047 8.722 -73.875 1.00 84.05 C
ATOM 4861 O ALA B 202 34.636 9.090 -74.983 1.00 82.99 O
ATOM 4862 CB ALA B 202 36.955 7.296 -74.628 1.00 84.64 C
ATOM 4863 N ARG B 203 34.256 8.574 -72.808 1.00 84.12 N
ATOM 4864 CA ARG B 203 32.817 8.862 -72.834 1.00 83.05 C
ATOM 4865 C ARG B 203 32.497 9.965 -71.840 1.00 82.46 C
ATOM 4866 O ARG B 203 31.362 10.422 -71.754 1.00 81.44 O
ATOM 4867 CB ARG B 203 32.016 7.618 -72.467 1.00 82.52 C
ATOM 4868 CG ARG B 203 32.230 6.475 -73.414 1.00 82.50 C
ATOM 4869 CD ARG B 203 31.540 5.219 -72.950 1.00 82.30 C
ATOM 4870 NE ARG B 203 30.108 5.412 -72.780 1.00 82.96 N
ATOM 4871 CZ ARG B 203 29.220 4.425 -72.823 1.00 84.30 C
ATOM 4872 NH1 ARG B 203 29.617 3.180 -73.038 1.00 84.61 N
ATOM 4873 NH2 ARG B 203 27.934 4.677 -72.640 1.00 85.34 N
ATOM 4874 N MET B 204 33.518 10.387 -71.102 1.00 82.65 N
ATOM 4875 CA MET B 204 33.387 11.424 -70.089 1.00 83.47 C
ATOM 4876 C MET B 204 33.990 12.763 -70.497 1.00 83.42 C
ATOM 4877 O MET B 204 34.765 12.848 -71.453 1.00 84.14 O
ATOM 4878 CB MET B 204 34.049 10.965 -68.792 1.00 84.29 C
ATOM 4879 CG MET B 204 33.324 9.846 -68.071 1.00 85.88 C
ATOM 4880 SD MET B 204 34.359 9.098 -66.785 1.00 88.08 S
ATOM 4881 CE MET B 204 34.556 10.473 -65.639 1.00 88.29 C
ATOM 4882 N ALA B 205 33.629 13.801 -69.744 1.00 82.65 N
ATOM 4883 CA ALA B 205 34.102 15.160 -69.971 1.00 81.92 C
ATOM 4884 C ALA B 205 34.050 15.955 -68.669 1.00 81.20 C
ATOM 4885 O ALA B 205 33.015 16.020 -68.016 1.00 81.25 O
ATOM 4886 CB ALA B 205 33.242 15.846 -71.031 1.00 81.49 C
ATOM 4887 N LEU B 206 35.173 16.554 -68.295 1.00 80.73 N
ATOM 4888 CA LEU B 206 35.241 17.349 -67.079 1.00 80.25 C
ATOM 4889 C LEU B 206 35.123 18.829 -67.428 1.00 79.62 C
ATOM 4890 O LEU B 206 36.118 19.483 -67.729 1.00 79.88 O
ATOM 4891 CB LEU B 206 36.569 17.100 -66.359 1.00 81.09 C
ATOM 4892 CG LEU B 206 36.788 17.918 -65.084 1.00 81.11 C
ATOM 4893 CD1 LEU B 206 35.737 17.516 -64.055 1.00 81.98 C
ATOM 4894 CD2 LEU B 206 38.185 17.687 -64.538 1.00 81.02 C
ATOM 4895 N VAL B 207 33.907 19.356 -67.381 1.00 78.46 N
ATOM 4896 CA VAL B 207 33.672 20.761 -67.700 1.00 77.96 C
ATOM 4897 C VAL B 207 33.565 21.628 -66.443 1.00 78.94 C
ATOM 4898 O VAL B 207 33.090 21.164 -65.413 1.00 79.85 O
ATOM 4899 CB VAL B 207 32.395 20.902 -68.525 1.00 76.80 C
ATOM 4900 CG1 VAL B 207 32.146 22.358 -68.869 1.00 75.92 C
ATOM 4901 CG2 VAL B 207 32.515 20.058 -69.779 1.00 75.78 C
ATOM 4902 N GLY B 208 34.004 22.883 -66.522 1.00 79.08 N
ATOM 4903 CA GLY B 208 33.940 23.746 -65.354 1.00 79.69 C
ATOM 4904 C GLY B 208 33.824 25.227 -65.653 1.00 80.97 C
ATOM 4905 O GLY B 208 34.257 25.699 -66.699 1.00 81.08 O
ATOM 4906 N ILE B 209 33.229 25.970 -64.729 1.00 82.17 N
ATOM 4907 CA ILE B 209 33.069 27.409 -64.902 1.00 82.97 C
ATOM 4908 C ILE B 209 33.573 28.106 -63.644 1.00 84.62 C
ATOM 4909 O ILE B 209 33.441 27.575 -62.544 1.00 84.72 O
ATOM 4910 CB ILE B 209 31.594 27.794 -65.122 1.00 81.87 C
ATOM 4911 CG1 ILE B 209 31.037 27.080 -66.346 1.00 80.74 C
ATOM 4912 CG2 ILE B 209 31.480 29.280 -65.350 1.00 82.07 C
ATOM 4913 CD1 ILE B 209 29.605 27.431 -66.634 1.00 81.15 C
ATOM 4914 N GLY B 210 34.149 29.294 -63.811 1.00 86.42 N
ATOM 4915 CA GLY B 210 34.666 30.027 -62.670 1.00 88.62 C
ATOM 4916 C GLY B 210 35.970 29.421 -62.197 1.00 90.40 C
ATOM 4917 O GLY B 210 36.388 29.604 -61.052 1.00 89.76 O
ATOM 4918 N VAL B 211 36.606 28.681 -63.095 1.00 92.62 N
ATOM 4919 CA VAL B 211 37.875 28.039 -62.804 1.00 94.97 C
ATOM 4920 C VAL B 211 38.843 28.363 -63.934 1.00 96.99 C
ATOM 4921 O VAL B 211 38.443 28.878 -64.985 1.00 97.15 O
ATOM 4922 CB VAL B 211 37.717 26.511 -62.698 1.00 94.30 C
ATOM 4923 CG1 VAL B 211 36.806 26.171 -61.537 1.00 95.33 C
ATOM 4924 CG2 VAL B 211 37.152 25.953 -63.991 1.00 93.75 C
ATOM 4925 N LYS B 212 40.120 28.077 -63.710 1.00 98.53 N
ATOM 4926 CA LYS B 212 41.138 28.326 -64.717 1.00 98.83 C
ATOM 4927 C LYS B 212 41.520 26.997 -65.356 1.00 98.93 C
ATOM 4928 O LYS B 212 41.861 26.037 -64.659 1.00 98.41 O
ATOM 4929 CB LYS B 212 42.365 28.978 -64.085 1.00 99.39 C
ATOM 4930 CG LYS B 212 43.412 29.392 -65.098 1.00101.57 C
ATOM 4931 CD LYS B 212 44.655 29.946 -64.426 1.00102.26 C
ATOM 4932 CE LYS B 212 45.711 30.297 -65.456 1.00102.45 C
ATOM 4933 NZ LYS B 212 46.977 30.716 -64.805 1.00103.10 N
ATOM 4934 N HIS B 213 41.454 26.953 -66.684 1.00 98.80 N
ATOM 4935 CA HIS B 213 41.770 25.753 -67.447 1.00 99.01 C
ATOM 4936 C HIS B 213 42.964 24.975 -66.910 1.00100.08 C
ATOM 4937 O HIS B 213 42.885 23.762 -66.720 1.00 99.97 O
ATOM 4938 CB HIS B 213 42.036 26.114 -68.905 1.00 98.02 C
ATOM 4939 CG HIS B 213 41.860 24.967 -69.846 1.00 97.30 C
ATOM 4940 ND1 HIS B 213 40.619 24.511 -70.234 1.00 97.17 N
ATOM 4941 CD2 HIS B 213 42.763 24.165 -70.458 1.00 97.01 C
ATOM 4942 CE1 HIS B 213 40.764 23.480 -71.044 1.00 96.65 C
ATOM 4943 NE2 HIS B 213 42.055 23.249 -71.196 1.00 96.82 N
ATOM 4944 N SER B 214 44.073 25.673 -66.677 1.00101.25 N
ATOM 4945 CA SER B 214 45.281 25.036 -66.165 1.00102.23 C
ATOM 4946 C SER B 214 44.995 24.231 -64.905 1.00103.24 C
ATOM 4947 O SER B 214 45.518 23.130 -64.736 1.00103.63 O
ATOM 4948 CB SER B 214 46.355 26.088 -65.884 1.00101.99 C
ATOM 4949 OG SER B 214 45.842 27.141 -65.090 1.00101.92 O
ATOM 4950 N ASP B 215 44.157 24.782 -64.027 1.00104.41 N
ATOM 4951 CA ASP B 215 43.791 24.114 -62.780 1.00104.80 C
ATOM 4952 C ASP B 215 42.931 22.886 -63.045 1.00105.80 C
ATOM 4953 O ASP B 215 43.276 21.779 -62.633 1.00105.97 O
ATOM 4954 CB ASP B 215 43.027 25.069 -61.861 1.00103.72 C
ATOM 4955 CG ASP B 215 43.912 26.137 -61.264 1.00103.08 C
ATOM 4956 OD1 ASP B 215 44.852 25.787 -60.524 1.00101.56 O
ATOM 4957 OD2 ASP B 215 43.665 27.331 -61.536 1.00103.39 O
ATOM 4958 N LEU B 216 41.810 23.087 -63.734 1.00107.09 N
ATOM 4959 CA LEU B 216 40.900 21.988 -64.043 1.00108.72 C
ATOM 4960 C LEU B 216 41.652 20.926 -64.827 1.00110.01 C
ATOM 4961 O LEU B 216 41.563 19.732 -64.527 1.00109.83 O
ATOM 4962 CB LEU B 216 39.703 22.491 -64.861 1.00108.45 C
ATOM 4963 CG LEU B 216 38.541 21.510 -65.072 1.00108.09 C
ATOM 4964 CD1 LEU B 216 37.942 21.132 -63.729 1.00107.80 C
ATOM 4965 CD2 LEU B 216 37.484 22.141 -65.966 1.00107.24 C
ATOM 4966 N LYS B 217 42.398 21.375 -65.832 1.00111.80 N
ATOM 4967 CA LYS B 217 43.180 20.476 -66.669 1.00113.30 C
ATOM 4968 C LYS B 217 44.098 19.624 -65.802 1.00114.08 C
ATOM 4969 O LYS B 217 44.238 18.420 -66.019 1.00113.97 O
ATOM 4970 CB LYS B 217 44.011 21.283 -67.673 1.00113.39 C
ATOM 4971 CG LYS B 217 44.892 20.432 -68.578 1.00113.89 C
ATOM 4972 CD LYS B 217 45.635 21.281 -69.596 1.00113.80 C
ATOM 4973 CE LYS B 217 46.475 20.416 -70.524 1.00113.85 C
ATOM 4974 NZ LYS B 217 47.104 21.217 -71.608 1.00113.45 N
ATOM 4975 N GLN B 218 44.712 20.254 -64.808 1.00115.14 N
ATOM 4976 CA GLN B 218 45.619 19.555 -63.917 1.00116.88 C
ATOM 4977 C GLN B 218 44.913 18.457 -63.132 1.00118.18 C
ATOM 4978 O GLN B 218 45.385 17.321 -63.084 1.00118.33 O
ATOM 4979 CB GLN B 218 46.266 20.548 -62.958 1.00117.35 C
ATOM 4980 CG GLN B 218 47.305 19.934 -62.046 1.00119.10 C
ATOM 4981 CD GLN B 218 48.161 20.980 -61.361 1.00120.24 C
ATOM 4982 OE1 GLN B 218 47.654 21.842 -60.641 1.00120.87 O
ATOM 4983 NE2 GLN B 218 49.469 20.916 -61.588 1.00120.84 N
ATOM 4984 N VAL B 219 43.781 18.797 -62.523 1.00119.49 N
ATOM 4985 CA VAL B 219 43.014 17.839 -61.734 1.00120.90 C
ATOM 4986 C VAL B 219 42.726 16.571 -62.532 1.00121.95 C
ATOM 4987 O VAL B 219 42.997 15.457 -62.075 1.00121.97 O
ATOM 4988 CB VAL B 219 41.665 18.440 -61.278 1.00121.14 C
ATOM 4989 CG1 VAL B 219 40.977 17.497 -60.301 1.00121.10 C
ATOM 4990 CG2 VAL B 219 41.887 19.800 -60.640 1.00121.29 C
ATOM 4991 N ALA B 220 42.179 16.754 -63.728 1.00123.10 N
ATOM 4992 CA ALA B 220 41.831 15.643 -64.601 1.00124.57 C
ATOM 4993 C ALA B 220 42.944 14.618 -64.729 1.00125.89 C
ATOM 4994 O ALA B 220 42.864 13.526 -64.164 1.00125.97 O
ATOM 4995 CB ALA B 220 41.459 16.167 -65.973 1.00124.16 C
ATOM 4996 N GLU B 221 43.978 14.983 -65.478 1.00127.74 N
ATOM 4997 CA GLU B 221 45.115 14.101 -65.718 1.00129.54 C
ATOM 4998 C GLU B 221 45.704 13.481 -64.456 1.00130.00 C
ATOM 4999 O GLU B 221 46.257 12.382 -64.503 1.00129.96 O
ATOM 5000 CB GLU B 221 46.205 14.849 -66.506 1.00130.57 C
ATOM 5001 CG GLU B 221 46.537 16.257 -65.997 1.00131.45 C
ATOM 5002 CD GLU B 221 47.509 17.009 -66.909 1.00131.41 C
ATOM 5003 OE1 GLU B 221 47.221 17.138 -68.121 1.00130.83 O
ATOM 5004 OE2 GLU B 221 48.559 17.475 -66.411 1.00131.11 O
ATOM 5005 N GLN B 222 45.550 14.161 -63.325 1.00130.75 N
ATOM 5006 CA GLN B 222 46.093 13.663 -62.069 1.00131.59 C
ATOM 5007 C GLN B 222 45.175 12.743 -61.270 1.00131.60 C
ATOM 5008 O GLN B 222 45.651 11.836 -60.584 1.00131.06 O
ATOM 5009 CB GLN B 222 46.525 14.838 -61.188 1.00132.29 C
ATOM 5010 CG GLN B 222 47.557 15.743 -61.845 1.00133.79 C
ATOM 5011 CD GLN B 222 48.066 16.822 -60.913 1.00134.38 C
ATOM 5012 OE1 GLN B 222 47.285 17.570 -60.327 1.00134.85 O
ATOM 5013 NE2 GLN B 222 49.385 16.913 -60.775 1.00134.79 N
ATOM 5014 N PHE B 223 43.865 12.953 -61.356 1.00132.09 N
ATOM 5015 CA PHE B 223 42.959 12.119 -60.582 1.00132.79 C
ATOM 5016 C PHE B 223 42.025 11.195 -61.345 1.00132.76 C
ATOM 5017 O PHE B 223 41.931 10.014 -61.016 1.00132.46 O
ATOM 5018 CB PHE B 223 42.157 12.987 -59.618 1.00133.56 C
ATOM 5019 CG PHE B 223 43.007 13.690 -58.601 1.00134.69 C
ATOM 5020 CD1 PHE B 223 43.744 14.821 -58.951 1.00135.26 C
ATOM 5021 CD2 PHE B 223 43.103 13.204 -57.300 1.00134.78 C
ATOM 5022 CE1 PHE B 223 44.566 15.457 -58.020 1.00135.53 C
ATOM 5023 CE2 PHE B 223 43.922 13.830 -56.360 1.00135.30 C
ATOM 5024 CZ PHE B 223 44.654 14.959 -56.721 1.00135.61 C
ATOM 5025 N LEU B 224 41.325 11.712 -62.349 1.00132.89 N
ATOM 5026 CA LEU B 224 40.418 10.862 -63.111 1.00133.23 C
ATOM 5027 C LEU B 224 41.176 9.649 -63.631 1.00134.16 C
ATOM 5028 O LEU B 224 42.146 9.788 -64.376 1.00134.47 O
ATOM 5029 CB LEU B 224 39.791 11.637 -64.271 1.00131.94 C
ATOM 5030 CG LEU B 224 38.642 12.551 -63.842 1.00130.98 C
ATOM 5031 CD1 LEU B 224 38.065 13.279 -65.038 1.00130.53 C
ATOM 5032 CD2 LEU B 224 37.570 11.717 -63.173 1.00130.61 C
ATOM 5033 N ASN B 225 40.732 8.461 -63.224 1.00135.23 N
ATOM 5034 CA ASN B 225 41.381 7.214 -63.626 1.00136.13 C
ATOM 5035 C ASN B 225 40.550 6.336 -64.564 1.00136.32 C
ATOM 5036 O ASN B 225 40.648 6.469 -65.786 1.00136.27 O
ATOM 5037 CB ASN B 225 41.763 6.400 -62.384 1.00136.53 C
ATOM 5038 CG ASN B 225 42.502 7.224 -61.349 1.00137.10 C
ATOM 5039 OD1 ASN B 225 43.539 7.827 -61.638 1.00137.27 O
ATOM 5040 ND2 ASN B 225 41.971 7.254 -60.132 1.00137.14 N
ATOM 5041 N ILE B 226 39.742 5.447 -63.978 1.00136.47 N
ATOM 5042 CA ILE B 226 38.897 4.498 -64.715 1.00136.28 C
ATOM 5043 C ILE B 226 39.153 4.550 -66.222 1.00135.93 C
ATOM 5044 O ILE B 226 38.603 5.382 -66.949 1.00136.15 O
ATOM 5045 CB ILE B 226 37.382 4.709 -64.395 1.00136.26 C
ATOM 5046 CG1 ILE B 226 36.562 3.553 -64.983 1.00136.03 C
ATOM 5047 CG2 ILE B 226 36.905 6.056 -64.922 1.00136.38 C
ATOM 5048 CD1 ILE B 226 35.138 3.475 -64.467 1.00136.02 C
ATOM 5049 N ARG B 227 40.012 3.638 -66.670 1.00135.01 N
ATOM 5050 CA ARG B 227 40.428 3.551 -68.062 1.00133.84 C
ATOM 5051 C ARG B 227 39.452 3.912 -69.165 1.00132.28 C
ATOM 5052 O ARG B 227 38.232 3.901 -69.003 1.00131.64 O
ATOM 5053 CB ARG B 227 41.024 2.169 -68.364 1.00134.77 C
ATOM 5054 CG ARG B 227 42.539 2.080 -68.151 1.00135.35 C
ATOM 5055 CD ARG B 227 43.290 3.185 -68.905 1.00136.20 C
ATOM 5056 NE ARG B 227 43.106 4.498 -68.284 1.00137.36 N
ATOM 5057 CZ ARG B 227 43.548 5.647 -68.793 1.00137.72 C
ATOM 5058 NH1 ARG B 227 44.207 5.659 -69.943 1.00138.15 N
ATOM 5059 NH2 ARG B 227 43.331 6.787 -68.146 1.00136.90 N
ATOM 5060 N SER B 228 40.061 4.235 -70.297 1.00130.77 N
ATOM 5061 CA SER B 228 39.398 4.626 -71.525 1.00129.16 C
ATOM 5062 C SER B 228 38.634 3.501 -72.207 1.00127.46 C
ATOM 5063 O SER B 228 38.469 2.407 -71.666 1.00126.69 O
ATOM 5064 CB SER B 228 40.452 5.171 -72.487 1.00129.71 C
ATOM 5065 OG SER B 228 41.585 4.318 -72.502 1.00129.95 O
ATOM 5066 N GLY B 229 38.188 3.794 -73.420 1.00125.77 N
ATOM 5067 CA GLY B 229 37.441 2.830 -74.192 1.00124.14 C
ATOM 5068 C GLY B 229 36.028 3.333 -74.334 1.00122.87 C
ATOM 5069 O GLY B 229 35.671 4.355 -73.754 1.00123.00 O
ATOM 5070 N ALA B 230 35.228 2.629 -75.118 1.00121.68 N
ATOM 5071 CA ALA B 230 33.846 3.017 -75.303 1.00120.58 C
ATOM 5072 C ALA B 230 32.997 2.025 -74.531 1.00119.78 C
ATOM 5073 O ALA B 230 31.769 2.055 -74.612 1.00120.36 O
ATOM 5074 CB ALA B 230 33.482 2.992 -76.779 1.00120.75 C
ATOM 5075 N GLY B 231 33.651 1.148 -73.774 1.00118.31 N
ATOM 5076 CA GLY B 231 32.910 0.162 -73.013 1.00116.70 C
ATOM 5077 C GLY B 231 31.821 -0.428 -73.886 1.00115.78 C
ATOM 5078 O GLY B 231 31.894 -0.345 -75.112 1.00116.30 O
ATOM 5079 N THR B 232 30.805 -1.025 -73.278 1.00114.70 N
ATOM 5080 CA THR B 232 29.731 -1.601 -74.069 1.00114.06 C
ATOM 5081 C THR B 232 29.018 -0.494 -74.837 1.00113.53 C
ATOM 5082 O THR B 232 28.639 0.535 -74.270 1.00113.59 O
ATOM 5083 CB THR B 232 28.709 -2.341 -73.186 1.00114.51 C
ATOM 5084 OG1 THR B 232 29.359 -3.429 -72.520 1.00114.72 O
ATOM 5085 CG2 THR B 232 27.560 -2.885 -74.034 1.00113.79 C
ATOM 5086 N SER B 233 28.853 -0.711 -76.137 1.00112.12 N
ATOM 5087 CA SER B 233 28.182 0.253 -76.992 1.00110.21 C
ATOM 5088 C SER B 233 26.695 -0.052 -76.973 1.00108.65 C
ATOM 5089 O SER B 233 26.291 -1.210 -76.858 1.00107.52 O
ATOM 5090 CB SER B 233 28.715 0.144 -78.420 1.00110.89 C
ATOM 5091 OG SER B 233 30.125 0.270 -78.445 1.00111.20 O
ATOM 5092 N SER B 234 25.881 0.992 -77.083 1.00107.47 N
ATOM 5093 CA SER B 234 24.432 0.831 -77.075 1.00106.05 C
ATOM 5094 C SER B 234 23.924 0.278 -78.395 1.00104.92 C
ATOM 5095 O SER B 234 24.558 0.452 -79.436 1.00104.91 O
ATOM 5096 CB SER B 234 23.752 2.176 -76.799 1.00106.15 C
ATOM 5097 OG SER B 234 22.347 2.088 -76.989 1.00105.80 O
ATOM 5098 N ALA B 235 22.778 -0.394 -78.345 1.00103.44 N
ATOM 5099 CA ALA B 235 22.171 -0.940 -79.550 1.00102.65 C
ATOM 5100 C ALA B 235 21.611 0.248 -80.332 1.00101.95 C
ATOM 5101 O ALA B 235 21.313 1.292 -79.753 1.00102.91 O
ATOM 5102 CB ALA B 235 21.054 -1.907 -79.183 1.00101.84 C
ATOM 5103 N LYS B 236 21.478 0.102 -81.644 1.00100.72 N
ATOM 5104 CA LYS B 236 20.948 1.186 -82.465 1.00 99.03 C
ATOM 5105 C LYS B 236 19.469 1.389 -82.149 1.00 97.16 C
ATOM 5106 O LYS B 236 18.762 0.440 -81.807 1.00 97.13 O
ATOM 5107 CB LYS B 236 21.123 0.850 -83.944 1.00 99.96 C
ATOM 5108 CG LYS B 236 22.557 0.484 -84.318 1.00101.73 C
ATOM 5109 CD LYS B 236 22.666 -0.033 -85.758 1.00101.63 C
ATOM 5110 CE LYS B 236 21.890 -1.335 -85.958 1.00100.59 C
ATOM 5111 NZ LYS B 236 21.944 -1.811 -87.370 1.00 99.85 N
ATOM 5112 N ALA B 237 19.007 2.628 -82.257 1.00 94.27 N
ATOM 5113 CA ALA B 237 17.615 2.934 -81.976 1.00 91.60 C
ATOM 5114 C ALA B 237 16.737 2.573 -83.163 1.00 90.01 C
ATOM 5115 O ALA B 237 16.865 3.155 -84.234 1.00 88.96 O
ATOM 5116 CB ALA B 237 17.471 4.404 -81.651 1.00 92.00 C
ATOM 5117 N THR B 238 15.845 1.608 -82.964 1.00 88.66 N
ATOM 5118 CA THR B 238 14.938 1.166 -84.019 1.00 87.53 C
ATOM 5119 C THR B 238 13.570 1.792 -83.820 1.00 86.25 C
ATOM 5120 O THR B 238 12.977 1.671 -82.750 1.00 86.78 O
ATOM 5121 CB THR B 238 14.772 -0.368 -84.010 1.00 88.27 C
ATOM 5122 OG1 THR B 238 16.035 -0.984 -84.288 1.00 88.52 O
ATOM 5123 CG2 THR B 238 13.748 -0.808 -85.061 1.00 87.90 C
ATOM 5124 N TYR B 239 13.064 2.451 -84.858 1.00 84.34 N
ATOM 5125 CA TYR B 239 11.763 3.106 -84.787 1.00 82.63 C
ATOM 5126 C TYR B 239 10.606 2.105 -84.848 1.00 82.57 C
ATOM 5127 O TYR B 239 10.627 1.165 -85.636 1.00 82.19 O
ATOM 5128 CB TYR B 239 11.627 4.121 -85.924 1.00 79.48 C
ATOM 5129 CG TYR B 239 10.492 5.098 -85.725 1.00 77.02 C
ATOM 5130 CD1 TYR B 239 10.712 6.338 -85.127 1.00 74.74 C
ATOM 5131 CD2 TYR B 239 9.190 4.777 -86.123 1.00 75.23 C
ATOM 5132 CE1 TYR B 239 9.664 7.234 -84.933 1.00 73.53 C
ATOM 5133 CE2 TYR B 239 8.138 5.665 -85.932 1.00 73.46 C
ATOM 5134 CZ TYR B 239 8.380 6.892 -85.337 1.00 73.12 C
ATOM 5135 OH TYR B 239 7.342 7.775 -85.146 1.00 71.28 O
ATOM 5136 N TRP B 240 9.594 2.312 -84.010 1.00 82.92 N
ATOM 5137 CA TRP B 240 8.440 1.425 -83.989 1.00 83.20 C
ATOM 5138 C TRP B 240 7.166 2.116 -84.464 1.00 83.33 C
ATOM 5139 O TRP B 240 6.397 1.541 -85.238 1.00 83.88 O
ATOM 5140 CB TRP B 240 8.229 0.851 -82.581 1.00 83.62 C
ATOM 5141 CG TRP B 240 6.956 0.042 -82.435 1.00 84.59 C
ATOM 5142 CD1 TRP B 240 6.336 -0.703 -83.402 1.00 84.74 C
ATOM 5143 CD2 TRP B 240 6.162 -0.109 -81.249 1.00 85.09 C
ATOM 5144 NE1 TRP B 240 5.209 -1.303 -82.895 1.00 84.89 N
ATOM 5145 CE2 TRP B 240 5.077 -0.958 -81.577 1.00 85.27 C
ATOM 5146 CE3 TRP B 240 6.261 0.389 -79.943 1.00 85.73 C
ATOM 5147 CZ2 TRP B 240 4.099 -1.320 -80.645 1.00 85.80 C
ATOM 5148 CZ3 TRP B 240 5.287 0.029 -79.013 1.00 85.86 C
ATOM 5149 CH2 TRP B 240 4.219 -0.819 -79.372 1.00 86.31 C
ATOM 5150 N GLY B 241 6.940 3.347 -84.012 1.00 82.73 N
ATOM 5151 CA GLY B 241 5.736 4.052 -84.416 1.00 81.91 C
ATOM 5152 C GLY B 241 4.511 3.404 -83.789 1.00 81.16 C
ATOM 5153 O GLY B 241 3.495 3.150 -84.455 1.00 80.63 O
ATOM 5154 N GLY B 242 4.622 3.132 -82.492 1.00 79.79 N
ATOM 5155 CA GLY B 242 3.536 2.518 -81.759 1.00 77.62 C
ATOM 5156 C GLY B 242 2.554 3.533 -81.207 1.00 75.72 C
ATOM 5157 O GLY B 242 2.657 4.734 -81.459 1.00 74.07 O
ATOM 5158 N GLU B 243 1.601 3.038 -80.430 1.00 74.13 N
ATOM 5159 CA GLU B 243 0.580 3.886 -79.851 1.00 72.04 C
ATOM 5160 C GLU B 243 0.156 3.332 -78.494 1.00 69.27 C
ATOM 5161 O GLU B 243 -0.403 2.235 -78.404 1.00 69.80 O
ATOM 5162 CB GLU B 243 -0.601 3.959 -80.829 1.00 73.73 C
ATOM 5163 CG GLU B 243 -1.881 4.549 -80.290 1.00 76.18 C
ATOM 5164 CD GLU B 243 -2.932 4.717 -81.374 1.00 77.34 C
ATOM 5165 OE1 GLU B 243 -2.946 3.894 -82.316 1.00 76.47 O
ATOM 5166 OE2 GLU B 243 -3.748 5.665 -81.272 1.00 79.40 O
ATOM 5167 N ILE B 244 0.445 4.094 -77.443 1.00 64.91 N
ATOM 5168 CA ILE B 244 0.097 3.714 -76.075 1.00 60.17 C
ATOM 5169 C ILE B 244 -0.940 4.682 -75.484 1.00 59.33 C
ATOM 5170 O ILE B 244 -0.742 5.899 -75.464 1.00 57.76 O
ATOM 5171 CB ILE B 244 1.348 3.712 -75.175 1.00 57.07 C
ATOM 5172 CG1 ILE B 244 2.376 2.721 -75.712 1.00 56.07 C
ATOM 5173 CG2 ILE B 244 0.973 3.342 -73.763 1.00 55.58 C
ATOM 5174 CD1 ILE B 244 3.716 2.785 -75.001 1.00 52.73 C
ATOM 5175 N ARG B 245 -2.048 4.138 -75.004 1.00 58.63 N
ATOM 5176 CA ARG B 245 -3.096 4.967 -74.431 1.00 59.06 C
ATOM 5177 C ARG B 245 -3.376 4.574 -72.989 1.00 60.28 C
ATOM 5178 O ARG B 245 -3.737 3.433 -72.715 1.00 61.49 O
ATOM 5179 CB ARG B 245 -4.379 4.824 -75.252 1.00 57.59 C
ATOM 5180 CG ARG B 245 -4.214 5.156 -76.725 1.00 54.43 C
ATOM 5181 CD ARG B 245 -5.326 4.541 -77.538 1.00 51.74 C
ATOM 5182 NE ARG B 245 -6.643 5.093 -77.228 1.00 51.48 N
ATOM 5183 CZ ARG B 245 -7.108 6.251 -77.694 1.00 49.57 C
ATOM 5184 NH1 ARG B 245 -6.365 7.002 -78.499 1.00 48.89 N
ATOM 5185 NH2 ARG B 245 -8.329 6.645 -77.372 1.00 47.95 N
ATOM 5186 N GLU B 246 -3.217 5.526 -72.073 1.00 60.75 N
ATOM 5187 CA GLU B 246 -3.464 5.283 -70.659 1.00 60.13 C
ATOM 5188 C GLU B 246 -4.772 5.926 -70.192 1.00 59.68 C
ATOM 5189 O GLU B 246 -4.835 7.129 -69.923 1.00 58.74 O
ATOM 5190 CB GLU B 246 -2.295 5.814 -69.839 1.00 61.74 C
ATOM 5191 CG GLU B 246 -2.514 5.747 -68.339 1.00 66.84 C
ATOM 5192 CD GLU B 246 -1.339 6.307 -67.537 1.00 69.94 C
ATOM 5193 OE1 GLU B 246 -1.591 6.886 -66.453 1.00 70.93 O
ATOM 5194 OE2 GLU B 246 -0.171 6.159 -67.980 1.00 70.54 O
ATOM 5195 N GLN B 247 -5.824 5.117 -70.117 1.00 59.42 N
ATOM 5196 CA GLN B 247 -7.129 5.600 -69.677 1.00 59.74 C
ATOM 5197 C GLN B 247 -7.094 5.669 -68.162 1.00 60.45 C
ATOM 5198 O GLN B 247 -7.176 4.637 -67.491 1.00 61.38 O
ATOM 5199 CB GLN B 247 -8.227 4.637 -70.131 1.00 58.48 C
ATOM 5200 CG GLN B 247 -9.593 4.851 -69.492 1.00 57.72 C
ATOM 5201 CD GLN B 247 -10.237 6.167 -69.874 1.00 58.32 C
ATOM 5202 OE1 GLN B 247 -10.311 6.521 -71.048 1.00 60.57 O
ATOM 5203 NE2 GLN B 247 -10.723 6.892 -68.883 1.00 58.45 N
ATOM 5204 N ASN B 248 -6.969 6.878 -67.622 1.00 60.45 N
ATOM 5205 CA ASN B 248 -6.901 7.041 -66.176 1.00 61.35 C
ATOM 5206 C ASN B 248 -7.954 7.995 -65.621 1.00 62.53 C
ATOM 5207 O ASN B 248 -7.946 8.343 -64.435 1.00 62.01 O
ATOM 5208 CB ASN B 248 -5.497 7.495 -65.775 1.00 60.02 C
ATOM 5209 CG ASN B 248 -5.177 8.892 -66.245 1.00 58.89 C
ATOM 5210 OD1 ASN B 248 -4.012 9.269 -66.319 1.00 59.04 O
ATOM 5211 ND2 ASN B 248 -6.206 9.679 -66.545 1.00 58.79 N
ATOM 5212 N GLY B 249 -8.850 8.429 -66.497 1.00 63.61 N
ATOM 5213 CA GLY B 249 -9.929 9.302 -66.082 1.00 66.42 C
ATOM 5214 C GLY B 249 -9.719 10.778 -65.787 1.00 67.82 C
ATOM 5215 O GLY B 249 -10.701 11.447 -65.467 1.00 67.82 O
ATOM 5216 N HIS B 250 -8.496 11.301 -65.881 1.00 69.50 N
ATOM 5217 CA HIS B 250 -8.273 12.729 -65.604 1.00 71.23 C
ATOM 5218 C HIS B 250 -9.056 13.675 -66.515 1.00 70.71 C
ATOM 5219 O HIS B 250 -9.208 13.427 -67.712 1.00 70.03 O
ATOM 5220 CB HIS B 250 -6.790 13.087 -65.690 1.00 73.99 C
ATOM 5221 CG HIS B 250 -5.977 12.522 -64.573 1.00 77.91 C
ATOM 5222 ND1 HIS B 250 -6.443 12.468 -63.276 1.00 79.72 N
ATOM 5223 CD2 HIS B 250 -4.729 11.996 -64.550 1.00 78.41 C
ATOM 5224 CE1 HIS B 250 -5.515 11.931 -62.501 1.00 80.02 C
ATOM 5225 NE2 HIS B 250 -4.467 11.636 -63.250 1.00 80.19 N
ATOM 5226 N SER B 251 -9.539 14.769 -65.932 1.00 70.82 N
ATOM 5227 CA SER B 251 -10.316 15.774 -66.663 1.00 69.95 C
ATOM 5228 C SER B 251 -9.532 16.329 -67.855 1.00 67.62 C
ATOM 5229 O SER B 251 -10.116 16.739 -68.862 1.00 67.67 O
ATOM 5230 CB SER B 251 -10.711 16.915 -65.720 1.00 71.18 C
ATOM 5231 OG SER B 251 -9.562 17.470 -65.095 1.00 75.22 O
ATOM 5232 N LEU B 252 -8.210 16.341 -67.731 1.00 64.21 N
ATOM 5233 CA LEU B 252 -7.363 16.822 -68.804 1.00 61.40 C
ATOM 5234 C LEU B 252 -6.720 15.657 -69.549 1.00 60.61 C
ATOM 5235 O LEU B 252 -6.299 14.672 -68.942 1.00 62.07 O
ATOM 5236 CB LEU B 252 -6.267 17.740 -68.256 1.00 60.07 C
ATOM 5237 CG LEU B 252 -6.679 19.046 -67.581 1.00 58.01 C
ATOM 5238 CD1 LEU B 252 -5.465 19.938 -67.493 1.00 57.43 C
ATOM 5239 CD2 LEU B 252 -7.756 19.740 -68.387 1.00 58.71 C
ATOM 5240 N VAL B 253 -6.651 15.772 -70.869 1.00 58.51 N
ATOM 5241 CA VAL B 253 -6.031 14.745 -71.688 1.00 56.28 C
ATOM 5242 C VAL B 253 -4.742 15.273 -72.310 1.00 56.19 C
ATOM 5243 O VAL B 253 -4.737 16.278 -73.035 1.00 56.20 O
ATOM 5244 CB VAL B 253 -6.957 14.284 -72.819 1.00 55.84 C
ATOM 5245 CG1 VAL B 253 -6.234 13.285 -73.697 1.00 53.48 C
ATOM 5246 CG2 VAL B 253 -8.211 13.676 -72.243 1.00 54.94 C
ATOM 5247 N HIS B 254 -3.643 14.602 -71.998 1.00 55.14 N
ATOM 5248 CA HIS B 254 -2.355 14.977 -72.546 1.00 54.83 C
ATOM 5249 C HIS B 254 -2.090 14.036 -73.697 1.00 54.75 C
ATOM 5250 O HIS B 254 -2.228 12.830 -73.553 1.00 55.57 O
ATOM 5251 CB HIS B 254 -1.246 14.817 -71.506 1.00 54.55 C
ATOM 5252 CG HIS B 254 -1.230 15.888 -70.464 1.00 54.69 C
ATOM 5253 ND1 HIS B 254 -0.114 16.651 -70.204 1.00 54.46 N
ATOM 5254 CD2 HIS B 254 -2.184 16.308 -69.600 1.00 54.95 C
ATOM 5255 CE1 HIS B 254 -0.379 17.496 -69.224 1.00 55.48 C
ATOM 5256 NE2 HIS B 254 -1.628 17.307 -68.839 1.00 55.63 N
ATOM 5257 N ALA B 255 -1.718 14.583 -74.843 1.00 55.02 N
ATOM 5258 CA ALA B 255 -1.417 13.749 -75.993 1.00 55.53 C
ATOM 5259 C ALA B 255 -0.192 14.271 -76.744 1.00 56.20 C
ATOM 5260 O ALA B 255 0.064 15.483 -76.796 1.00 56.58 O
ATOM 5261 CB ALA B 255 -2.616 13.683 -76.914 1.00 54.57 C
ATOM 5262 N ALA B 256 0.580 13.348 -77.301 1.00 55.75 N
ATOM 5263 CA ALA B 256 1.757 13.718 -78.060 1.00 56.72 C
ATOM 5264 C ALA B 256 1.811 12.849 -79.301 1.00 58.35 C
ATOM 5265 O ALA B 256 1.648 11.632 -79.222 1.00 58.84 O
ATOM 5266 CB ALA B 256 2.994 13.524 -77.236 1.00 55.08 C
ATOM 5267 N VAL B 257 1.996 13.483 -80.454 1.00 60.57 N
ATOM 5268 CA VAL B 257 2.094 12.764 -81.718 1.00 61.82 C
ATOM 5269 C VAL B 257 3.427 13.150 -82.323 1.00 63.37 C
ATOM 5270 O VAL B 257 3.747 14.337 -82.435 1.00 63.37 O
ATOM 5271 CB VAL B 257 0.983 13.154 -82.698 1.00 60.86 C
ATOM 5272 CG1 VAL B 257 1.182 12.413 -83.996 1.00 60.18 C
ATOM 5273 CG2 VAL B 257 -0.372 12.817 -82.119 1.00 60.80 C
ATOM 5274 N VAL B 258 4.216 12.155 -82.699 1.00 64.93 N
ATOM 5275 CA VAL B 258 5.512 12.453 -83.271 1.00 67.39 C
ATOM 5276 C VAL B 258 5.892 11.556 -84.421 1.00 69.28 C
ATOM 5277 O VAL B 258 5.201 10.595 -84.754 1.00 69.57 O
ATOM 5278 CB VAL B 258 6.636 12.352 -82.225 1.00 67.54 C
ATOM 5279 CG1 VAL B 258 6.427 13.378 -81.132 1.00 67.76 C
ATOM 5280 CG2 VAL B 258 6.679 10.944 -81.655 1.00 67.40 C
ATOM 5281 N THR B 259 7.032 11.892 -85.001 1.00 71.29 N
ATOM 5282 CA THR B 259 7.609 11.183 -86.122 1.00 72.78 C
ATOM 5283 C THR B 259 9.109 11.204 -85.879 1.00 74.05 C
ATOM 5284 O THR B 259 9.604 12.051 -85.133 1.00 74.67 O
ATOM 5285 CB THR B 259 7.294 11.925 -87.430 1.00 72.70 C
ATOM 5286 OG1 THR B 259 5.948 11.632 -87.830 1.00 74.20 O
ATOM 5287 CG2 THR B 259 8.266 11.534 -88.522 1.00 73.28 C
ATOM 5288 N GLU B 260 9.835 10.272 -86.481 1.00 75.44 N
ATOM 5289 CA GLU B 260 11.280 10.256 -86.319 1.00 76.18 C
ATOM 5290 C GLU B 260 11.825 11.555 -86.931 1.00 76.45 C
ATOM 5291 O GLU B 260 11.577 11.861 -88.095 1.00 77.15 O
ATOM 5292 CB GLU B 260 11.858 9.024 -87.019 1.00 76.84 C
ATOM 5293 CG GLU B 260 13.379 8.940 -87.022 1.00 79.69 C
ATOM 5294 CD GLU B 260 13.891 7.525 -87.287 1.00 81.67 C
ATOM 5295 OE1 GLU B 260 13.216 6.763 -88.025 1.00 81.55 O
ATOM 5296 OE2 GLU B 260 14.974 7.178 -86.764 1.00 82.67 O
ATOM 5297 N GLY B 261 12.538 12.339 -86.134 1.00 76.44 N
ATOM 5298 CA GLY B 261 13.082 13.584 -86.636 1.00 76.24 C
ATOM 5299 C GLY B 261 14.592 13.526 -86.719 1.00 77.22 C
ATOM 5300 O GLY B 261 15.185 12.453 -86.627 1.00 76.77 O
ATOM 5301 N ALA B 262 15.220 14.684 -86.882 1.00 78.51 N
ATOM 5302 CA ALA B 262 16.673 14.758 -86.990 1.00 79.70 C
ATOM 5303 C ALA B 262 17.353 14.389 -85.685 1.00 80.15 C
ATOM 5304 O ALA B 262 16.765 14.525 -84.612 1.00 80.97 O
ATOM 5305 CB ALA B 262 17.097 16.165 -87.418 1.00 80.31 C
ATOM 5306 N ALA B 263 18.596 13.925 -85.791 1.00 80.40 N
ATOM 5307 CA ALA B 263 19.378 13.536 -84.631 1.00 81.12 C
ATOM 5308 C ALA B 263 20.330 14.665 -84.280 1.00 82.47 C
ATOM 5309 O ALA B 263 20.347 15.692 -84.951 1.00 81.98 O
ATOM 5310 CB ALA B 263 20.161 12.273 -84.933 1.00 80.27 C
ATOM 5311 N VAL B 264 21.112 14.470 -83.223 1.00 84.93 N
ATOM 5312 CA VAL B 264 22.086 15.467 -82.788 1.00 86.22 C
ATOM 5313 C VAL B 264 23.084 15.656 -83.919 1.00 87.19 C
ATOM 5314 O VAL B 264 23.560 14.679 -84.502 1.00 86.93 O
ATOM 5315 CB VAL B 264 22.880 15.000 -81.544 1.00 86.63 C
ATOM 5316 CG1 VAL B 264 23.812 16.107 -81.077 1.00 85.53 C
ATOM 5317 CG2 VAL B 264 21.932 14.595 -80.434 1.00 87.53 C
ATOM 5318 N GLY B 265 23.405 16.912 -84.218 1.00 88.06 N
ATOM 5319 CA GLY B 265 24.343 17.197 -85.287 1.00 89.13 C
ATOM 5320 C GLY B 265 23.712 16.919 -86.637 1.00 90.14 C
ATOM 5321 O GLY B 265 23.822 15.813 -87.176 1.00 90.00 O
ATOM 5322 N SER B 266 23.043 17.923 -87.187 1.00 90.49 N
ATOM 5323 CA SER B 266 22.391 17.768 -88.475 1.00 91.47 C
ATOM 5324 C SER B 266 21.861 19.106 -88.966 1.00 92.24 C
ATOM 5325 O SER B 266 21.396 19.931 -88.175 1.00 92.89 O
ATOM 5326 CB SER B 266 21.237 16.765 -88.355 1.00 90.83 C
ATOM 5327 OG SER B 266 20.533 16.641 -89.578 1.00 91.42 O
ATOM 5328 N ALA B 267 21.952 19.332 -90.273 1.00 92.79 N
ATOM 5329 CA ALA B 267 21.445 20.568 -90.851 1.00 92.85 C
ATOM 5330 C ALA B 267 19.928 20.430 -90.794 1.00 92.25 C
ATOM 5331 O ALA B 267 19.191 21.414 -90.858 1.00 93.08 O
ATOM 5332 CB ALA B 267 21.915 20.718 -92.303 1.00 92.70 C
ATOM 5333 N GLU B 268 19.483 19.184 -90.660 1.00 90.78 N
ATOM 5334 CA GLU B 268 18.066 18.859 -90.577 1.00 89.44 C
ATOM 5335 C GLU B 268 17.532 19.323 -89.217 1.00 87.68 C
ATOM 5336 O GLU B 268 16.398 19.800 -89.103 1.00 86.99 O
ATOM 5337 CB GLU B 268 17.892 17.344 -90.755 1.00 90.02 C
ATOM 5338 CG GLU B 268 16.452 16.863 -90.792 1.00 91.42 C
ATOM 5339 CD GLU B 268 16.329 15.422 -91.269 1.00 92.37 C
ATOM 5340 OE1 GLU B 268 17.129 14.571 -90.812 1.00 92.41 O
ATOM 5341 OE2 GLU B 268 15.426 15.144 -92.093 1.00 92.14 O
ATOM 5342 N ALA B 269 18.374 19.192 -88.196 1.00 85.46 N
ATOM 5343 CA ALA B 269 18.026 19.600 -86.845 1.00 82.98 C
ATOM 5344 C ALA B 269 17.506 21.026 -86.877 1.00 81.64 C
ATOM 5345 O ALA B 269 16.386 21.296 -86.451 1.00 81.64 O
ATOM 5346 CB ALA B 269 19.245 19.511 -85.949 1.00 82.27 C
ATOM 5347 N ASN B 270 18.330 21.932 -87.392 1.00 80.02 N
ATOM 5348 CA ASN B 270 17.979 23.347 -87.493 1.00 78.78 C
ATOM 5349 C ASN B 270 16.645 23.610 -88.178 1.00 77.20 C
ATOM 5350 O ASN B 270 15.941 24.565 -87.842 1.00 75.67 O
ATOM 5351 CB ASN B 270 19.072 24.105 -88.243 1.00 80.23 C
ATOM 5352 CG ASN B 270 20.243 24.458 -87.362 1.00 81.02 C
ATOM 5353 OD1 ASN B 270 20.131 25.302 -86.475 1.00 80.79 O
ATOM 5354 ND2 ASN B 270 21.381 23.809 -87.596 1.00 81.81 N
ATOM 5355 N ALA B 271 16.311 22.773 -89.152 1.00 76.19 N
ATOM 5356 CA ALA B 271 15.066 22.926 -89.888 1.00 76.74 C
ATOM 5357 C ALA B 271 13.894 22.725 -88.945 1.00 77.50 C
ATOM 5358 O ALA B 271 12.963 23.537 -88.893 1.00 77.49 O
ATOM 5359 CB ALA B 271 15.007 21.913 -91.030 1.00 76.91 C
ATOM 5360 N PHE B 272 13.946 21.631 -88.195 1.00 78.15 N
ATOM 5361 CA PHE B 272 12.887 21.329 -87.247 1.00 78.42 C
ATOM 5362 C PHE B 272 12.813 22.376 -86.136 1.00 77.67 C
ATOM 5363 O PHE B 272 11.726 22.799 -85.754 1.00 77.69 O
ATOM 5364 CB PHE B 272 13.086 19.926 -86.669 1.00 78.52 C
ATOM 5365 CG PHE B 272 12.703 18.830 -87.622 1.00 78.78 C
ATOM 5366 CD1 PHE B 272 13.671 18.012 -88.192 1.00 79.11 C
ATOM 5367 CD2 PHE B 272 11.367 18.622 -87.957 1.00 78.63 C
ATOM 5368 CE1 PHE B 272 13.311 17.001 -89.082 1.00 79.47 C
ATOM 5369 CE2 PHE B 272 10.997 17.618 -88.842 1.00 78.28 C
ATOM 5370 CZ PHE B 272 11.971 16.805 -89.406 1.00 79.18 C
ATOM 5371 N SER B 273 13.967 22.796 -85.626 1.00 76.73 N
ATOM 5372 CA SER B 273 13.996 23.810 -84.581 1.00 76.71 C
ATOM 5373 C SER B 273 13.177 25.006 -85.053 1.00 76.10 C
ATOM 5374 O SER B 273 12.277 25.477 -84.353 1.00 76.06 O
ATOM 5375 CB SER B 273 15.435 24.256 -84.297 1.00 76.92 C
ATOM 5376 OG SER B 273 16.232 23.171 -83.845 1.00 78.16 O
ATOM 5377 N VAL B 274 13.484 25.485 -86.253 1.00 75.08 N
ATOM 5378 CA VAL B 274 12.766 26.619 -86.812 1.00 73.65 C
ATOM 5379 C VAL B 274 11.282 26.296 -86.996 1.00 73.39 C
ATOM 5380 O VAL B 274 10.426 27.101 -86.632 1.00 74.55 O
ATOM 5381 CB VAL B 274 13.381 27.061 -88.160 1.00 72.75 C
ATOM 5382 CG1 VAL B 274 12.626 28.254 -88.707 1.00 71.31 C
ATOM 5383 CG2 VAL B 274 14.844 27.426 -87.963 1.00 71.43 C
ATOM 5384 N LEU B 275 10.967 25.127 -87.551 1.00 71.96 N
ATOM 5385 CA LEU B 275 9.562 24.745 -87.742 1.00 69.92 C
ATOM 5386 C LEU B 275 8.870 24.706 -86.386 1.00 69.94 C
ATOM 5387 O LEU B 275 7.687 25.019 -86.259 1.00 68.76 O
ATOM 5388 CB LEU B 275 9.453 23.363 -88.401 1.00 67.28 C
ATOM 5389 CG LEU B 275 8.025 22.800 -88.469 1.00 64.56 C
ATOM 5390 CD1 LEU B 275 7.141 23.716 -89.284 1.00 61.93 C
ATOM 5391 CD2 LEU B 275 8.040 21.413 -89.066 1.00 62.52 C
ATOM 5392 N GLN B 276 9.632 24.301 -85.376 1.00 71.13 N
ATOM 5393 CA GLN B 276 9.142 24.213 -84.009 1.00 71.62 C
ATOM 5394 C GLN B 276 8.654 25.591 -83.592 1.00 71.72 C
ATOM 5395 O GLN B 276 7.502 25.758 -83.191 1.00 70.82 O
ATOM 5396 CB GLN B 276 10.274 23.768 -83.083 1.00 72.24 C
ATOM 5397 CG GLN B 276 9.886 23.594 -81.624 1.00 72.31 C
ATOM 5398 CD GLN B 276 11.077 23.239 -80.733 1.00 72.52 C
ATOM 5399 OE1 GLN B 276 10.901 22.889 -79.564 1.00 72.88 O
ATOM 5400 NE2 GLN B 276 12.291 23.334 -81.282 1.00 70.71 N
ATOM 5401 N HIS B 277 9.544 26.576 -83.699 1.00 71.54 N
ATOM 5402 CA HIS B 277 9.224 27.952 -83.339 1.00 72.11 C
ATOM 5403 C HIS B 277 8.180 28.568 -84.273 1.00 71.63 C
ATOM 5404 O HIS B 277 7.480 29.511 -83.905 1.00 71.69 O
ATOM 5405 CB HIS B 277 10.493 28.808 -83.342 1.00 73.61 C
ATOM 5406 CG HIS B 277 11.399 28.560 -82.175 1.00 75.60 C
ATOM 5407 ND1 HIS B 277 11.045 28.869 -80.878 1.00 77.15 N
ATOM 5408 CD2 HIS B 277 12.652 28.050 -82.110 1.00 76.14 C
ATOM 5409 CE1 HIS B 277 12.042 28.561 -80.067 1.00 77.16 C
ATOM 5410 NE2 HIS B 277 13.029 28.063 -80.789 1.00 76.23 N
ATOM 5411 N VAL B 278 8.075 28.041 -85.485 1.00 70.98 N
ATOM 5412 CA VAL B 278 7.099 28.559 -86.428 1.00 70.62 C
ATOM 5413 C VAL B 278 5.715 28.069 -86.035 1.00 70.28 C
ATOM 5414 O VAL B 278 4.727 28.782 -86.192 1.00 71.04 O
ATOM 5415 CB VAL B 278 7.401 28.090 -87.874 1.00 71.38 C
ATOM 5416 CG1 VAL B 278 6.214 28.419 -88.789 1.00 69.07 C
ATOM 5417 CG2 VAL B 278 8.677 28.758 -88.384 1.00 70.29 C
ATOM 5418 N LEU B 279 5.657 26.845 -85.522 1.00 69.93 N
ATOM 5419 CA LEU B 279 4.401 26.229 -85.106 1.00 69.07 C
ATOM 5420 C LEU B 279 3.920 26.695 -83.730 1.00 68.91 C
ATOM 5421 O LEU B 279 2.720 26.887 -83.509 1.00 67.58 O
ATOM 5422 CB LEU B 279 4.566 24.714 -85.106 1.00 68.00 C
ATOM 5423 CG LEU B 279 4.516 24.041 -86.473 1.00 67.14 C
ATOM 5424 CD1 LEU B 279 5.013 22.609 -86.353 1.00 66.63 C
ATOM 5425 CD2 LEU B 279 3.083 24.086 -87.008 1.00 66.42 C
ATOM 5426 N GLY B 280 4.871 26.867 -82.816 1.00 69.25 N
ATOM 5427 CA GLY B 280 4.568 27.295 -81.462 1.00 69.65 C
ATOM 5428 C GLY B 280 5.416 26.509 -80.478 1.00 70.21 C
ATOM 5429 O GLY B 280 5.167 25.334 -80.236 1.00 70.49 O
ATOM 5430 N ALA B 281 6.429 27.150 -79.910 1.00 71.23 N
ATOM 5431 CA ALA B 281 7.312 26.477 -78.967 1.00 72.71 C
ATOM 5432 C ALA B 281 7.233 27.061 -77.555 1.00 74.17 C
ATOM 5433 O ALA B 281 8.253 27.447 -76.987 1.00 76.15 O
ATOM 5434 CB ALA B 281 8.749 26.546 -79.475 1.00 71.09 C
ATOM 5435 N GLY B 282 6.035 27.133 -76.985 1.00 74.06 N
ATOM 5436 CA GLY B 282 5.925 27.682 -75.644 1.00 74.27 C
ATOM 5437 C GLY B 282 5.508 29.139 -75.612 1.00 74.25 C
ATOM 5438 O GLY B 282 5.712 29.866 -76.583 1.00 74.15 O
ATOM 5439 N PRO B 283 4.920 29.599 -74.497 1.00 73.98 N
ATOM 5440 CA PRO B 283 4.464 30.982 -74.333 1.00 73.65 C
ATOM 5441 C PRO B 283 5.609 31.984 -74.120 1.00 72.89 C
ATOM 5442 O PRO B 283 6.697 31.611 -73.664 1.00 72.26 O
ATOM 5443 CB PRO B 283 3.533 30.882 -73.124 1.00 73.48 C
ATOM 5444 CG PRO B 283 4.240 29.881 -72.278 1.00 72.52 C
ATOM 5445 CD PRO B 283 4.642 28.812 -73.281 1.00 73.20 C
ATOM 5446 N LEU B 284 5.345 33.250 -74.449 1.00 71.37 N
ATOM 5447 CA LEU B 284 6.328 34.323 -74.313 1.00 69.92 C
ATOM 5448 C LEU B 284 5.727 35.486 -73.534 1.00 68.65 C
ATOM 5449 O LEU B 284 6.441 36.377 -73.069 1.00 68.76 O
ATOM 5450 CB LEU B 284 6.743 34.822 -75.692 1.00 71.06 C
ATOM 5451 CG LEU B 284 7.277 33.787 -76.679 1.00 72.65 C
ATOM 5452 CD1 LEU B 284 7.050 34.286 -78.097 1.00 74.51 C
ATOM 5453 CD2 LEU B 284 8.750 33.521 -76.412 1.00 72.10 C
ATOM 5454 N ILE B 285 4.403 35.472 -73.410 1.00 66.64 N
ATOM 5455 CA ILE B 285 3.673 36.511 -72.697 1.00 64.14 C
ATOM 5456 C ILE B 285 2.842 35.846 -71.605 1.00 63.30 C
ATOM 5457 O ILE B 285 2.073 34.918 -71.878 1.00 61.69 O
ATOM 5458 CB ILE B 285 2.713 37.288 -73.654 1.00 64.27 C
ATOM 5459 CG1 ILE B 285 3.500 37.893 -74.818 1.00 62.91 C
ATOM 5460 CG2 ILE B 285 1.978 38.395 -72.900 1.00 61.94 C
ATOM 5461 CD1 ILE B 285 2.612 38.519 -75.866 1.00 61.06 C
ATOM 5462 N LYS B 286 2.999 36.323 -70.374 1.00 62.17 N
ATOM 5463 CA LYS B 286 2.252 35.783 -69.247 1.00 61.52 C
ATOM 5464 C LYS B 286 0.747 35.915 -69.482 1.00 62.00 C
ATOM 5465 O LYS B 286 0.244 37.018 -69.716 1.00 61.09 O
ATOM 5466 CB LYS B 286 2.646 36.513 -67.962 1.00 60.04 C
ATOM 5467 CG LYS B 286 2.053 35.894 -66.716 1.00 60.07 C
ATOM 5468 CD LYS B 286 2.598 36.528 -65.466 1.00 60.07 C
ATOM 5469 CE LYS B 286 1.952 35.922 -64.238 1.00 60.05 C
ATOM 5470 NZ LYS B 286 2.379 36.605 -62.996 1.00 59.91 N
ATOM 5471 N ARG B 287 0.036 34.788 -69.413 1.00 63.39 N
ATOM 5472 CA ARG B 287 -1.419 34.752 -69.626 1.00 64.87 C
ATOM 5473 C ARG B 287 -1.783 35.274 -71.005 1.00 66.22 C
ATOM 5474 O ARG B 287 -2.950 35.349 -71.368 1.00 66.85 O
ATOM 5475 CB ARG B 287 -2.160 35.591 -68.578 1.00 63.64 C
ATOM 5476 CG ARG B 287 -2.010 35.098 -67.147 1.00 63.73 C
ATOM 5477 CD ARG B 287 -3.058 35.743 -66.233 1.00 63.41 C
ATOM 5478 NE ARG B 287 -2.818 35.460 -64.821 1.00 60.24 N
ATOM 5479 CZ ARG B 287 -1.815 35.978 -64.118 1.00 59.26 C
ATOM 5480 NH1 ARG B 287 -0.953 36.811 -64.683 1.00 56.22 N
ATOM 5481 NH2 ARG B 287 -1.663 35.645 -62.846 1.00 59.52 N
ATOM 5482 N GLY B 288 -0.773 35.637 -71.777 1.00 68.13 N
ATOM 5483 CA GLY B 288 -1.036 36.161 -73.097 1.00 69.62 C
ATOM 5484 C GLY B 288 -1.174 35.066 -74.125 1.00 70.34 C
ATOM 5485 O GLY B 288 -0.624 33.974 -73.966 1.00 70.13 O
ATOM 5486 N SER B 289 -1.923 35.361 -75.180 1.00 70.99 N
ATOM 5487 CA SER B 289 -2.118 34.412 -76.259 1.00 72.14 C
ATOM 5488 C SER B 289 -0.842 34.404 -77.092 1.00 73.64 C
ATOM 5489 O SER B 289 -0.038 35.344 -77.038 1.00 74.45 O
ATOM 5490 CB SER B 289 -3.303 34.830 -77.136 1.00 71.34 C
ATOM 5491 OG SER B 289 -3.448 33.945 -78.234 1.00 71.58 O
ATOM 5492 N SER B 290 -0.644 33.335 -77.849 1.00 74.30 N
ATOM 5493 CA SER B 290 0.525 33.240 -78.695 1.00 74.91 C
ATOM 5494 C SER B 290 0.024 33.398 -80.121 1.00 75.79 C
ATOM 5495 O SER B 290 -0.565 32.471 -80.686 1.00 76.22 O
ATOM 5496 CB SER B 290 1.212 31.887 -78.500 1.00 75.31 C
ATOM 5497 OG SER B 290 1.739 31.767 -77.189 1.00 74.12 O
ATOM 5498 N VAL B 291 0.235 34.582 -80.691 1.00 75.86 N
ATOM 5499 CA VAL B 291 -0.210 34.859 -82.056 1.00 76.22 C
ATOM 5500 C VAL B 291 0.777 34.304 -83.081 1.00 75.19 C
ATOM 5501 O VAL B 291 0.384 33.752 -84.106 1.00 74.28 O
ATOM 5502 CB VAL B 291 -0.380 36.362 -82.277 1.00 76.51 C
ATOM 5503 CG1 VAL B 291 -1.064 36.611 -83.612 1.00 77.17 C
ATOM 5504 CG2 VAL B 291 -1.190 36.956 -81.134 1.00 76.40 C
ATOM 5505 N THR B 292 2.060 34.454 -82.775 1.00 75.07 N
ATOM 5506 CA THR B 292 3.150 33.972 -83.614 1.00 74.67 C
ATOM 5507 C THR B 292 3.177 32.442 -83.597 1.00 74.76 C
ATOM 5508 O THR B 292 4.124 31.822 -84.088 1.00 74.69 O
ATOM 5509 CB THR B 292 4.503 34.496 -83.078 1.00 74.96 C
ATOM 5510 OG1 THR B 292 4.470 35.925 -83.058 1.00 75.38 O
ATOM 5511 CG2 THR B 292 5.678 34.028 -83.942 1.00 75.12 C
ATOM 5512 N SER B 293 2.142 31.830 -83.027 1.00 74.07 N
ATOM 5513 CA SER B 293 2.089 30.375 -82.956 1.00 73.62 C
ATOM 5514 C SER B 293 1.010 29.803 -83.858 1.00 72.52 C
ATOM 5515 O SER B 293 -0.173 29.814 -83.514 1.00 71.71 O
ATOM 5516 CB SER B 293 1.852 29.921 -81.518 1.00 74.79 C
ATOM 5517 OG SER B 293 1.778 28.505 -81.446 1.00 77.91 O
ATOM 5518 N LYS B 294 1.431 29.306 -85.015 1.00 71.54 N
ATOM 5519 CA LYS B 294 0.509 28.725 -85.984 1.00 71.30 C
ATOM 5520 C LYS B 294 -0.352 27.662 -85.317 1.00 71.06 C
ATOM 5521 O LYS B 294 -1.581 27.678 -85.415 1.00 71.03 O
ATOM 5522 CB LYS B 294 1.287 28.071 -87.125 1.00 71.20 C
ATOM 5523 CG LYS B 294 2.040 29.019 -88.030 1.00 71.00 C
ATOM 5524 CD LYS B 294 1.117 29.608 -89.061 1.00 69.89 C
ATOM 5525 CE LYS B 294 1.900 30.328 -90.126 1.00 70.16 C
ATOM 5526 NZ LYS B 294 0.982 30.820 -91.181 1.00 71.95 N
ATOM 5527 N LEU B 295 0.319 26.738 -84.637 1.00 70.09 N
ATOM 5528 CA LEU B 295 -0.332 25.628 -83.964 1.00 68.91 C
ATOM 5529 C LEU B 295 -1.334 26.052 -82.884 1.00 69.24 C
ATOM 5530 O LEU B 295 -2.486 25.610 -82.890 1.00 68.48 O
ATOM 5531 CB LEU B 295 0.744 24.720 -83.379 1.00 66.91 C
ATOM 5532 CG LEU B 295 0.305 23.410 -82.741 1.00 66.04 C
ATOM 5533 CD1 LEU B 295 -0.624 22.637 -83.656 1.00 64.02 C
ATOM 5534 CD2 LEU B 295 1.545 22.608 -82.428 1.00 66.22 C
ATOM 5535 N TYR B 296 -0.899 26.909 -81.965 1.00 69.43 N
ATOM 5536 CA TYR B 296 -1.770 27.376 -80.888 1.00 70.56 C
ATOM 5537 C TYR B 296 -2.988 28.097 -81.474 1.00 69.67 C
ATOM 5538 O TYR B 296 -4.134 27.751 -81.184 1.00 69.34 O
ATOM 5539 CB TYR B 296 -0.988 28.316 -79.965 1.00 72.32 C
ATOM 5540 CG TYR B 296 -1.580 28.519 -78.580 1.00 75.10 C
ATOM 5541 CD1 TYR B 296 -2.828 29.125 -78.404 1.00 75.95 C
ATOM 5542 CD2 TYR B 296 -0.858 28.157 -77.436 1.00 76.65 C
ATOM 5543 CE1 TYR B 296 -3.340 29.375 -77.123 1.00 76.64 C
ATOM 5544 CE2 TYR B 296 -1.358 28.403 -76.152 1.00 77.77 C
ATOM 5545 CZ TYR B 296 -2.598 29.014 -76.002 1.00 77.91 C
ATOM 5546 OH TYR B 296 -3.085 29.270 -74.734 1.00 78.26 O
ATOM 5547 N GLN B 297 -2.724 29.094 -82.307 1.00 69.02 N
ATOM 5548 CA GLN B 297 -3.775 29.872 -82.950 1.00 67.97 C
ATOM 5549 C GLN B 297 -4.788 28.996 -83.668 1.00 68.31 C
ATOM 5550 O GLN B 297 -5.973 29.316 -83.702 1.00 67.25 O
ATOM 5551 CB GLN B 297 -3.159 30.855 -83.938 1.00 66.56 C
ATOM 5552 CG GLN B 297 -2.474 32.029 -83.274 1.00 65.63 C
ATOM 5553 CD GLN B 297 -3.454 32.879 -82.501 1.00 64.92 C
ATOM 5554 OE1 GLN B 297 -4.520 33.231 -83.008 1.00 64.37 O
ATOM 5555 NE2 GLN B 297 -3.103 33.216 -81.268 1.00 64.66 N
ATOM 5556 N GLY B 298 -4.314 27.891 -84.240 1.00 69.63 N
ATOM 5557 CA GLY B 298 -5.195 26.986 -84.957 1.00 70.77 C
ATOM 5558 C GLY B 298 -6.121 26.235 -84.022 1.00 71.48 C
ATOM 5559 O GLY B 298 -7.334 26.180 -84.239 1.00 71.90 O
ATOM 5560 N VAL B 299 -5.544 25.654 -82.976 1.00 71.42 N
ATOM 5561 CA VAL B 299 -6.321 24.916 -81.994 1.00 71.87 C
ATOM 5562 C VAL B 299 -7.341 25.858 -81.345 1.00 72.23 C
ATOM 5563 O VAL B 299 -8.493 25.491 -81.114 1.00 71.04 O
ATOM 5564 CB VAL B 299 -5.403 24.342 -80.895 1.00 71.93 C
ATOM 5565 CG1 VAL B 299 -6.228 23.589 -79.873 1.00 72.17 C
ATOM 5566 CG2 VAL B 299 -4.356 23.435 -81.513 1.00 70.83 C
ATOM 5567 N ALA B 300 -6.898 27.078 -81.056 1.00 73.17 N
ATOM 5568 CA ALA B 300 -7.748 28.084 -80.438 1.00 74.70 C
ATOM 5569 C ALA B 300 -9.002 28.312 -81.267 1.00 76.46 C
ATOM 5570 O ALA B 300 -10.094 28.467 -80.728 1.00 76.66 O
ATOM 5571 CB ALA B 300 -6.979 29.391 -80.279 1.00 73.23 C
ATOM 5572 N LYS B 301 -8.846 28.322 -82.584 1.00 79.83 N
ATOM 5573 CA LYS B 301 -9.980 28.545 -83.476 1.00 83.30 C
ATOM 5574 C LYS B 301 -10.954 27.368 -83.429 1.00 84.40 C
ATOM 5575 O LYS B 301 -12.153 27.525 -83.669 1.00 84.34 O
ATOM 5576 CB LYS B 301 -9.491 28.753 -84.921 1.00 84.13 C
ATOM 5577 CG LYS B 301 -8.440 29.849 -85.098 1.00 85.38 C
ATOM 5578 CD LYS B 301 -7.879 29.848 -86.522 1.00 87.90 C
ATOM 5579 CE LYS B 301 -6.602 30.695 -86.670 1.00 88.42 C
ATOM 5580 NZ LYS B 301 -6.807 32.150 -86.418 1.00 88.56 N
ATOM 5581 N ALA B 302 -10.436 26.190 -83.102 1.00 85.70 N
ATOM 5582 CA ALA B 302 -11.258 24.990 -83.059 1.00 87.21 C
ATOM 5583 C ALA B 302 -12.036 24.757 -81.771 1.00 88.02 C
ATOM 5584 O ALA B 302 -13.178 24.307 -81.814 1.00 87.96 O
ATOM 5585 CB ALA B 302 -10.397 23.773 -83.360 1.00 87.51 C
ATOM 5586 N THR B 303 -11.431 25.053 -80.628 1.00 88.78 N
ATOM 5587 CA THR B 303 -12.111 24.820 -79.365 1.00 90.13 C
ATOM 5588 C THR B 303 -12.308 26.089 -78.541 1.00 91.32 C
ATOM 5589 O THR B 303 -11.527 27.037 -78.636 1.00 91.56 O
ATOM 5590 CB THR B 303 -11.344 23.782 -78.529 1.00 90.04 C
ATOM 5591 OG1 THR B 303 -12.113 23.441 -77.369 1.00 90.77 O
ATOM 5592 CG2 THR B 303 -9.989 24.338 -78.102 1.00 90.26 C
ATOM 5593 N THR B 304 -13.360 26.095 -77.728 1.00 92.19 N
ATOM 5594 CA THR B 304 -13.692 27.239 -76.880 1.00 92.84 C
ATOM 5595 C THR B 304 -13.082 27.107 -75.489 1.00 92.49 C
ATOM 5596 O THR B 304 -12.836 28.103 -74.802 1.00 93.41 O
ATOM 5597 CB THR B 304 -15.224 27.370 -76.694 1.00 93.51 C
ATOM 5598 OG1 THR B 304 -15.870 27.329 -77.974 1.00 94.54 O
ATOM 5599 CG2 THR B 304 -15.573 28.685 -75.991 1.00 93.88 C
ATOM 5600 N GLN B 305 -12.835 25.869 -75.081 1.00 91.43 N
ATOM 5601 CA GLN B 305 -12.304 25.594 -73.760 1.00 89.88 C
ATOM 5602 C GLN B 305 -10.798 25.712 -73.590 1.00 88.59 C
ATOM 5603 O GLN B 305 -10.049 25.756 -74.562 1.00 88.15 O
ATOM 5604 CB GLN B 305 -12.764 24.208 -73.318 1.00 89.50 C
ATOM 5605 CG GLN B 305 -14.269 24.084 -73.301 1.00 90.01 C
ATOM 5606 CD GLN B 305 -14.923 25.234 -72.572 1.00 91.08 C
ATOM 5607 OE1 GLN B 305 -14.678 25.449 -71.380 1.00 91.22 O
ATOM 5608 NE2 GLN B 305 -15.754 25.993 -73.284 1.00 91.29 N
ATOM 5609 N PRO B 306 -10.342 25.784 -72.330 1.00 87.67 N
ATOM 5610 CA PRO B 306 -8.921 25.892 -72.005 1.00 85.60 C
ATOM 5611 C PRO B 306 -8.165 24.731 -72.604 1.00 82.79 C
ATOM 5612 O PRO B 306 -8.613 23.586 -72.544 1.00 81.03 O
ATOM 5613 CB PRO B 306 -8.915 25.856 -70.485 1.00 86.71 C
ATOM 5614 CG PRO B 306 -10.182 26.566 -70.149 1.00 87.40 C
ATOM 5615 CD PRO B 306 -11.156 25.923 -71.108 1.00 87.77 C
ATOM 5616 N PHE B 307 -7.014 25.036 -73.184 1.00 81.31 N
ATOM 5617 CA PHE B 307 -6.187 24.014 -73.801 1.00 80.08 C
ATOM 5618 C PHE B 307 -4.743 24.477 -73.876 1.00 77.53 C
ATOM 5619 O PHE B 307 -4.375 25.545 -73.379 1.00 76.59 O
ATOM 5620 CB PHE B 307 -6.682 23.725 -75.217 1.00 81.03 C
ATOM 5621 CG PHE B 307 -6.306 24.789 -76.207 1.00 82.28 C
ATOM 5622 CD1 PHE B 307 -5.065 24.766 -76.834 1.00 82.33 C
ATOM 5623 CD2 PHE B 307 -7.166 25.848 -76.463 1.00 82.94 C
ATOM 5624 CE1 PHE B 307 -4.684 25.780 -77.692 1.00 82.81 C
ATOM 5625 CE2 PHE B 307 -6.794 26.867 -77.321 1.00 83.26 C
ATOM 5626 CZ PHE B 307 -5.548 26.834 -77.938 1.00 83.60 C
ATOM 5627 N ASP B 308 -3.933 23.653 -74.518 1.00 75.50 N
ATOM 5628 CA ASP B 308 -2.537 23.967 -74.703 1.00 74.63 C
ATOM 5629 C ASP B 308 -1.927 23.060 -75.757 1.00 73.51 C
ATOM 5630 O ASP B 308 -1.983 21.836 -75.652 1.00 73.71 O
ATOM 5631 CB ASP B 308 -1.773 23.814 -73.399 1.00 74.84 C
ATOM 5632 CG ASP B 308 -0.407 24.437 -73.471 1.00 76.62 C
ATOM 5633 OD1 ASP B 308 0.157 24.526 -74.583 1.00 77.71 O
ATOM 5634 OD2 ASP B 308 0.115 24.832 -72.419 1.00 78.25 O
ATOM 5635 N ALA B 309 -1.338 23.671 -76.777 1.00 72.17 N
ATOM 5636 CA ALA B 309 -0.703 22.926 -77.850 1.00 70.00 C
ATOM 5637 C ALA B 309 0.705 23.464 -78.069 1.00 68.57 C
ATOM 5638 O ALA B 309 0.945 24.656 -77.930 1.00 68.28 O
ATOM 5639 CB ALA B 309 -1.524 23.052 -79.122 1.00 69.20 C
ATOM 5640 N SER B 310 1.637 22.580 -78.394 1.00 68.40 N
ATOM 5641 CA SER B 310 3.016 22.980 -78.635 1.00 68.82 C
ATOM 5642 C SER B 310 3.739 22.065 -79.600 1.00 68.59 C
ATOM 5643 O SER B 310 3.372 20.906 -79.779 1.00 68.66 O
ATOM 5644 CB SER B 310 3.808 23.013 -77.333 1.00 69.11 C
ATOM 5645 OG SER B 310 3.426 24.119 -76.547 1.00 72.89 O
ATOM 5646 N ALA B 311 4.777 22.601 -80.227 1.00 68.27 N
ATOM 5647 CA ALA B 311 5.571 21.817 -81.147 1.00 66.87 C
ATOM 5648 C ALA B 311 6.552 21.087 -80.254 1.00 65.66 C
ATOM 5649 O ALA B 311 7.239 21.698 -79.441 1.00 64.77 O
ATOM 5650 CB ALA B 311 6.306 22.720 -82.119 1.00 66.41 C
ATOM 5651 N PHE B 312 6.585 19.771 -80.388 1.00 65.65 N
ATOM 5652 CA PHE B 312 7.486 18.945 -79.605 1.00 64.92 C
ATOM 5653 C PHE B 312 8.713 18.696 -80.460 1.00 65.19 C
ATOM 5654 O PHE B 312 8.605 18.609 -81.680 1.00 64.93 O
ATOM 5655 CB PHE B 312 6.819 17.615 -79.271 1.00 63.94 C
ATOM 5656 CG PHE B 312 7.689 16.697 -78.482 1.00 62.63 C
ATOM 5657 CD1 PHE B 312 7.886 16.908 -77.124 1.00 61.04 C
ATOM 5658 CD2 PHE B 312 8.333 15.631 -79.100 1.00 61.73 C
ATOM 5659 CE1 PHE B 312 8.709 16.074 -76.388 1.00 60.78 C
ATOM 5660 CE2 PHE B 312 9.156 14.792 -78.374 1.00 62.05 C
ATOM 5661 CZ PHE B 312 9.345 15.014 -77.009 1.00 61.76 C
ATOM 5662 N ASN B 313 9.873 18.566 -79.832 1.00 65.94 N
ATOM 5663 CA ASN B 313 11.093 18.336 -80.593 1.00 67.60 C
ATOM 5664 C ASN B 313 12.254 17.814 -79.739 1.00 67.95 C
ATOM 5665 O ASN B 313 12.663 18.461 -78.775 1.00 67.79 O
ATOM 5666 CB ASN B 313 11.485 19.650 -81.302 1.00 68.77 C
ATOM 5667 CG ASN B 313 12.788 19.541 -82.098 1.00 70.02 C
ATOM 5668 OD1 ASN B 313 12.941 18.679 -82.968 1.00 70.78 O
ATOM 5669 ND2 ASN B 313 13.726 20.432 -81.805 1.00 70.71 N
ATOM 5670 N VAL B 314 12.783 16.643 -80.092 1.00 68.32 N
ATOM 5671 CA VAL B 314 13.915 16.073 -79.359 1.00 68.94 C
ATOM 5672 C VAL B 314 15.011 15.587 -80.289 1.00 69.75 C
ATOM 5673 O VAL B 314 14.740 14.961 -81.313 1.00 70.70 O
ATOM 5674 CB VAL B 314 13.520 14.864 -78.512 1.00 68.32 C
ATOM 5675 CG1 VAL B 314 14.641 14.534 -77.550 1.00 66.83 C
ATOM 5676 CG2 VAL B 314 12.261 15.141 -77.775 1.00 68.41 C
ATOM 5677 N ASN B 315 16.255 15.854 -79.921 1.00 70.13 N
ATOM 5678 CA ASN B 315 17.367 15.412 -80.744 1.00 71.22 C
ATOM 5679 C ASN B 315 18.312 14.511 -79.964 1.00 71.27 C
ATOM 5680 O ASN B 315 18.939 14.937 -79.001 1.00 70.96 O
ATOM 5681 CB ASN B 315 18.146 16.615 -81.305 1.00 72.40 C
ATOM 5682 CG ASN B 315 17.301 17.495 -82.239 1.00 73.19 C
ATOM 5683 OD1 ASN B 315 16.475 17.002 -83.013 1.00 73.36 O
ATOM 5684 ND2 ASN B 315 17.530 18.804 -82.179 1.00 72.85 N
ATOM 5685 N TYR B 316 18.409 13.257 -80.383 1.00 71.95 N
ATOM 5686 CA TYR B 316 19.301 12.312 -79.727 1.00 72.91 C
ATOM 5687 C TYR B 316 20.488 11.983 -80.634 1.00 73.15 C
ATOM 5688 O TYR B 316 20.477 12.299 -81.825 1.00 72.60 O
ATOM 5689 CB TYR B 316 18.542 11.031 -79.359 1.00 72.92 C
ATOM 5690 CG TYR B 316 17.494 11.233 -78.289 1.00 73.40 C
ATOM 5691 CD1 TYR B 316 16.137 11.092 -78.580 1.00 73.88 C
ATOM 5692 CD2 TYR B 316 17.862 11.567 -76.982 1.00 73.20 C
ATOM 5693 CE1 TYR B 316 15.167 11.276 -77.593 1.00 74.56 C
ATOM 5694 CE2 TYR B 316 16.906 11.755 -75.991 1.00 73.96 C
ATOM 5695 CZ TYR B 316 15.560 11.608 -76.301 1.00 74.84 C
ATOM 5696 OH TYR B 316 14.616 11.796 -75.315 1.00 75.73 O
ATOM 5697 N SER B 317 21.510 11.353 -80.060 1.00 73.40 N
ATOM 5698 CA SER B 317 22.720 10.979 -80.793 1.00 73.35 C
ATOM 5699 C SER B 317 22.458 10.285 -82.131 1.00 73.81 C
ATOM 5700 O SER B 317 22.997 10.690 -83.164 1.00 73.86 O
ATOM 5701 CB SER B 317 23.592 10.066 -79.933 1.00 72.08 C
ATOM 5702 OG SER B 317 23.010 8.781 -79.824 1.00 72.47 O
ATOM 5703 N ASP B 318 21.635 9.240 -82.111 1.00 73.79 N
ATOM 5704 CA ASP B 318 21.345 8.497 -83.328 1.00 73.81 C
ATOM 5705 C ASP B 318 19.883 8.555 -83.780 1.00 72.70 C
ATOM 5706 O ASP B 318 19.403 7.657 -84.484 1.00 72.98 O
ATOM 5707 CB ASP B 318 21.760 7.034 -83.151 1.00 76.47 C
ATOM 5708 CG ASP B 318 20.810 6.260 -82.247 1.00 78.83 C
ATOM 5709 OD1 ASP B 318 20.955 5.019 -82.146 1.00 80.34 O
ATOM 5710 OD2 ASP B 318 19.919 6.892 -81.637 1.00 79.64 O
ATOM 5711 N SER B 319 19.172 9.596 -83.369 1.00 70.47 N
ATOM 5712 CA SER B 319 17.779 9.743 -83.766 1.00 69.67 C
ATOM 5713 C SER B 319 17.164 10.973 -83.115 1.00 68.95 C
ATOM 5714 O SER B 319 17.861 11.761 -82.473 1.00 69.92 O
ATOM 5715 CB SER B 319 16.973 8.491 -83.392 1.00 69.59 C
ATOM 5716 OG SER B 319 15.663 8.533 -83.948 1.00 69.28 O
ATOM 5717 N GLY B 320 15.861 11.142 -83.294 1.00 67.16 N
ATOM 5718 CA GLY B 320 15.184 12.282 -82.712 1.00 65.13 C
ATOM 5719 C GLY B 320 13.698 12.115 -82.928 1.00 64.61 C
ATOM 5720 O GLY B 320 13.270 11.238 -83.681 1.00 64.73 O
ATOM 5721 N LEU B 321 12.901 12.943 -82.267 1.00 63.21 N
ATOM 5722 CA LEU B 321 11.461 12.865 -82.419 1.00 61.73 C
ATOM 5723 C LEU B 321 10.923 14.265 -82.648 1.00 60.86 C
ATOM 5724 O LEU B 321 11.438 15.237 -82.086 1.00 60.63 O
ATOM 5725 CB LEU B 321 10.825 12.251 -81.164 1.00 63.11 C
ATOM 5726 CG LEU B 321 11.256 10.830 -80.762 1.00 63.02 C
ATOM 5727 CD1 LEU B 321 10.501 10.397 -79.512 1.00 62.93 C
ATOM 5728 CD2 LEU B 321 10.980 9.859 -81.901 1.00 62.72 C
ATOM 5729 N PHE B 322 9.898 14.372 -83.485 1.00 59.57 N
ATOM 5730 CA PHE B 322 9.303 15.674 -83.765 1.00 58.81 C
ATOM 5731 C PHE B 322 7.804 15.558 -83.946 1.00 58.63 C
ATOM 5732 O PHE B 322 7.320 14.646 -84.614 1.00 59.71 O
ATOM 5733 CB PHE B 322 9.901 16.298 -85.028 1.00 57.78 C
ATOM 5734 CG PHE B 322 9.330 17.649 -85.349 1.00 55.94 C
ATOM 5735 CD1 PHE B 322 9.904 18.804 -84.817 1.00 55.31 C
ATOM 5736 CD2 PHE B 322 8.165 17.764 -86.111 1.00 54.84 C
ATOM 5737 CE1 PHE B 322 9.326 20.049 -85.031 1.00 53.95 C
ATOM 5738 CE2 PHE B 322 7.578 19.005 -86.331 1.00 53.77 C
ATOM 5739 CZ PHE B 322 8.159 20.149 -85.789 1.00 54.56 C
ATOM 5740 N GLY B 323 7.073 16.494 -83.359 1.00 58.38 N
ATOM 5741 CA GLY B 323 5.629 16.471 -83.472 1.00 58.31 C
ATOM 5742 C GLY B 323 5.016 17.542 -82.603 1.00 59.44 C
ATOM 5743 O GLY B 323 5.584 18.622 -82.433 1.00 58.62 O
ATOM 5744 N PHE B 324 3.859 17.241 -82.035 1.00 60.77 N
ATOM 5745 CA PHE B 324 3.171 18.203 -81.192 1.00 60.91 C
ATOM 5746 C PHE B 324 2.580 17.573 -79.937 1.00 61.20 C
ATOM 5747 O PHE B 324 2.131 16.429 -79.947 1.00 61.64 O
ATOM 5748 CB PHE B 324 2.067 18.880 -82.003 1.00 60.29 C
ATOM 5749 CG PHE B 324 0.971 17.944 -82.449 1.00 60.54 C
ATOM 5750 CD1 PHE B 324 -0.096 17.643 -81.611 1.00 60.78 C
ATOM 5751 CD2 PHE B 324 0.989 17.390 -83.722 1.00 60.91 C
ATOM 5752 CE1 PHE B 324 -1.132 16.806 -82.044 1.00 61.46 C
ATOM 5753 CE2 PHE B 324 -0.041 16.553 -84.160 1.00 61.35 C
ATOM 5754 CZ PHE B 324 -1.101 16.263 -83.322 1.00 61.25 C
ATOM 5755 N TYR B 325 2.570 18.344 -78.857 1.00 61.42 N
ATOM 5756 CA TYR B 325 2.026 17.894 -77.586 1.00 60.76 C
ATOM 5757 C TYR B 325 0.802 18.742 -77.224 1.00 60.85 C
ATOM 5758 O TYR B 325 0.874 19.972 -77.202 1.00 61.77 O
ATOM 5759 CB TYR B 325 3.088 18.050 -76.501 1.00 60.25 C
ATOM 5760 CG TYR B 325 2.718 17.412 -75.189 1.00 61.59 C
ATOM 5761 CD1 TYR B 325 3.304 16.213 -74.795 1.00 61.68 C
ATOM 5762 CD2 TYR B 325 1.784 18.004 -74.336 1.00 61.17 C
ATOM 5763 CE1 TYR B 325 2.983 15.615 -73.584 1.00 62.17 C
ATOM 5764 CE2 TYR B 325 1.447 17.414 -73.120 1.00 62.31 C
ATOM 5765 CZ TYR B 325 2.054 16.213 -72.747 1.00 63.00 C
ATOM 5766 OH TYR B 325 1.741 15.600 -71.550 1.00 62.23 O
ATOM 5767 N THR B 326 -0.326 18.101 -76.944 1.00 59.73 N
ATOM 5768 CA THR B 326 -1.513 18.858 -76.562 1.00 58.71 C
ATOM 5769 C THR B 326 -1.956 18.533 -75.128 1.00 58.44 C
ATOM 5770 O THR B 326 -1.457 17.593 -74.500 1.00 58.35 O
ATOM 5771 CB THR B 326 -2.699 18.576 -77.502 1.00 58.18 C
ATOM 5772 OG1 THR B 326 -3.120 17.216 -77.352 1.00 57.06 O
ATOM 5773 CG2 THR B 326 -2.303 18.821 -78.933 1.00 58.36 C
ATOM 5774 N ILE B 327 -2.884 19.342 -74.625 1.00 56.45 N
ATOM 5775 CA ILE B 327 -3.466 19.193 -73.296 1.00 54.72 C
ATOM 5776 C ILE B 327 -4.831 19.841 -73.429 1.00 55.05 C
ATOM 5777 O ILE B 327 -4.922 21.048 -73.663 1.00 53.91 O
ATOM 5778 CB ILE B 327 -2.698 19.972 -72.213 1.00 52.36 C
ATOM 5779 CG1 ILE B 327 -1.233 19.562 -72.186 1.00 52.08 C
ATOM 5780 CG2 ILE B 327 -3.306 19.681 -70.862 1.00 50.97 C
ATOM 5781 CD1 ILE B 327 -0.443 20.227 -71.080 1.00 51.23 C
ATOM 5782 N SER B 328 -5.895 19.059 -73.284 1.00 55.91 N
ATOM 5783 CA SER B 328 -7.232 19.621 -73.434 1.00 57.14 C
ATOM 5784 C SER B 328 -8.279 18.939 -72.580 1.00 59.01 C
ATOM 5785 O SER B 328 -8.043 17.878 -72.017 1.00 59.65 O
ATOM 5786 CB SER B 328 -7.658 19.531 -74.896 1.00 54.96 C
ATOM 5787 OG SER B 328 -7.591 18.192 -75.348 1.00 52.90 O
ATOM 5788 N GLN B 329 -9.448 19.557 -72.483 1.00 61.54 N
ATOM 5789 CA GLN B 329 -10.517 18.946 -71.724 1.00 63.50 C
ATOM 5790 C GLN B 329 -10.803 17.655 -72.465 1.00 63.09 C
ATOM 5791 O GLN B 329 -10.596 17.574 -73.670 1.00 63.04 O
ATOM 5792 CB GLN B 329 -11.748 19.847 -71.710 1.00 65.87 C
ATOM 5793 CG GLN B 329 -11.615 21.042 -70.782 1.00 69.08 C
ATOM 5794 CD GLN B 329 -12.917 21.813 -70.648 1.00 72.89 C
ATOM 5795 OE1 GLN B 329 -12.990 22.822 -69.931 1.00 74.61 O
ATOM 5796 NE2 GLN B 329 -13.963 21.340 -71.340 1.00 72.42 N
ATOM 5797 N ALA B 330 -11.267 16.642 -71.748 1.00 63.69 N
ATOM 5798 CA ALA B 330 -11.538 15.349 -72.366 1.00 62.76 C
ATOM 5799 C ALA B 330 -12.489 15.401 -73.553 1.00 61.71 C
ATOM 5800 O ALA B 330 -12.208 14.833 -74.600 1.00 61.08 O
ATOM 5801 CB ALA B 330 -12.069 14.382 -71.320 1.00 62.42 C
ATOM 5802 N ALA B 331 -13.610 16.086 -73.389 1.00 62.02 N
ATOM 5803 CA ALA B 331 -14.607 16.168 -74.446 1.00 63.61 C
ATOM 5804 C ALA B 331 -14.139 16.851 -75.724 1.00 65.07 C
ATOM 5805 O ALA B 331 -14.644 16.562 -76.809 1.00 65.92 O
ATOM 5806 CB ALA B 331 -15.847 16.861 -73.921 1.00 62.99 C
ATOM 5807 N HIS B 332 -13.168 17.744 -75.608 1.00 66.44 N
ATOM 5808 CA HIS B 332 -12.686 18.462 -76.776 1.00 67.84 C
ATOM 5809 C HIS B 332 -11.333 17.987 -77.285 1.00 68.40 C
ATOM 5810 O HIS B 332 -10.741 18.614 -78.163 1.00 69.54 O
ATOM 5811 CB HIS B 332 -12.628 19.955 -76.462 1.00 68.94 C
ATOM 5812 CG HIS B 332 -13.910 20.499 -75.922 1.00 69.30 C
ATOM 5813 ND1 HIS B 332 -15.117 20.341 -76.570 1.00 70.41 N
ATOM 5814 CD2 HIS B 332 -14.181 21.184 -74.788 1.00 70.34 C
ATOM 5815 CE1 HIS B 332 -16.075 20.903 -75.856 1.00 70.72 C
ATOM 5816 NE2 HIS B 332 -15.534 21.422 -74.769 1.00 70.72 N
ATOM 5817 N ALA B 333 -10.847 16.878 -76.742 1.00 68.25 N
ATOM 5818 CA ALA B 333 -9.558 16.333 -77.155 1.00 67.53 C
ATOM 5819 C ALA B 333 -9.551 16.027 -78.643 1.00 67.44 C
ATOM 5820 O ALA B 333 -8.586 16.336 -79.351 1.00 66.58 O
ATOM 5821 CB ALA B 333 -9.259 15.067 -76.373 1.00 68.41 C
ATOM 5822 N GLY B 334 -10.636 15.412 -79.108 1.00 67.51 N
ATOM 5823 CA GLY B 334 -10.746 15.058 -80.509 1.00 67.21 C
ATOM 5824 C GLY B 334 -10.420 16.223 -81.414 1.00 66.79 C
ATOM 5825 O GLY B 334 -9.441 16.195 -82.159 1.00 66.30 O
ATOM 5826 N GLU B 335 -11.244 17.260 -81.338 1.00 67.28 N
ATOM 5827 CA GLU B 335 -11.053 18.439 -82.158 1.00 67.39 C
ATOM 5828 C GLU B 335 -9.698 19.100 -81.956 1.00 66.14 C
ATOM 5829 O GLU B 335 -9.054 19.493 -82.922 1.00 67.10 O
ATOM 5830 CB GLU B 335 -12.177 19.439 -81.898 1.00 69.12 C
ATOM 5831 CG GLU B 335 -12.611 19.510 -80.457 1.00 74.06 C
ATOM 5832 CD GLU B 335 -13.666 20.582 -80.213 1.00 77.73 C
ATOM 5833 OE1 GLU B 335 -13.313 21.791 -80.191 1.00 79.08 O
ATOM 5834 OE2 GLU B 335 -14.852 20.210 -80.049 1.00 78.88 O
ATOM 5835 N VAL B 336 -9.258 19.214 -80.709 1.00 64.80 N
ATOM 5836 CA VAL B 336 -7.971 19.840 -80.413 1.00 63.06 C
ATOM 5837 C VAL B 336 -6.792 19.122 -81.046 1.00 63.93 C
ATOM 5838 O VAL B 336 -5.837 19.757 -81.490 1.00 63.91 O
ATOM 5839 CB VAL B 336 -7.729 19.916 -78.902 1.00 61.37 C
ATOM 5840 CG1 VAL B 336 -6.287 20.323 -78.606 1.00 57.39 C
ATOM 5841 CG2 VAL B 336 -8.699 20.900 -78.302 1.00 60.32 C
ATOM 5842 N ILE B 337 -6.847 17.798 -81.078 1.00 64.37 N
ATOM 5843 CA ILE B 337 -5.762 17.038 -81.664 1.00 64.96 C
ATOM 5844 C ILE B 337 -5.794 17.111 -83.188 1.00 65.03 C
ATOM 5845 O ILE B 337 -4.751 17.247 -83.834 1.00 65.10 O
ATOM 5846 CB ILE B 337 -5.817 15.582 -81.203 1.00 65.86 C
ATOM 5847 CG1 ILE B 337 -5.766 15.546 -79.673 1.00 64.89 C
ATOM 5848 CG2 ILE B 337 -4.646 14.791 -81.804 1.00 65.76 C
ATOM 5849 CD1 ILE B 337 -5.891 14.161 -79.088 1.00 65.20 C
ATOM 5850 N ARG B 338 -6.987 17.028 -83.768 1.00 65.42 N
ATOM 5851 CA ARG B 338 -7.106 17.105 -85.217 1.00 65.93 C
ATOM 5852 C ARG B 338 -6.693 18.482 -85.707 1.00 66.24 C
ATOM 5853 O ARG B 338 -5.970 18.602 -86.691 1.00 66.61 O
ATOM 5854 CB ARG B 338 -8.530 16.779 -85.662 1.00 66.39 C
ATOM 5855 CG ARG B 338 -8.751 15.289 -85.846 1.00 68.40 C
ATOM 5856 CD ARG B 338 -10.088 14.963 -86.488 1.00 71.25 C
ATOM 5857 NE ARG B 338 -11.089 14.547 -85.510 1.00 75.42 N
ATOM 5858 CZ ARG B 338 -11.608 15.350 -84.587 1.00 78.72 C
ATOM 5859 NH1 ARG B 338 -11.215 16.614 -84.515 1.00 81.67 N
ATOM 5860 NH2 ARG B 338 -12.527 14.896 -83.740 1.00 79.58 N
ATOM 5861 N ALA B 339 -7.135 19.521 -85.010 1.00 67.13 N
ATOM 5862 CA ALA B 339 -6.781 20.887 -85.380 1.00 68.11 C
ATOM 5863 C ALA B 339 -5.258 21.032 -85.449 1.00 68.80 C
ATOM 5864 O ALA B 339 -4.722 21.649 -86.370 1.00 69.35 O
ATOM 5865 CB ALA B 339 -7.360 21.877 -84.360 1.00 67.80 C
ATOM 5866 N ALA B 340 -4.567 20.459 -84.470 1.00 69.34 N
ATOM 5867 CA ALA B 340 -3.114 20.522 -84.423 1.00 70.08 C
ATOM 5868 C ALA B 340 -2.512 19.799 -85.621 1.00 71.06 C
ATOM 5869 O ALA B 340 -1.437 20.162 -86.093 1.00 71.74 O
ATOM 5870 CB ALA B 340 -2.605 19.901 -83.130 1.00 69.55 C
ATOM 5871 N MET B 341 -3.205 18.774 -86.106 1.00 71.82 N
ATOM 5872 CA MET B 341 -2.731 18.010 -87.255 1.00 73.44 C
ATOM 5873 C MET B 341 -2.809 18.805 -88.551 1.00 74.10 C
ATOM 5874 O MET B 341 -1.889 18.761 -89.373 1.00 73.34 O
ATOM 5875 CB MET B 341 -3.539 16.728 -87.402 1.00 74.61 C
ATOM 5876 CG MET B 341 -2.939 15.553 -86.682 1.00 77.39 C
ATOM 5877 SD MET B 341 -1.885 14.600 -87.784 1.00 80.50 S
ATOM 5878 CE MET B 341 -0.621 15.757 -88.128 1.00 79.72 C
ATOM 5879 N ASN B 342 -3.912 19.530 -88.728 1.00 74.66 N
ATOM 5880 CA ASN B 342 -4.117 20.338 -89.927 1.00 75.66 C
ATOM 5881 C ASN B 342 -3.069 21.426 -90.021 1.00 75.01 C
ATOM 5882 O ASN B 342 -2.632 21.781 -91.111 1.00 74.70 O
ATOM 5883 CB ASN B 342 -5.499 20.987 -89.916 1.00 77.71 C
ATOM 5884 CG ASN B 342 -6.610 19.974 -89.779 1.00 80.58 C
ATOM 5885 OD1 ASN B 342 -6.674 18.997 -90.536 1.00 81.98 O
ATOM 5886 ND2 ASN B 342 -7.500 20.195 -88.809 1.00 81.39 N
ATOM 5887 N GLN B 343 -2.678 21.961 -88.872 1.00 74.63 N
ATOM 5888 CA GLN B 343 -1.678 23.009 -88.840 1.00 74.26 C
ATOM 5889 C GLN B 343 -0.347 22.481 -89.341 1.00 74.17 C
ATOM 5890 O GLN B 343 0.493 23.242 -89.821 1.00 73.34 O
ATOM 5891 CB GLN B 343 -1.548 23.568 -87.425 1.00 73.85 C
ATOM 5892 CG GLN B 343 -2.641 24.561 -87.090 1.00 75.06 C
ATOM 5893 CD GLN B 343 -2.576 25.818 -87.961 1.00 76.47 C
ATOM 5894 OE1 GLN B 343 -3.530 26.591 -88.023 1.00 78.10 O
ATOM 5895 NE2 GLN B 343 -1.444 26.029 -88.625 1.00 76.12 N
ATOM 5896 N LEU B 344 -0.163 21.170 -89.238 1.00 74.58 N
ATOM 5897 CA LEU B 344 1.067 20.553 -89.705 1.00 76.57 C
ATOM 5898 C LEU B 344 0.991 20.278 -91.196 1.00 77.76 C
ATOM 5899 O LEU B 344 1.973 20.461 -91.917 1.00 78.38 O
ATOM 5900 CB LEU B 344 1.341 19.268 -88.937 1.00 76.08 C
ATOM 5901 CG LEU B 344 2.126 19.556 -87.661 1.00 76.89 C
ATOM 5902 CD1 LEU B 344 1.833 18.482 -86.660 1.00 77.85 C
ATOM 5903 CD2 LEU B 344 3.619 19.653 -87.957 1.00 75.45 C
ATOM 5904 N LYS B 345 -0.175 19.833 -91.659 1.00 78.49 N
ATOM 5905 CA LYS B 345 -0.361 19.579 -93.077 1.00 78.62 C
ATOM 5906 C LYS B 345 -0.254 20.950 -93.731 1.00 78.05 C
ATOM 5907 O LYS B 345 0.646 21.210 -94.526 1.00 78.14 O
ATOM 5908 CB LYS B 345 -1.746 18.992 -93.352 1.00 80.41 C
ATOM 5909 CG LYS B 345 -2.073 17.726 -92.567 1.00 84.80 C
ATOM 5910 CD LYS B 345 -3.266 16.987 -93.176 1.00 87.87 C
ATOM 5911 CE LYS B 345 -4.477 17.906 -93.347 1.00 90.49 C
ATOM 5912 NZ LYS B 345 -5.579 17.273 -94.142 1.00 91.93 N
ATOM 5913 N ALA B 346 -1.175 21.833 -93.361 1.00 77.32 N
ATOM 5914 CA ALA B 346 -1.219 23.189 -93.888 1.00 76.19 C
ATOM 5915 C ALA B 346 0.163 23.821 -94.005 1.00 75.78 C
ATOM 5916 O ALA B 346 0.388 24.673 -94.862 1.00 76.15 O
ATOM 5917 CB ALA B 346 -2.115 24.054 -93.006 1.00 74.87 C
ATOM 5918 N ALA B 347 1.085 23.401 -93.148 1.00 75.74 N
ATOM 5919 CA ALA B 347 2.433 23.944 -93.167 1.00 77.18 C
ATOM 5920 C ALA B 347 3.309 23.184 -94.152 1.00 78.80 C
ATOM 5921 O ALA B 347 4.225 23.752 -94.742 1.00 78.67 O
ATOM 5922 CB ALA B 347 3.030 23.880 -91.781 1.00 77.17 C
ATOM 5923 N ALA B 348 3.022 21.895 -94.314 1.00 80.93 N
ATOM 5924 CA ALA B 348 3.765 21.034 -95.232 1.00 83.30 C
ATOM 5925 C ALA B 348 3.430 21.434 -96.669 1.00 85.04 C
ATOM 5926 O ALA B 348 4.207 21.195 -97.598 1.00 84.87 O
ATOM 5927 CB ALA B 348 3.394 19.570 -94.992 1.00 82.47 C
ATOM 5928 N GLN B 349 2.265 22.054 -96.833 1.00 86.52 N
ATOM 5929 CA GLN B 349 1.803 22.508 -98.134 1.00 87.99 C
ATOM 5930 C GLN B 349 2.104 23.997 -98.318 1.00 89.65 C
ATOM 5931 O GLN B 349 1.198 24.801 -98.544 1.00 90.94 O
ATOM 5932 CB GLN B 349 0.305 22.257 -98.257 1.00 87.14 C
ATOM 5933 CG GLN B 349 -0.082 20.831 -97.928 1.00 87.58 C
ATOM 5934 CD GLN B 349 -1.578 20.635 -97.907 1.00 87.84 C
ATOM 5935 OE1 GLN B 349 -2.303 21.406 -97.278 1.00 89.46 O
ATOM 5936 NE2 GLN B 349 -2.053 19.600 -98.590 1.00 87.70 N
ATOM 5937 N GLY B 350 3.381 24.355 -98.200 1.00 90.61 N
ATOM 5938 CA GLY B 350 3.808 25.735 -98.372 1.00 91.20 C
ATOM 5939 C GLY B 350 3.151 26.826 -97.536 1.00 91.58 C
ATOM 5940 O GLY B 350 3.510 28.002 -97.673 1.00 92.03 O
ATOM 5941 N GLY B 351 2.203 26.456 -96.677 1.00 91.31 N
ATOM 5942 CA GLY B 351 1.527 27.437 -95.840 1.00 90.59 C
ATOM 5943 C GLY B 351 2.428 28.089 -94.801 1.00 90.52 C
ATOM 5944 O GLY B 351 2.010 28.322 -93.663 1.00 90.79 O
ATOM 5945 N VAL B 352 3.663 28.387 -95.202 1.00 89.69 N
ATOM 5946 CA VAL B 352 4.652 29.016 -94.335 1.00 88.84 C
ATOM 5947 C VAL B 352 5.186 30.297 -94.969 1.00 89.16 C
ATOM 5948 O VAL B 352 5.864 30.247 -95.993 1.00 88.70 O
ATOM 5949 CB VAL B 352 5.843 28.080 -94.098 1.00 87.89 C
ATOM 5950 CG1 VAL B 352 6.895 28.777 -93.251 1.00 86.78 C
ATOM 5951 CG2 VAL B 352 5.362 26.805 -93.442 1.00 88.21 C
ATOM 5952 N THR B 353 4.879 31.440 -94.361 1.00 89.43 N
ATOM 5953 CA THR B 353 5.344 32.734 -94.861 1.00 89.25 C
ATOM 5954 C THR B 353 6.864 32.785 -94.771 1.00 88.87 C
ATOM 5955 O THR B 353 7.481 32.006 -94.043 1.00 88.70 O
ATOM 5956 CB THR B 353 4.766 33.911 -94.025 1.00 89.98 C
ATOM 5957 OG1 THR B 353 3.346 33.970 -94.190 1.00 90.46 O
ATOM 5958 CG2 THR B 353 5.374 35.241 -94.455 1.00 90.04 C
ATOM 5959 N GLU B 354 7.466 33.703 -95.518 1.00 88.82 N
ATOM 5960 CA GLU B 354 8.911 33.854 -95.508 1.00 88.62 C
ATOM 5961 C GLU B 354 9.270 34.711 -94.300 1.00 88.57 C
ATOM 5962 O GLU B 354 10.401 34.689 -93.816 1.00 87.98 O
ATOM 5963 CB GLU B 354 9.375 34.527 -96.802 1.00 87.96 C
ATOM 5964 CG GLU B 354 10.879 34.526 -97.005 1.00 87.92 C
ATOM 5965 CD GLU B 354 11.448 33.130 -97.137 1.00 88.25 C
ATOM 5966 OE1 GLU B 354 10.888 32.332 -97.920 1.00 87.99 O
ATOM 5967 OE2 GLU B 354 12.458 32.832 -96.469 1.00 87.98 O
ATOM 5968 N GLU B 355 8.284 35.463 -93.816 1.00 89.19 N
ATOM 5969 CA GLU B 355 8.465 36.323 -92.656 1.00 89.71 C
ATOM 5970 C GLU B 355 8.313 35.465 -91.408 1.00 88.69 C
ATOM 5971 O GLU B 355 8.909 35.747 -90.367 1.00 88.58 O
ATOM 5972 CB GLU B 355 7.412 37.430 -92.641 1.00 92.19 C
ATOM 5973 CG GLU B 355 7.539 38.362 -91.446 1.00 95.94 C
ATOM 5974 CD GLU B 355 6.284 39.188 -91.200 1.00 97.66 C
ATOM 5975 OE1 GLU B 355 5.199 38.587 -91.027 1.00 98.70 O
ATOM 5976 OE2 GLU B 355 6.383 40.436 -91.171 1.00 98.73 O
ATOM 5977 N ASP B 356 7.493 34.425 -91.523 1.00 86.91 N
ATOM 5978 CA ASP B 356 7.277 33.499 -90.423 1.00 85.09 C
ATOM 5979 C ASP B 356 8.625 32.904 -90.062 1.00 84.04 C
ATOM 5980 O ASP B 356 9.006 32.850 -88.892 1.00 84.35 O
ATOM 5981 CB ASP B 356 6.329 32.374 -90.846 1.00 84.97 C
ATOM 5982 CG ASP B 356 4.904 32.853 -91.039 1.00 84.83 C
ATOM 5983 OD1 ASP B 356 4.665 34.075 -90.912 1.00 85.00 O
ATOM 5984 OD2 ASP B 356 4.029 32.003 -91.320 1.00 83.47 O
ATOM 5985 N VAL B 357 9.344 32.461 -91.086 1.00 82.67 N
ATOM 5986 CA VAL B 357 10.657 31.860 -90.902 1.00 82.01 C
ATOM 5987 C VAL B 357 11.651 32.873 -90.339 1.00 81.92 C
ATOM 5988 O VAL B 357 12.614 32.513 -89.667 1.00 80.49 O
ATOM 5989 CB VAL B 357 11.190 31.292 -92.238 1.00 80.83 C
ATOM 5990 CG1 VAL B 357 12.588 30.749 -92.056 1.00 79.88 C
ATOM 5991 CG2 VAL B 357 10.261 30.194 -92.736 1.00 80.32 C
ATOM 5992 N THR B 358 11.406 34.148 -90.606 1.00 83.04 N
ATOM 5993 CA THR B 358 12.291 35.193 -90.118 1.00 85.08 C
ATOM 5994 C THR B 358 12.079 35.370 -88.620 1.00 85.92 C
ATOM 5995 O THR B 358 13.034 35.387 -87.843 1.00 85.78 O
ATOM 5996 CB THR B 358 12.024 36.544 -90.840 1.00 85.67 C
ATOM 5997 OG1 THR B 358 12.222 36.384 -92.253 1.00 86.15 O
ATOM 5998 CG2 THR B 358 12.970 37.628 -90.324 1.00 85.17 C
ATOM 5999 N LYS B 359 10.816 35.492 -88.224 1.00 87.23 N
ATOM 6000 CA LYS B 359 10.466 35.674 -86.820 1.00 87.85 C
ATOM 6001 C LYS B 359 10.930 34.491 -85.983 1.00 87.22 C
ATOM 6002 O LYS B 359 11.619 34.668 -84.980 1.00 87.30 O
ATOM 6003 CB LYS B 359 8.954 35.866 -86.678 1.00 89.41 C
ATOM 6004 CG LYS B 359 8.442 37.146 -87.334 1.00 90.93 C
ATOM 6005 CD LYS B 359 6.960 37.364 -87.069 1.00 92.04 C
ATOM 6006 CE LYS B 359 6.515 38.728 -87.570 1.00 93.03 C
ATOM 6007 NZ LYS B 359 5.086 38.999 -87.254 1.00 94.46 N
ATOM 6008 N ALA B 360 10.557 33.287 -86.403 1.00 86.08 N
ATOM 6009 CA ALA B 360 10.950 32.083 -85.690 1.00 85.78 C
ATOM 6010 C ALA B 360 12.463 32.063 -85.457 1.00 85.86 C
ATOM 6011 O ALA B 360 12.932 31.683 -84.381 1.00 86.80 O
ATOM 6012 CB ALA B 360 10.526 30.856 -86.479 1.00 85.53 C
ATOM 6013 N LYS B 361 13.224 32.484 -86.461 1.00 85.29 N
ATOM 6014 CA LYS B 361 14.678 32.507 -86.353 1.00 84.33 C
ATOM 6015 C LYS B 361 15.154 33.423 -85.235 1.00 83.98 C
ATOM 6016 O LYS B 361 16.218 33.204 -84.659 1.00 83.71 O
ATOM 6017 CB LYS B 361 15.306 32.941 -87.679 1.00 84.40 C
ATOM 6018 CG LYS B 361 15.223 31.899 -88.787 1.00 83.20 C
ATOM 6019 CD LYS B 361 15.785 32.448 -90.082 1.00 82.90 C
ATOM 6020 CE LYS B 361 15.677 31.454 -91.226 1.00 82.35 C
ATOM 6021 NZ LYS B 361 16.029 32.108 -92.520 1.00 82.08 N
ATOM 6022 N ASN B 362 14.375 34.454 -84.932 1.00 84.23 N
ATOM 6023 CA ASN B 362 14.740 35.375 -83.861 1.00 85.26 C
ATOM 6024 C ASN B 362 14.496 34.700 -82.527 1.00 84.98 C
ATOM 6025 O ASN B 362 15.376 34.662 -81.668 1.00 85.34 O
ATOM 6026 CB ASN B 362 13.907 36.658 -83.922 1.00 86.71 C
ATOM 6027 CG ASN B 362 14.301 37.550 -85.073 1.00 88.70 C
ATOM 6028 OD1 ASN B 362 15.469 37.929 -85.211 1.00 88.67 O
ATOM 6029 ND2 ASN B 362 13.328 37.895 -85.914 1.00 89.67 N
ATOM 6030 N GLN B 363 13.286 34.168 -82.364 1.00 84.15 N
ATOM 6031 CA GLN B 363 12.898 33.487 -81.142 1.00 82.31 C
ATOM 6032 C GLN B 363 13.904 32.384 -80.863 1.00 82.05 C
ATOM 6033 O GLN B 363 14.310 32.174 -79.718 1.00 82.87 O
ATOM 6034 CB GLN B 363 11.488 32.922 -81.298 1.00 81.19 C
ATOM 6035 CG GLN B 363 10.480 34.001 -81.647 1.00 80.01 C
ATOM 6036 CD GLN B 363 9.097 33.463 -81.913 1.00 79.64 C
ATOM 6037 OE1 GLN B 363 8.940 32.401 -82.505 1.00 80.71 O
ATOM 6038 NE2 GLN B 363 8.082 34.210 -81.498 1.00 79.11 N
ATOM 6039 N LEU B 364 14.329 31.701 -81.918 1.00 80.85 N
ATOM 6040 CA LEU B 364 15.301 30.628 -81.771 1.00 80.28 C
ATOM 6041 C LEU B 364 16.653 31.182 -81.310 1.00 79.91 C
ATOM 6042 O LEU B 364 17.244 30.688 -80.347 1.00 79.18 O
ATOM 6043 CB LEU B 364 15.435 29.874 -83.094 1.00 79.16 C
ATOM 6044 CG LEU B 364 16.203 28.552 -83.076 1.00 79.68 C
ATOM 6045 CD1 LEU B 364 16.147 27.892 -81.706 1.00 78.97 C
ATOM 6046 CD2 LEU B 364 15.602 27.644 -84.137 1.00 79.82 C
ATOM 6047 N LYS B 365 17.137 32.215 -81.991 1.00 79.79 N
ATOM 6048 CA LYS B 365 18.406 32.831 -81.621 1.00 79.68 C
ATOM 6049 C LYS B 365 18.321 33.378 -80.200 1.00 79.03 C
ATOM 6050 O LYS B 365 19.258 33.241 -79.409 1.00 78.17 O
ATOM 6051 CB LYS B 365 18.742 33.993 -82.554 1.00 81.23 C
ATOM 6052 CG LYS B 365 19.060 33.642 -83.991 1.00 82.90 C
ATOM 6053 CD LYS B 365 19.507 34.910 -84.701 1.00 84.27 C
ATOM 6054 CE LYS B 365 19.651 34.727 -86.195 1.00 85.23 C
ATOM 6055 NZ LYS B 365 20.011 36.025 -86.827 1.00 85.15 N
ATOM 6056 N ALA B 366 17.193 34.020 -79.895 1.00 78.49 N
ATOM 6057 CA ALA B 366 16.967 34.605 -78.577 1.00 78.02 C
ATOM 6058 C ALA B 366 17.005 33.509 -77.528 1.00 78.24 C
ATOM 6059 O ALA B 366 17.847 33.527 -76.624 1.00 78.18 O
ATOM 6060 CB ALA B 366 15.621 35.325 -78.539 1.00 76.72 C
ATOM 6061 N THR B 367 16.094 32.551 -77.662 1.00 78.21 N
ATOM 6062 CA THR B 367 16.012 31.431 -76.738 1.00 78.45 C
ATOM 6063 C THR B 367 17.402 30.914 -76.421 1.00 78.23 C
ATOM 6064 O THR B 367 17.849 30.985 -75.286 1.00 78.60 O
ATOM 6065 CB THR B 367 15.173 30.281 -77.325 1.00 79.03 C
ATOM 6066 OG1 THR B 367 13.792 30.670 -77.372 1.00 79.04 O
ATOM 6067 CG2 THR B 367 15.324 29.028 -76.478 1.00 78.52 C
ATOM 6068 N TYR B 368 18.081 30.397 -77.433 1.00 78.99 N
ATOM 6069 CA TYR B 368 19.427 29.877 -77.243 1.00 80.19 C
ATOM 6070 C TYR B 368 20.283 30.832 -76.414 1.00 80.14 C
ATOM 6071 O TYR B 368 20.956 30.418 -75.463 1.00 80.19 O
ATOM 6072 CB TYR B 368 20.105 29.652 -78.596 1.00 81.24 C
ATOM 6073 CG TYR B 368 21.607 29.511 -78.481 1.00 82.69 C
ATOM 6074 CD1 TYR B 368 22.184 28.320 -78.036 1.00 82.69 C
ATOM 6075 CD2 TYR B 368 22.449 30.593 -78.761 1.00 82.93 C
ATOM 6076 CE1 TYR B 368 23.570 28.208 -77.868 1.00 83.08 C
ATOM 6077 CE2 TYR B 368 23.834 30.493 -78.597 1.00 83.70 C
ATOM 6078 CZ TYR B 368 24.391 29.298 -78.147 1.00 83.61 C
ATOM 6079 OH TYR B 368 25.757 29.202 -77.962 1.00 83.12 O
ATOM 6080 N LEU B 369 20.257 32.107 -76.785 1.00 79.71 N
ATOM 6081 CA LEU B 369 21.045 33.116 -76.093 1.00 79.63 C
ATOM 6082 C LEU B 369 20.672 33.321 -74.643 1.00 78.09 C
ATOM 6083 O LEU B 369 21.534 33.608 -73.814 1.00 78.25 O
ATOM 6084 CB LEU B 369 20.958 34.451 -76.827 1.00 81.54 C
ATOM 6085 CG LEU B 369 21.984 34.629 -77.950 1.00 83.32 C
ATOM 6086 CD1 LEU B 369 21.840 36.029 -78.550 1.00 83.30 C
ATOM 6087 CD2 LEU B 369 23.402 34.420 -77.394 1.00 82.99 C
ATOM 6088 N MET B 370 19.387 33.190 -74.339 1.00 76.52 N
ATOM 6089 CA MET B 370 18.928 33.357 -72.973 1.00 75.23 C
ATOM 6090 C MET B 370 19.295 32.120 -72.163 1.00 75.20 C
ATOM 6091 O MET B 370 19.715 32.227 -71.014 1.00 75.30 O
ATOM 6092 CB MET B 370 17.420 33.609 -72.959 1.00 73.98 C
ATOM 6093 CG MET B 370 17.044 34.890 -73.702 1.00 74.06 C
ATOM 6094 SD MET B 370 15.343 35.531 -73.531 1.00 74.44 S
ATOM 6095 CE MET B 370 14.506 34.645 -74.847 1.00 74.43 C
ATOM 6096 N SER B 371 19.166 30.954 -72.788 1.00 75.71 N
ATOM 6097 CA SER B 371 19.476 29.667 -72.166 1.00 75.79 C
ATOM 6098 C SER B 371 20.786 29.645 -71.408 1.00 75.51 C
ATOM 6099 O SER B 371 20.930 28.915 -70.432 1.00 75.46 O
ATOM 6100 CB SER B 371 19.533 28.571 -73.228 1.00 76.82 C
ATOM 6101 OG SER B 371 18.303 28.462 -73.925 1.00 79.62 O
ATOM 6102 N VAL B 372 21.742 30.444 -71.862 1.00 76.10 N
ATOM 6103 CA VAL B 372 23.059 30.475 -71.236 1.00 77.00 C
ATOM 6104 C VAL B 372 23.292 31.544 -70.171 1.00 77.31 C
ATOM 6105 O VAL B 372 24.420 31.724 -69.712 1.00 77.83 O
ATOM 6106 CB VAL B 372 24.153 30.603 -72.311 1.00 77.04 C
ATOM 6107 CG1 VAL B 372 24.355 29.254 -72.995 1.00 76.40 C
ATOM 6108 CG2 VAL B 372 23.753 31.674 -73.337 1.00 76.10 C
ATOM 6109 N GLU B 373 22.234 32.244 -69.773 1.00 77.50 N
ATOM 6110 CA GLU B 373 22.344 33.290 -68.751 1.00 77.59 C
ATOM 6111 C GLU B 373 22.699 32.726 -67.370 1.00 77.34 C
ATOM 6112 O GLU B 373 23.492 33.314 -66.630 1.00 76.39 O
ATOM 6113 CB GLU B 373 21.028 34.065 -68.645 1.00 77.56 C
ATOM 6114 CG GLU B 373 20.770 35.048 -69.762 1.00 78.17 C
ATOM 6115 CD GLU B 373 19.373 35.633 -69.692 1.00 80.56 C
ATOM 6116 OE1 GLU B 373 19.100 36.627 -70.409 1.00 79.95 O
ATOM 6117 OE2 GLU B 373 18.543 35.092 -68.924 1.00 82.15 O
ATOM 6118 N THR B 374 22.100 31.586 -67.037 1.00 77.14 N
ATOM 6119 CA THR B 374 22.313 30.919 -65.755 1.00 76.12 C
ATOM 6120 C THR B 374 23.505 29.960 -65.779 1.00 75.54 C
ATOM 6121 O THR B 374 23.754 29.297 -66.778 1.00 76.03 O
ATOM 6122 CB THR B 374 21.060 30.112 -65.354 1.00 76.16 C
ATOM 6123 OG1 THR B 374 20.868 29.031 -66.278 1.00 74.97 O
ATOM 6124 CG2 THR B 374 19.830 31.006 -65.366 1.00 75.52 C
ATOM 6125 N ALA B 375 24.229 29.881 -64.668 1.00 74.79 N
ATOM 6126 CA ALA B 375 25.377 28.993 -64.566 1.00 74.72 C
ATOM 6127 C ALA B 375 25.038 27.566 -65.001 1.00 75.29 C
ATOM 6128 O ALA B 375 25.837 26.908 -65.665 1.00 74.92 O
ATOM 6129 CB ALA B 375 25.901 28.993 -63.134 1.00 74.18 C
ATOM 6130 N GLN B 376 23.857 27.086 -64.632 1.00 76.91 N
ATOM 6131 CA GLN B 376 23.456 25.731 -64.992 1.00 79.59 C
ATOM 6132 C GLN B 376 23.333 25.600 -66.502 1.00 79.91 C
ATOM 6133 O GLN B 376 23.678 24.566 -67.078 1.00 79.75 O
ATOM 6134 CB GLN B 376 22.115 25.362 -64.338 1.00 81.60 C
ATOM 6135 CG GLN B 376 21.771 23.859 -64.425 1.00 85.15 C
ATOM 6136 CD GLN B 376 20.365 23.514 -63.905 1.00 86.93 C
ATOM 6137 OE1 GLN B 376 19.998 23.872 -62.784 1.00 87.40 O
ATOM 6138 NE2 GLN B 376 19.584 22.803 -64.721 1.00 87.27 N
ATOM 6139 N GLY B 377 22.833 26.655 -67.137 1.00 80.68 N
ATOM 6140 CA GLY B 377 22.656 26.640 -68.580 1.00 81.65 C
ATOM 6141 C GLY B 377 23.959 26.753 -69.347 1.00 81.65 C
ATOM 6142 O GLY B 377 24.202 26.018 -70.306 1.00 81.72 O
ATOM 6143 N LEU B 378 24.801 27.687 -68.928 1.00 81.28 N
ATOM 6144 CA LEU B 378 26.083 27.881 -69.576 1.00 80.35 C
ATOM 6145 C LEU B 378 26.896 26.597 -69.497 1.00 79.39 C
ATOM 6146 O LEU B 378 27.381 26.093 -70.505 1.00 78.33 O
ATOM 6147 CB LEU B 378 26.850 29.019 -68.901 1.00 80.39 C
ATOM 6148 CG LEU B 378 28.240 29.268 -69.483 1.00 81.14 C
ATOM 6149 CD1 LEU B 378 28.129 29.470 -70.985 1.00 81.17 C
ATOM 6150 CD2 LEU B 378 28.869 30.479 -68.816 1.00 81.24 C
ATOM 6151 N LEU B 379 27.029 26.066 -68.289 1.00 79.13 N
ATOM 6152 CA LEU B 379 27.793 24.849 -68.080 1.00 79.42 C
ATOM 6153 C LEU B 379 27.256 23.694 -68.898 1.00 79.93 C
ATOM 6154 O LEU B 379 28.026 22.887 -69.424 1.00 80.82 O
ATOM 6155 CB LEU B 379 27.780 24.440 -66.611 1.00 79.04 C
ATOM 6156 CG LEU B 379 28.540 23.136 -66.361 1.00 79.15 C
ATOM 6157 CD1 LEU B 379 30.035 23.410 -66.357 1.00 80.05 C
ATOM 6158 CD2 LEU B 379 28.118 22.543 -65.040 1.00 80.15 C
ATOM 6159 N ASN B 380 25.937 23.597 -68.999 1.00 79.69 N
ATOM 6160 CA ASN B 380 25.368 22.499 -69.753 1.00 80.03 C
ATOM 6161 C ASN B 380 25.638 22.660 -71.232 1.00 79.99 C
ATOM 6162 O ASN B 380 25.889 21.676 -71.921 1.00 80.39 O
ATOM 6163 CB ASN B 380 23.864 22.368 -69.520 1.00 80.65 C
ATOM 6164 CG ASN B 380 23.274 21.167 -70.255 1.00 81.21 C
ATOM 6165 OD1 ASN B 380 23.770 20.042 -70.130 1.00 80.96 O
ATOM 6166 ND2 ASN B 380 22.218 21.402 -71.023 1.00 80.67 N
ATOM 6167 N GLU B 381 25.593 23.893 -71.727 1.00 79.81 N
ATOM 6168 CA GLU B 381 25.858 24.123 -73.141 1.00 79.24 C
ATOM 6169 C GLU B 381 27.302 23.742 -73.473 1.00 78.17 C
ATOM 6170 O GLU B 381 27.547 22.990 -74.417 1.00 77.76 O
ATOM 6171 CB GLU B 381 25.603 25.585 -73.514 1.00 80.68 C
ATOM 6172 CG GLU B 381 25.746 25.848 -75.004 1.00 84.03 C
ATOM 6173 CD GLU B 381 24.783 25.011 -75.842 1.00 86.38 C
ATOM 6174 OE1 GLU B 381 24.619 23.800 -75.552 1.00 87.02 O
ATOM 6175 OE2 GLU B 381 24.199 25.562 -76.803 1.00 87.17 O
ATOM 6176 N ILE B 382 28.250 24.250 -72.687 1.00 76.40 N
ATOM 6177 CA ILE B 382 29.658 23.945 -72.891 1.00 75.24 C
ATOM 6178 C ILE B 382 29.892 22.441 -72.895 1.00 76.05 C
ATOM 6179 O ILE B 382 30.240 21.862 -73.922 1.00 76.76 O
ATOM 6180 CB ILE B 382 30.528 24.576 -71.795 1.00 73.90 C
ATOM 6181 CG1 ILE B 382 30.496 26.099 -71.936 1.00 74.02 C
ATOM 6182 CG2 ILE B 382 31.944 24.043 -71.881 1.00 73.13 C
ATOM 6183 CD1 ILE B 382 31.271 26.849 -70.870 1.00 73.49 C
ATOM 6184 N GLY B 383 29.684 21.810 -71.747 1.00 76.65 N
ATOM 6185 CA GLY B 383 29.894 20.377 -71.638 1.00 78.21 C
ATOM 6186 C GLY B 383 29.175 19.480 -72.634 1.00 79.59 C
ATOM 6187 O GLY B 383 29.731 18.476 -73.080 1.00 79.55 O
ATOM 6188 N SER B 384 27.940 19.818 -72.982 1.00 81.02 N
ATOM 6189 CA SER B 384 27.179 18.997 -73.915 1.00 83.26 C
ATOM 6190 C SER B 384 27.927 18.831 -75.222 1.00 84.83 C
ATOM 6191 O SER B 384 28.103 17.715 -75.719 1.00 84.86 O
ATOM 6192 CB SER B 384 25.814 19.627 -74.188 1.00 84.03 C
ATOM 6193 OG SER B 384 25.012 19.616 -73.021 1.00 86.07 O
ATOM 6194 N GLU B 385 28.358 19.959 -75.774 1.00 86.33 N
ATOM 6195 CA GLU B 385 29.100 19.977 -77.024 1.00 87.03 C
ATOM 6196 C GLU B 385 30.509 19.436 -76.781 1.00 86.41 C
ATOM 6197 O GLU B 385 30.976 18.559 -77.504 1.00 86.24 O
ATOM 6198 CB GLU B 385 29.145 21.406 -77.557 1.00 89.09 C
ATOM 6199 CG GLU B 385 29.955 21.585 -78.818 1.00 93.75 C
ATOM 6200 CD GLU B 385 29.825 22.987 -79.376 1.00 96.05 C
ATOM 6201 OE1 GLU B 385 30.041 23.952 -78.608 1.00 97.17 O
ATOM 6202 OE2 GLU B 385 29.507 23.122 -80.578 1.00 97.90 O
ATOM 6203 N ALA B 386 31.175 19.945 -75.752 1.00 85.22 N
ATOM 6204 CA ALA B 386 32.514 19.490 -75.419 1.00 85.13 C
ATOM 6205 C ALA B 386 32.538 17.982 -75.160 1.00 85.47 C
ATOM 6206 O ALA B 386 33.597 17.403 -74.918 1.00 85.66 O
ATOM 6207 CB ALA B 386 33.022 20.231 -74.195 1.00 84.61 C
ATOM 6208 N LEU B 387 31.373 17.345 -75.209 1.00 85.72 N
ATOM 6209 CA LEU B 387 31.302 15.913 -74.971 1.00 87.01 C
ATOM 6210 C LEU B 387 31.069 15.149 -76.262 1.00 88.47 C
ATOM 6211 O LEU B 387 31.661 14.093 -76.483 1.00 88.91 O
ATOM 6212 CB LEU B 387 30.172 15.578 -73.992 1.00 85.96 C
ATOM 6213 CG LEU B 387 30.088 14.088 -73.630 1.00 85.19 C
ATOM 6214 CD1 LEU B 387 31.243 13.716 -72.702 1.00 84.11 C
ATOM 6215 CD2 LEU B 387 28.761 13.784 -72.966 1.00 84.33 C
ATOM 6216 N LEU B 388 30.202 15.689 -77.111 1.00 89.94 N
ATOM 6217 CA LEU B 388 29.869 15.040 -78.373 1.00 91.75 C
ATOM 6218 C LEU B 388 30.746 15.461 -79.555 1.00 92.67 C
ATOM 6219 O LEU B 388 30.395 15.207 -80.714 1.00 92.77 O
ATOM 6220 CB LEU B 388 28.397 15.298 -78.713 1.00 92.60 C
ATOM 6221 CG LEU B 388 27.357 14.917 -77.650 1.00 93.64 C
ATOM 6222 CD1 LEU B 388 25.964 15.195 -78.192 1.00 93.83 C
ATOM 6223 CD2 LEU B 388 27.492 13.442 -77.273 1.00 93.86 C
ATOM 6224 N SER B 389 31.880 16.101 -79.269 1.00 93.17 N
ATOM 6225 CA SER B 389 32.792 16.543 -80.324 1.00 93.14 C
ATOM 6226 C SER B 389 33.959 17.381 -79.806 1.00 93.23 C
ATOM 6227 O SER B 389 34.525 18.174 -80.546 1.00 93.07 O
ATOM 6228 CB SER B 389 32.032 17.344 -81.390 1.00 92.93 C
ATOM 6229 OG SER B 389 31.543 18.570 -80.876 1.00 93.41 O
ATOM 6230 N GLY B 390 34.315 17.202 -78.539 1.00 94.08 N
ATOM 6231 CA GLY B 390 35.418 17.947 -77.952 1.00 94.80 C
ATOM 6232 C GLY B 390 35.723 19.307 -78.557 1.00 95.70 C
ATOM 6233 O GLY B 390 36.889 19.656 -78.736 1.00 95.73 O
ATOM 6234 N THR B 391 34.685 20.075 -78.872 1.00 96.56 N
ATOM 6235 CA THR B 391 34.865 21.403 -79.453 1.00 97.99 C
ATOM 6236 C THR B 391 33.881 22.403 -78.876 1.00 99.02 C
ATOM 6237 O THR B 391 33.167 22.107 -77.925 1.00 99.22 O
ATOM 6238 CB THR B 391 34.657 21.399 -80.976 1.00 97.90 C
ATOM 6239 OG1 THR B 391 33.326 20.963 -81.273 1.00 97.55 O
ATOM 6240 CG2 THR B 391 35.671 20.494 -81.653 1.00 97.77 C
ATOM 6241 N HIS B 392 33.849 23.589 -79.471 1.00100.61 N
ATOM 6242 CA HIS B 392 32.953 24.647 -79.031 1.00102.39 C
ATOM 6243 C HIS B 392 32.629 25.648 -80.136 1.00102.98 C
ATOM 6244 O HIS B 392 33.457 26.480 -80.495 1.00103.83 O
ATOM 6245 CB HIS B 392 33.542 25.397 -77.833 1.00103.40 C
ATOM 6246 CG HIS B 392 32.781 26.636 -77.472 1.00104.98 C
ATOM 6247 ND1 HIS B 392 33.083 27.875 -77.998 1.00105.66 N
ATOM 6248 CD2 HIS B 392 31.694 26.817 -76.686 1.00105.78 C
ATOM 6249 CE1 HIS B 392 32.214 28.766 -77.552 1.00105.81 C
ATOM 6250 NE2 HIS B 392 31.361 28.150 -76.754 1.00106.55 N
ATOM 6251 N THR B 393 31.411 25.563 -80.657 1.00103.34 N
ATOM 6252 CA THR B 393 30.948 26.459 -81.709 1.00103.92 C
ATOM 6253 C THR B 393 30.717 27.865 -81.159 1.00104.80 C
ATOM 6254 O THR B 393 30.115 28.033 -80.099 1.00105.45 O
ATOM 6255 CB THR B 393 29.626 25.946 -82.326 1.00103.82 C
ATOM 6256 OG1 THR B 393 29.874 24.746 -83.068 1.00104.25 O
ATOM 6257 CG2 THR B 393 29.019 26.991 -83.245 1.00103.88 C
ATOM 6258 N ALA B 394 31.203 28.872 -81.877 1.00105.70 N
ATOM 6259 CA ALA B 394 31.029 30.255 -81.455 1.00106.51 C
ATOM 6260 C ALA B 394 29.548 30.609 -81.545 1.00107.29 C
ATOM 6261 O ALA B 394 28.862 30.207 -82.488 1.00107.04 O
ATOM 6262 CB ALA B 394 31.844 31.181 -82.351 1.00106.31 C
ATOM 6263 N PRO B 395 29.031 31.361 -80.558 1.00108.10 N
ATOM 6264 CA PRO B 395 27.614 31.739 -80.577 1.00108.48 C
ATOM 6265 C PRO B 395 27.210 32.465 -81.861 1.00108.81 C
ATOM 6266 O PRO B 395 26.030 32.737 -82.089 1.00108.79 O
ATOM 6267 CB PRO B 395 27.473 32.612 -79.327 1.00108.40 C
ATOM 6268 CG PRO B 395 28.856 33.174 -79.136 1.00108.35 C
ATOM 6269 CD PRO B 395 29.724 31.978 -79.415 1.00108.23 C
ATOM 6270 N SER B 396 28.199 32.765 -82.698 1.00109.45 N
ATOM 6271 CA SER B 396 27.960 33.449 -83.965 1.00109.98 C
ATOM 6272 C SER B 396 27.817 32.429 -85.088 1.00109.67 C
ATOM 6273 O SER B 396 27.052 32.632 -86.030 1.00109.29 O
ATOM 6274 CB SER B 396 29.116 34.403 -84.279 1.00110.39 C
ATOM 6275 OG SER B 396 30.347 33.706 -84.375 1.00111.43 O
ATOM 6276 N VAL B 397 28.569 31.338 -84.983 1.00109.85 N
ATOM 6277 CA VAL B 397 28.525 30.270 -85.974 1.00109.83 C
ATOM 6278 C VAL B 397 27.191 29.543 -85.827 1.00110.47 C
ATOM 6279 O VAL B 397 26.572 29.140 -86.817 1.00110.29 O
ATOM 6280 CB VAL B 397 29.682 29.267 -85.764 1.00109.17 C
ATOM 6281 CG1 VAL B 397 29.632 28.172 -86.815 1.00108.38 C
ATOM 6282 CG2 VAL B 397 31.010 29.998 -85.816 1.00108.34 C
ATOM 6283 N VAL B 398 26.752 29.382 -84.581 1.00110.78 N
ATOM 6284 CA VAL B 398 25.487 28.717 -84.306 1.00111.11 C
ATOM 6285 C VAL B 398 24.354 29.573 -84.860 1.00111.50 C
ATOM 6286 O VAL B 398 23.399 29.049 -85.425 1.00111.90 O
ATOM 6287 CB VAL B 398 25.282 28.499 -82.789 1.00110.86 C
ATOM 6288 CG1 VAL B 398 25.388 29.815 -82.058 1.00111.23 C
ATOM 6289 CG2 VAL B 398 23.932 27.861 -82.530 1.00109.82 C
ATOM 6290 N ALA B 399 24.469 30.890 -84.702 1.00111.92 N
ATOM 6291 CA ALA B 399 23.458 31.813 -85.213 1.00112.75 C
ATOM 6292 C ALA B 399 23.560 31.830 -86.735 1.00113.53 C
ATOM 6293 O ALA B 399 22.558 31.895 -87.445 1.00113.65 O
ATOM 6294 CB ALA B 399 23.692 33.209 -84.659 1.00112.50 C
ATOM 6295 N GLN B 400 24.795 31.773 -87.217 1.00114.44 N
ATOM 6296 CA GLN B 400 25.104 31.759 -88.644 1.00114.61 C
ATOM 6297 C GLN B 400 24.495 30.516 -89.297 1.00113.95 C
ATOM 6298 O GLN B 400 24.013 30.564 -90.431 1.00114.10 O
ATOM 6299 CB GLN B 400 26.625 31.762 -88.810 1.00115.58 C
ATOM 6300 CG GLN B 400 27.153 31.368 -90.169 1.00116.22 C
ATOM 6301 CD GLN B 400 28.636 31.046 -90.113 1.00116.50 C
ATOM 6302 OE1 GLN B 400 29.447 31.875 -89.695 1.00116.45 O
ATOM 6303 NE2 GLN B 400 28.996 29.833 -90.525 1.00116.06 N
ATOM 6304 N LYS B 401 24.522 29.408 -88.563 1.00112.66 N
ATOM 6305 CA LYS B 401 23.981 28.144 -89.043 1.00111.49 C
ATOM 6306 C LYS B 401 22.460 28.119 -89.006 1.00109.98 C
ATOM 6307 O LYS B 401 21.819 27.527 -89.873 1.00109.78 O
ATOM 6308 CB LYS B 401 24.513 26.989 -88.191 1.00112.36 C
ATOM 6309 CG LYS B 401 25.994 26.705 -88.357 1.00113.64 C
ATOM 6310 CD LYS B 401 26.284 26.072 -89.709 1.00114.66 C
ATOM 6311 CE LYS B 401 27.756 25.712 -89.851 1.00114.90 C
ATOM 6312 NZ LYS B 401 28.048 25.036 -91.147 1.00114.58 N
ATOM 6313 N ILE B 402 21.883 28.765 -87.999 1.00108.42 N
ATOM 6314 CA ILE B 402 20.434 28.769 -87.846 1.00107.20 C
ATOM 6315 C ILE B 402 19.686 29.595 -88.898 1.00106.14 C
ATOM 6316 O ILE B 402 18.861 29.046 -89.632 1.00105.40 O
ATOM 6317 CB ILE B 402 20.030 29.201 -86.387 1.00106.68 C
ATOM 6318 CG1 ILE B 402 18.517 29.075 -86.185 1.00106.27 C
ATOM 6319 CG2 ILE B 402 20.501 30.611 -86.094 1.00107.28 C
ATOM 6320 CD1 ILE B 402 17.682 30.184 -86.804 1.00106.09 C
ATOM 6321 N ASP B 403 19.965 30.895 -88.987 1.00104.91 N
ATOM 6322 CA ASP B 403 19.275 31.742 -89.962 1.00103.11 C
ATOM 6323 C ASP B 403 19.538 31.298 -91.398 1.00102.05 C
ATOM 6324 O ASP B 403 18.765 31.613 -92.303 1.00101.92 O
ATOM 6325 CB ASP B 403 19.672 33.210 -89.791 1.00102.14 C
ATOM 6326 CG ASP B 403 21.161 33.398 -89.720 1.00102.11 C
ATOM 6327 OD1 ASP B 403 21.881 32.611 -90.368 1.00102.70 O
ATOM 6328 OD2 ASP B 403 21.612 34.336 -89.028 1.00101.77 O
ATOM 6329 N SER B 404 20.634 30.574 -91.606 1.00100.59 N
ATOM 6330 CA SER B 404 20.960 30.072 -92.934 1.00 98.51 C
ATOM 6331 C SER B 404 20.139 28.799 -93.137 1.00 96.95 C
ATOM 6332 O SER B 404 20.676 27.715 -93.380 1.00 95.72 O
ATOM 6333 CB SER B 404 22.463 29.775 -93.047 1.00 99.16 C
ATOM 6334 OG SER B 404 22.870 28.747 -92.160 1.00 98.98 O
ATOM 6335 N VAL B 405 18.825 28.959 -93.012 1.00 95.64 N
ATOM 6336 CA VAL B 405 17.860 27.876 -93.156 1.00 94.98 C
ATOM 6337 C VAL B 405 16.693 28.397 -93.989 1.00 94.58 C
ATOM 6338 O VAL B 405 15.867 29.168 -93.505 1.00 94.64 O
ATOM 6339 CB VAL B 405 17.337 27.416 -91.771 1.00 94.88 C
ATOM 6340 CG1 VAL B 405 16.117 26.534 -91.935 1.00 94.42 C
ATOM 6341 CG2 VAL B 405 18.427 26.658 -91.028 1.00 94.77 C
ATOM 6342 N THR B 406 16.629 27.964 -95.241 1.00 94.47 N
ATOM 6343 CA THR B 406 15.588 28.409 -96.160 1.00 93.71 C
ATOM 6344 C THR B 406 14.172 28.042 -95.748 1.00 91.92 C
ATOM 6345 O THR B 406 13.943 27.119 -94.971 1.00 91.05 O
ATOM 6346 CB THR B 406 15.816 27.850 -97.596 1.00 94.88 C
ATOM 6347 OG1 THR B 406 15.185 26.568 -97.727 1.00 95.68 O
ATOM 6348 CG2 THR B 406 17.307 27.689 -97.875 1.00 95.65 C
ATOM 6349 N SER B 407 13.227 28.787 -96.299 1.00 90.91 N
ATOM 6350 CA SER B 407 11.817 28.561 -96.054 1.00 90.91 C
ATOM 6351 C SER B 407 11.474 27.176 -96.572 1.00 90.92 C
ATOM 6352 O SER B 407 10.538 26.537 -96.101 1.00 91.32 O
ATOM 6353 CB SER B 407 10.990 29.608 -96.801 1.00 90.99 C
ATOM 6354 OG SER B 407 9.634 29.217 -96.918 1.00 91.46 O
ATOM 6355 N ALA B 408 12.237 26.717 -97.554 1.00 91.35 N
ATOM 6356 CA ALA B 408 12.002 25.404 -98.133 1.00 91.66 C
ATOM 6357 C ALA B 408 12.266 24.344 -97.077 1.00 91.48 C
ATOM 6358 O ALA B 408 11.397 23.527 -96.772 1.00 91.69 O
ATOM 6359 CB ALA B 408 12.910 25.193 -99.336 1.00 92.37 C
ATOM 6360 N ASP B 409 13.471 24.374 -96.517 1.00 90.99 N
ATOM 6361 CA ASP B 409 13.876 23.425 -95.490 1.00 91.02 C
ATOM 6362 C ASP B 409 12.740 23.159 -94.516 1.00 91.29 C
ATOM 6363 O ASP B 409 12.341 22.009 -94.300 1.00 92.03 O
ATOM 6364 CB ASP B 409 15.067 23.977 -94.718 1.00 90.91 C
ATOM 6365 CG ASP B 409 16.200 24.374 -95.618 1.00 91.06 C
ATOM 6366 OD1 ASP B 409 16.476 23.609 -96.563 1.00 92.72 O
ATOM 6367 OD2 ASP B 409 16.817 25.433 -95.379 1.00 89.12 O
ATOM 6368 N VAL B 410 12.235 24.238 -93.928 1.00 90.16 N
ATOM 6369 CA VAL B 410 11.146 24.166 -92.969 1.00 88.93 C
ATOM 6370 C VAL B 410 9.959 23.386 -93.526 1.00 88.40 C
ATOM 6371 O VAL B 410 9.518 22.406 -92.924 1.00 88.07 O
ATOM 6372 CB VAL B 410 10.677 25.583 -92.574 1.00 88.90 C
ATOM 6373 CG1 VAL B 410 9.455 25.499 -91.676 1.00 88.67 C
ATOM 6374 CG2 VAL B 410 11.803 26.320 -91.868 1.00 89.07 C
ATOM 6375 N VAL B 411 9.449 23.822 -94.677 1.00 87.73 N
ATOM 6376 CA VAL B 411 8.305 23.162 -95.299 1.00 86.89 C
ATOM 6377 C VAL B 411 8.593 21.682 -95.514 1.00 86.35 C
ATOM 6378 O VAL B 411 7.680 20.856 -95.466 1.00 86.64 O
ATOM 6379 CB VAL B 411 7.932 23.804 -96.663 1.00 86.31 C
ATOM 6380 CG1 VAL B 411 6.628 23.197 -97.191 1.00 84.40 C
ATOM 6381 CG2 VAL B 411 7.795 25.312 -96.507 1.00 85.34 C
ATOM 6382 N ASN B 412 9.861 21.353 -95.751 1.00 85.19 N
ATOM 6383 CA ASN B 412 10.249 19.964 -95.956 1.00 85.09 C
ATOM 6384 C ASN B 412 10.124 19.221 -94.643 1.00 83.81 C
ATOM 6385 O ASN B 412 9.525 18.149 -94.582 1.00 83.51 O
ATOM 6386 CB ASN B 412 11.686 19.863 -96.476 1.00 86.60 C
ATOM 6387 CG ASN B 412 11.812 20.305 -97.925 1.00 87.26 C
ATOM 6388 OD1 ASN B 412 10.961 19.982 -98.763 1.00 86.91 O
ATOM 6389 ND2 ASN B 412 12.880 21.040 -98.229 1.00 87.32 N
ATOM 6390 N ALA B 413 10.696 19.795 -93.592 1.00 82.76 N
ATOM 6391 CA ALA B 413 10.612 19.198 -92.271 1.00 81.18 C
ATOM 6392 C ALA B 413 9.141 18.866 -92.032 1.00 80.43 C
ATOM 6393 O ALA B 413 8.800 17.739 -91.679 1.00 80.78 O
ATOM 6394 CB ALA B 413 11.106 20.179 -91.228 1.00 80.69 C
ATOM 6395 N ALA B 414 8.277 19.853 -92.252 1.00 79.24 N
ATOM 6396 CA ALA B 414 6.836 19.683 -92.075 1.00 78.77 C
ATOM 6397 C ALA B 414 6.290 18.507 -92.883 1.00 79.17 C
ATOM 6398 O ALA B 414 5.425 17.772 -92.415 1.00 78.66 O
ATOM 6399 CB ALA B 414 6.108 20.963 -92.467 1.00 78.49 C
ATOM 6400 N LYS B 415 6.785 18.334 -94.104 1.00 80.61 N
ATOM 6401 CA LYS B 415 6.335 17.232 -94.952 1.00 80.62 C
ATOM 6402 C LYS B 415 6.805 15.897 -94.389 1.00 80.17 C
ATOM 6403 O LYS B 415 6.035 14.941 -94.326 1.00 80.26 O
ATOM 6404 CB LYS B 415 6.864 17.391 -96.383 1.00 81.80 C
ATOM 6405 CG LYS B 415 6.246 18.543 -97.165 1.00 83.72 C
ATOM 6406 CD LYS B 415 6.668 18.507 -98.628 1.00 85.17 C
ATOM 6407 CE LYS B 415 6.025 19.635 -99.419 1.00 86.77 C
ATOM 6408 NZ LYS B 415 6.390 19.603-100.866 1.00 87.11 N
ATOM 6409 N LYS B 416 8.069 15.840 -93.978 1.00 79.32 N
ATOM 6410 CA LYS B 416 8.633 14.619 -93.425 1.00 78.99 C
ATOM 6411 C LYS B 416 7.758 14.099 -92.299 1.00 79.16 C
ATOM 6412 O LYS B 416 7.695 12.895 -92.052 1.00 78.76 O
ATOM 6413 CB LYS B 416 10.046 14.865 -92.893 1.00 79.21 C
ATOM 6414 CG LYS B 416 10.702 13.603 -92.347 1.00 79.70 C
ATOM 6415 CD LYS B 416 12.129 13.842 -91.890 1.00 79.98 C
ATOM 6416 CE LYS B 416 12.710 12.570 -91.298 1.00 80.42 C
ATOM 6417 NZ LYS B 416 14.064 12.785 -90.718 1.00 81.12 N
ATOM 6418 N PHE B 417 7.083 15.019 -91.618 1.00 79.38 N
ATOM 6419 CA PHE B 417 6.209 14.656 -90.518 1.00 80.17 C
ATOM 6420 C PHE B 417 4.902 14.060 -91.016 1.00 81.36 C
ATOM 6421 O PHE B 417 4.494 12.982 -90.582 1.00 81.74 O
ATOM 6422 CB PHE B 417 5.884 15.877 -89.648 1.00 80.11 C
ATOM 6423 CG PHE B 417 4.773 15.629 -88.647 1.00 79.26 C
ATOM 6424 CD1 PHE B 417 5.036 15.017 -87.423 1.00 77.72 C
ATOM 6425 CD2 PHE B 417 3.450 15.935 -88.969 1.00 77.97 C
ATOM 6426 CE1 PHE B 417 4.001 14.709 -86.546 1.00 76.56 C
ATOM 6427 CE2 PHE B 417 2.413 15.629 -88.098 1.00 76.80 C
ATOM 6428 CZ PHE B 417 2.684 15.015 -86.885 1.00 76.22 C
ATOM 6429 N VAL B 418 4.241 14.773 -91.920 1.00 82.05 N
ATOM 6430 CA VAL B 418 2.959 14.317 -92.436 1.00 83.37 C
ATOM 6431 C VAL B 418 3.042 12.984 -93.172 1.00 84.50 C
ATOM 6432 O VAL B 418 2.062 12.233 -93.227 1.00 84.43 O
ATOM 6433 CB VAL B 418 2.340 15.363 -93.377 1.00 82.75 C
ATOM 6434 CG1 VAL B 418 0.864 15.052 -93.593 1.00 82.99 C
ATOM 6435 CG2 VAL B 418 2.520 16.753 -92.798 1.00 82.47 C
ATOM 6436 N SER B 419 4.216 12.686 -93.723 1.00 85.56 N
ATOM 6437 CA SER B 419 4.421 11.449 -94.472 1.00 86.42 C
ATOM 6438 C SER B 419 5.044 10.330 -93.645 1.00 86.19 C
ATOM 6439 O SER B 419 4.781 9.151 -93.897 1.00 87.14 O
ATOM 6440 CB SER B 419 5.302 11.716 -95.693 1.00 87.14 C
ATOM 6441 OG SER B 419 6.601 12.122 -95.291 1.00 88.70 O
ATOM 6442 N GLY B 420 5.873 10.689 -92.668 1.00 84.74 N
ATOM 6443 CA GLY B 420 6.508 9.679 -91.840 1.00 83.43 C
ATOM 6444 C GLY B 420 5.540 8.883 -90.971 1.00 82.46 C
ATOM 6445 O GLY B 420 4.413 9.326 -90.706 1.00 81.50 O
ATOM 6446 N LYS B 421 5.971 7.695 -90.538 1.00 81.43 N
ATOM 6447 CA LYS B 421 5.147 6.852 -89.673 1.00 79.68 C
ATOM 6448 C LYS B 421 5.152 7.498 -88.301 1.00 79.25 C
ATOM 6449 O LYS B 421 6.208 7.812 -87.748 1.00 79.16 O
ATOM 6450 CB LYS B 421 5.703 5.433 -89.566 1.00 78.00 C
ATOM 6451 CG LYS B 421 4.808 4.521 -88.751 1.00 77.41 C
ATOM 6452 CD LYS B 421 5.291 3.077 -88.737 1.00 77.25 C
ATOM 6453 CE LYS B 421 4.329 2.193 -87.942 1.00 76.91 C
ATOM 6454 NZ LYS B 421 4.781 0.779 -87.849 1.00 76.61 N
ATOM 6455 N LYS B 422 3.964 7.688 -87.751 1.00 78.38 N
ATOM 6456 CA LYS B 422 3.839 8.346 -86.469 1.00 77.77 C
ATOM 6457 C LYS B 422 3.592 7.412 -85.294 1.00 76.95 C
ATOM 6458 O LYS B 422 3.051 6.317 -85.446 1.00 77.56 O
ATOM 6459 CB LYS B 422 2.719 9.384 -86.565 1.00 77.87 C
ATOM 6460 CG LYS B 422 2.930 10.384 -87.701 1.00 78.69 C
ATOM 6461 CD LYS B 422 1.619 10.989 -88.165 1.00 79.26 C
ATOM 6462 CE LYS B 422 1.759 11.622 -89.543 1.00 80.75 C
ATOM 6463 NZ LYS B 422 0.426 11.897 -90.180 1.00 82.11 N
ATOM 6464 N SER B 423 4.034 7.849 -84.122 1.00 75.22 N
ATOM 6465 CA SER B 423 3.829 7.113 -82.888 1.00 72.91 C
ATOM 6466 C SER B 423 3.080 8.106 -81.995 1.00 70.74 C
ATOM 6467 O SER B 423 3.292 9.322 -82.089 1.00 70.10 O
ATOM 6468 CB SER B 423 5.171 6.676 -82.270 1.00 73.04 C
ATOM 6469 OG SER B 423 6.068 7.758 -82.112 1.00 73.63 O
ATOM 6470 N MET B 424 2.187 7.594 -81.153 1.00 68.01 N
ATOM 6471 CA MET B 424 1.395 8.453 -80.284 1.00 64.31 C
ATOM 6472 C MET B 424 1.239 7.923 -78.858 1.00 63.30 C
ATOM 6473 O MET B 424 1.290 6.712 -78.610 1.00 63.96 O
ATOM 6474 CB MET B 424 0.016 8.650 -80.911 1.00 61.44 C
ATOM 6475 CG MET B 424 -0.941 9.450 -80.082 1.00 57.29 C
ATOM 6476 SD MET B 424 -2.608 9.137 -80.646 1.00 55.72 S
ATOM 6477 CE MET B 424 -3.335 10.754 -80.523 1.00 52.88 C
ATOM 6478 N ALA B 425 1.050 8.846 -77.925 1.00 60.95 N
ATOM 6479 CA ALA B 425 0.858 8.504 -76.525 1.00 58.74 C
ATOM 6480 C ALA B 425 -0.104 9.519 -75.921 1.00 57.97 C
ATOM 6481 O ALA B 425 0.070 10.726 -76.088 1.00 56.83 O
ATOM 6482 CB ALA B 425 2.178 8.533 -75.797 1.00 58.33 C
ATOM 6483 N ALA B 426 -1.125 9.026 -75.230 1.00 58.17 N
ATOM 6484 CA ALA B 426 -2.118 9.887 -74.596 1.00 57.94 C
ATOM 6485 C ALA B 426 -2.613 9.286 -73.281 1.00 57.72 C
ATOM 6486 O ALA B 426 -2.714 8.065 -73.150 1.00 57.72 O
ATOM 6487 CB ALA B 426 -3.293 10.100 -75.540 1.00 58.66 C
ATOM 6488 N SER B 427 -2.922 10.142 -72.311 1.00 57.63 N
ATOM 6489 CA SER B 427 -3.429 9.682 -71.015 1.00 57.73 C
ATOM 6490 C SER B 427 -4.566 10.576 -70.539 1.00 56.04 C
ATOM 6491 O SER B 427 -4.586 11.771 -70.819 1.00 55.69 O
ATOM 6492 CB SER B 427 -2.311 9.676 -69.969 1.00 59.45 C
ATOM 6493 OG SER B 427 -1.914 10.999 -69.642 1.00 62.72 O
ATOM 6494 N GLY B 428 -5.511 9.996 -69.813 1.00 55.29 N
ATOM 6495 CA GLY B 428 -6.635 10.774 -69.326 1.00 55.16 C
ATOM 6496 C GLY B 428 -7.912 10.066 -69.704 1.00 55.29 C
ATOM 6497 O GLY B 428 -7.886 8.872 -69.989 1.00 55.85 O
ATOM 6498 N ASP B 429 -9.029 10.780 -69.694 1.00 56.15 N
ATOM 6499 CA ASP B 429 -10.308 10.187 -70.073 1.00 58.30 C
ATOM 6500 C ASP B 429 -10.323 10.180 -71.610 1.00 58.34 C
ATOM 6501 O ASP B 429 -10.909 11.063 -72.251 1.00 58.77 O
ATOM 6502 CB ASP B 429 -11.471 11.027 -69.531 1.00 60.33 C
ATOM 6503 CG ASP B 429 -12.811 10.342 -69.695 1.00 63.94 C
ATOM 6504 OD1 ASP B 429 -12.999 9.625 -70.704 1.00 68.39 O
ATOM 6505 OD2 ASP B 429 -13.688 10.530 -68.829 1.00 65.10 O
ATOM 6506 N LEU B 430 -9.674 9.170 -72.186 1.00 56.96 N
ATOM 6507 CA LEU B 430 -9.537 9.028 -73.630 1.00 55.73 C
ATOM 6508 C LEU B 430 -10.801 8.683 -74.419 1.00 56.01 C
ATOM 6509 O LEU B 430 -10.725 8.317 -75.590 1.00 53.27 O
ATOM 6510 CB LEU B 430 -8.455 7.988 -73.917 1.00 54.17 C
ATOM 6511 CG LEU B 430 -7.153 8.186 -73.135 1.00 53.61 C
ATOM 6512 CD1 LEU B 430 -6.152 7.141 -73.572 1.00 52.92 C
ATOM 6513 CD2 LEU B 430 -6.592 9.586 -73.370 1.00 51.84 C
ATOM 6514 N GLY B 431 -11.960 8.813 -73.787 1.00 57.91 N
ATOM 6515 CA GLY B 431 -13.203 8.492 -74.472 1.00 60.30 C
ATOM 6516 C GLY B 431 -13.458 9.232 -75.780 1.00 61.82 C
ATOM 6517 O GLY B 431 -14.221 8.760 -76.631 1.00 60.91 O
ATOM 6518 N SER B 432 -12.834 10.397 -75.939 1.00 63.47 N
ATOM 6519 CA SER B 432 -13.009 11.192 -77.149 1.00 64.42 C
ATOM 6520 C SER B 432 -11.687 11.445 -77.857 1.00 65.24 C
ATOM 6521 O SER B 432 -11.618 12.232 -78.802 1.00 66.52 O
ATOM 6522 CB SER B 432 -13.647 12.534 -76.809 1.00 64.98 C
ATOM 6523 OG SER B 432 -14.949 12.357 -76.291 1.00 68.91 O
ATOM 6524 N THR B 433 -10.629 10.793 -77.393 1.00 65.72 N
ATOM 6525 CA THR B 433 -9.326 10.971 -78.009 1.00 64.53 C
ATOM 6526 C THR B 433 -9.226 10.021 -79.195 1.00 65.80 C
ATOM 6527 O THR B 433 -9.507 8.827 -79.082 1.00 65.56 O
ATOM 6528 CB THR B 433 -8.209 10.684 -77.008 1.00 62.90 C
ATOM 6529 OG1 THR B 433 -8.491 11.369 -75.782 1.00 60.89 O
ATOM 6530 CG2 THR B 433 -6.883 11.169 -77.553 1.00 62.10 C
ATOM 6531 N PRO B 434 -8.847 10.550 -80.363 1.00 67.30 N
ATOM 6532 CA PRO B 434 -8.719 9.734 -81.576 1.00 68.26 C
ATOM 6533 C PRO B 434 -7.493 8.811 -81.614 1.00 67.89 C
ATOM 6534 O PRO B 434 -6.478 9.073 -80.960 1.00 66.75 O
ATOM 6535 CB PRO B 434 -8.697 10.788 -82.685 1.00 68.28 C
ATOM 6536 CG PRO B 434 -7.986 11.934 -82.024 1.00 67.86 C
ATOM 6537 CD PRO B 434 -8.637 11.979 -80.659 1.00 67.32 C
ATOM 6538 N PHE B 435 -7.601 7.721 -82.372 1.00 67.91 N
ATOM 6539 CA PHE B 435 -6.485 6.794 -82.498 1.00 69.36 C
ATOM 6540 C PHE B 435 -5.624 7.280 -83.647 1.00 70.03 C
ATOM 6541 O PHE B 435 -6.119 7.912 -84.574 1.00 70.73 O
ATOM 6542 CB PHE B 435 -6.965 5.375 -82.795 1.00 69.39 C
ATOM 6543 CG PHE B 435 -7.711 4.736 -81.668 1.00 69.32 C
ATOM 6544 CD1 PHE B 435 -8.980 5.185 -81.311 1.00 69.36 C
ATOM 6545 CD2 PHE B 435 -7.146 3.680 -80.961 1.00 68.95 C
ATOM 6546 CE1 PHE B 435 -9.678 4.590 -80.263 1.00 69.97 C
ATOM 6547 CE2 PHE B 435 -7.834 3.077 -79.913 1.00 69.05 C
ATOM 6548 CZ PHE B 435 -9.103 3.532 -79.561 1.00 69.99 C
ATOM 6549 N LEU B 436 -4.338 6.968 -83.586 1.00 70.75 N
ATOM 6550 CA LEU B 436 -3.383 7.379 -84.609 1.00 71.70 C
ATOM 6551 C LEU B 436 -3.861 7.184 -86.057 1.00 73.36 C
ATOM 6552 O LEU B 436 -3.492 7.956 -86.941 1.00 73.66 O
ATOM 6553 CB LEU B 436 -2.064 6.632 -84.387 1.00 69.23 C
ATOM 6554 CG LEU B 436 -0.783 7.307 -84.864 1.00 67.68 C
ATOM 6555 CD1 LEU B 436 -0.683 8.695 -84.280 1.00 67.82 C
ATOM 6556 CD2 LEU B 436 0.406 6.484 -84.437 1.00 67.21 C
ATOM 6557 N ASP B 437 -4.686 6.168 -86.300 1.00 75.72 N
ATOM 6558 CA ASP B 437 -5.175 5.903 -87.654 1.00 77.41 C
ATOM 6559 C ASP B 437 -6.441 6.670 -88.033 1.00 78.28 C
ATOM 6560 O ASP B 437 -7.134 6.304 -88.982 1.00 78.90 O
ATOM 6561 CB ASP B 437 -5.406 4.394 -87.869 1.00 77.59 C
ATOM 6562 CG ASP B 437 -6.443 3.807 -86.917 1.00 78.57 C
ATOM 6563 OD1 ASP B 437 -6.120 3.653 -85.716 1.00 80.05 O
ATOM 6564 OD2 ASP B 437 -7.575 3.498 -87.367 1.00 76.57 O
ATOM 6565 N GLU B 438 -6.748 7.727 -87.294 1.00 79.09 N
ATOM 6566 CA GLU B 438 -7.926 8.534 -87.600 1.00 80.42 C
ATOM 6567 C GLU B 438 -7.441 9.965 -87.733 1.00 81.75 C
ATOM 6568 O GLU B 438 -8.232 10.899 -87.832 1.00 81.94 O
ATOM 6569 CB GLU B 438 -8.960 8.452 -86.479 1.00 80.24 C
ATOM 6570 CG GLU B 438 -9.142 7.070 -85.890 1.00 81.51 C
ATOM 6571 CD GLU B 438 -10.209 7.042 -84.819 1.00 81.99 C
ATOM 6572 OE1 GLU B 438 -10.347 8.053 -84.094 1.00 81.36 O
ATOM 6573 OE2 GLU B 438 -10.901 6.007 -84.695 1.00 82.24 O
ATOM 6574 N LEU B 439 -6.123 10.127 -87.714 1.00 83.25 N
ATOM 6575 CA LEU B 439 -5.512 11.440 -87.842 1.00 85.50 C
ATOM 6576 C LEU B 439 -5.046 11.636 -89.279 1.00 87.41 C
ATOM 6577 O LEU B 439 -3.808 11.692 -89.505 1.00 88.67 O
ATOM 6578 CB LEU B 439 -4.322 11.574 -86.893 1.00 84.97 C
ATOM 6579 CG LEU B 439 -4.630 11.359 -85.415 1.00 85.37 C
ATOM 6580 CD1 LEU B 439 -3.378 11.620 -84.587 1.00 84.26 C
ATOM 6581 CD2 LEU B 439 -5.767 12.283 -85.000 1.00 86.22 C
ATOM 6582 OXT LEU B 439 -5.933 11.715 -90.158 1.00 88.74 O
TER 6583 LEU B 439
ATOM 6584 N MET C 1 13.876 5.563 -29.505 1.00102.13 N
ATOM 6585 CA MET C 1 12.877 5.433 -30.608 1.00101.87 C
ATOM 6586 C MET C 1 12.215 6.780 -30.901 1.00101.35 C
ATOM 6587 O MET C 1 12.413 7.357 -31.972 1.00102.30 O
ATOM 6588 CB MET C 1 11.805 4.399 -30.237 1.00102.11 C
ATOM 6589 N ALA C 2 11.431 7.277 -29.946 1.00 99.32 N
ATOM 6590 CA ALA C 2 10.746 8.555 -30.109 1.00 96.40 C
ATOM 6591 C ALA C 2 11.700 9.718 -29.854 1.00 94.19 C
ATOM 6592 O ALA C 2 12.636 9.611 -29.052 1.00 93.36 O
ATOM 6593 CB ALA C 2 9.545 8.636 -29.159 1.00 96.68 C
ATOM 6594 N PRO C 3 11.478 10.846 -30.543 1.00 92.14 N
ATOM 6595 CA PRO C 3 12.316 12.038 -30.391 1.00 90.71 C
ATOM 6596 C PRO C 3 12.282 12.687 -29.004 1.00 89.43 C
ATOM 6597 O PRO C 3 13.269 13.290 -28.584 1.00 89.91 O
ATOM 6598 CB PRO C 3 11.802 12.967 -31.493 1.00 90.86 C
ATOM 6599 CG PRO C 3 10.379 12.543 -31.669 1.00 91.36 C
ATOM 6600 CD PRO C 3 10.475 11.043 -31.604 1.00 91.52 C
ATOM 6601 N ASN C 4 11.158 12.574 -28.293 1.00 87.66 N
ATOM 6602 CA ASN C 4 11.066 13.168 -26.957 1.00 84.75 C
ATOM 6603 C ASN C 4 10.716 12.179 -25.855 1.00 82.46 C
ATOM 6604 O ASN C 4 9.750 11.420 -25.955 1.00 81.43 O
ATOM 6605 CB ASN C 4 10.084 14.358 -26.938 1.00 84.79 C
ATOM 6606 CG ASN C 4 8.640 13.952 -27.114 1.00 83.64 C
ATOM 6607 OD1 ASN C 4 8.283 13.274 -28.075 1.00 84.64 O
ATOM 6608 ND2 ASN C 4 7.793 14.384 -26.190 1.00 82.12 N
ATOM 6609 N ILE C 5 11.531 12.210 -24.804 1.00 80.68 N
ATOM 6610 CA ILE C 5 11.394 11.337 -23.641 1.00 79.77 C
ATOM 6611 C ILE C 5 9.989 11.222 -23.042 1.00 79.77 C
ATOM 6612 O ILE C 5 9.580 10.135 -22.622 1.00 79.22 O
ATOM 6613 CB ILE C 5 12.396 11.769 -22.525 1.00 79.00 C
ATOM 6614 CG1 ILE C 5 13.715 11.017 -22.696 1.00 78.42 C
ATOM 6615 CG2 ILE C 5 11.834 11.494 -21.148 1.00 77.95 C
ATOM 6616 CD1 ILE C 5 13.587 9.512 -22.540 1.00 78.33 C
ATOM 6617 N ARG C 6 9.259 12.335 -23.003 1.00 79.16 N
ATOM 6618 CA ARG C 6 7.913 12.348 -22.438 1.00 77.55 C
ATOM 6619 C ARG C 6 7.059 11.210 -22.994 1.00 77.41 C
ATOM 6620 O ARG C 6 6.111 10.764 -22.342 1.00 76.95 O
ATOM 6621 CB ARG C 6 7.237 13.695 -22.718 1.00 76.65 C
ATOM 6622 CG ARG C 6 6.163 14.065 -21.696 1.00 76.47 C
ATOM 6623 CD ARG C 6 5.511 15.424 -21.970 1.00 73.94 C
ATOM 6624 NE ARG C 6 4.726 15.421 -23.201 1.00 72.12 N
ATOM 6625 CZ ARG C 6 5.092 16.044 -24.314 1.00 71.78 C
ATOM 6626 NH1 ARG C 6 6.232 16.721 -24.330 1.00 73.56 N
ATOM 6627 NH2 ARG C 6 4.332 15.983 -25.406 1.00 69.39 N
ATOM 6628 N LYS C 7 7.413 10.729 -24.188 1.00 77.12 N
ATOM 6629 CA LYS C 7 6.672 9.647 -24.840 1.00 76.83 C
ATOM 6630 C LYS C 7 7.369 8.276 -24.901 1.00 76.97 C
ATOM 6631 O LYS C 7 6.700 7.239 -24.867 1.00 76.36 O
ATOM 6632 CB LYS C 7 6.284 10.058 -26.266 1.00 76.20 C
ATOM 6633 CG LYS C 7 5.344 11.253 -26.374 1.00 75.04 C
ATOM 6634 CD LYS C 7 4.985 11.513 -27.832 1.00 73.71 C
ATOM 6635 CE LYS C 7 4.173 12.787 -28.005 1.00 74.07 C
ATOM 6636 NZ LYS C 7 3.865 13.077 -29.441 1.00 72.56 N
ATOM 6637 N SER C 8 8.695 8.254 -25.004 1.00 77.22 N
ATOM 6638 CA SER C 8 9.400 6.976 -25.090 1.00 77.37 C
ATOM 6639 C SER C 8 9.666 6.278 -23.747 1.00 77.93 C
ATOM 6640 O SER C 8 9.439 5.073 -23.622 1.00 78.54 O
ATOM 6641 CB SER C 8 10.710 7.147 -25.868 1.00 76.56 C
ATOM 6642 OG SER C 8 11.478 8.226 -25.373 1.00 76.97 O
ATOM 6643 N HIS C 9 10.133 7.027 -22.750 1.00 77.29 N
ATOM 6644 CA HIS C 9 10.425 6.468 -21.427 1.00 76.89 C
ATOM 6645 C HIS C 9 9.226 5.652 -20.924 1.00 76.79 C
ATOM 6646 O HIS C 9 8.102 6.141 -20.941 1.00 78.06 O
ATOM 6647 CB HIS C 9 10.732 7.602 -20.440 1.00 76.39 C
ATOM 6648 CG HIS C 9 11.230 7.128 -19.110 1.00 76.08 C
ATOM 6649 ND1 HIS C 9 12.541 6.760 -18.891 1.00 74.82 N
ATOM 6650 CD2 HIS C 9 10.580 6.912 -17.943 1.00 76.81 C
ATOM 6651 CE1 HIS C 9 12.676 6.337 -17.648 1.00 74.62 C
ATOM 6652 NE2 HIS C 9 11.501 6.418 -17.051 1.00 76.83 N
ATOM 6653 N PRO C 10 9.450 4.404 -20.455 1.00 76.15 N
ATOM 6654 CA PRO C 10 8.352 3.556 -19.960 1.00 74.71 C
ATOM 6655 C PRO C 10 7.563 4.052 -18.735 1.00 72.87 C
ATOM 6656 O PRO C 10 6.464 3.564 -18.472 1.00 71.62 O
ATOM 6657 CB PRO C 10 9.041 2.213 -19.707 1.00 74.24 C
ATOM 6658 CG PRO C 10 10.429 2.625 -19.339 1.00 75.05 C
ATOM 6659 CD PRO C 10 10.739 3.695 -20.354 1.00 74.96 C
ATOM 6660 N LEU C 11 8.116 5.001 -17.984 1.00 70.97 N
ATOM 6661 CA LEU C 11 7.411 5.533 -16.819 1.00 70.07 C
ATOM 6662 C LEU C 11 6.748 6.874 -17.136 1.00 69.41 C
ATOM 6663 O LEU C 11 5.582 7.088 -16.802 1.00 68.67 O
ATOM 6664 CB LEU C 11 8.358 5.696 -15.616 1.00 69.68 C
ATOM 6665 CG LEU C 11 8.739 4.445 -14.807 1.00 68.20 C
ATOM 6666 CD1 LEU C 11 9.588 4.843 -13.613 1.00 66.37 C
ATOM 6667 CD2 LEU C 11 7.485 3.722 -14.336 1.00 66.98 C
ATOM 6668 N LEU C 12 7.493 7.773 -17.776 1.00 68.92 N
ATOM 6669 CA LEU C 12 6.955 9.074 -18.146 1.00 67.74 C
ATOM 6670 C LEU C 12 5.819 8.859 -19.115 1.00 67.92 C
ATOM 6671 O LEU C 12 4.798 9.534 -19.042 1.00 67.84 O
ATOM 6672 CB LEU C 12 8.031 9.926 -18.793 1.00 67.39 C
ATOM 6673 CG LEU C 12 9.167 10.193 -17.813 1.00 68.91 C
ATOM 6674 CD1 LEU C 12 10.225 11.050 -18.473 1.00 69.24 C
ATOM 6675 CD2 LEU C 12 8.608 10.887 -16.575 1.00 68.88 C
ATOM 6676 N LYS C 13 6.017 7.910 -20.025 1.00 68.37 N
ATOM 6677 CA LYS C 13 5.018 7.547 -21.027 1.00 68.98 C
ATOM 6678 C LYS C 13 3.670 7.446 -20.325 1.00 69.99 C
ATOM 6679 O LYS C 13 2.642 7.924 -20.822 1.00 70.46 O
ATOM 6680 CB LYS C 13 5.382 6.191 -21.643 1.00 68.74 C
ATOM 6681 CG LYS C 13 4.275 5.511 -22.417 1.00 69.84 C
ATOM 6682 CD LYS C 13 4.650 4.089 -22.780 1.00 71.26 C
ATOM 6683 CE LYS C 13 5.818 4.049 -23.759 1.00 73.29 C
ATOM 6684 NZ LYS C 13 6.215 2.652 -24.124 1.00 74.12 N
ATOM 6685 N MET C 14 3.694 6.826 -19.153 1.00 70.15 N
ATOM 6686 CA MET C 14 2.494 6.642 -18.358 1.00 70.68 C
ATOM 6687 C MET C 14 1.960 7.947 -17.779 1.00 69.39 C
ATOM 6688 O MET C 14 0.749 8.157 -17.736 1.00 70.07 O
ATOM 6689 CB MET C 14 2.773 5.659 -17.235 1.00 73.18 C
ATOM 6690 CG MET C 14 3.066 4.268 -17.715 1.00 77.61 C
ATOM 6691 SD MET C 14 3.218 3.179 -16.300 1.00 85.02 S
ATOM 6692 CE MET C 14 1.400 3.041 -15.797 1.00 84.14 C
ATOM 6693 N ILE C 15 2.855 8.815 -17.319 1.00 66.44 N
ATOM 6694 CA ILE C 15 2.429 10.095 -16.770 1.00 63.64 C
ATOM 6695 C ILE C 15 1.881 10.975 -17.887 1.00 62.72 C
ATOM 6696 O ILE C 15 0.890 11.689 -17.707 1.00 61.49 O
ATOM 6697 CB ILE C 15 3.589 10.819 -16.108 1.00 62.05 C
ATOM 6698 CG1 ILE C 15 4.158 9.942 -14.997 1.00 62.25 C
ATOM 6699 CG2 ILE C 15 3.123 12.149 -15.564 1.00 59.07 C
ATOM 6700 CD1 ILE C 15 5.423 10.487 -14.363 1.00 63.30 C
ATOM 6701 N ASN C 16 2.529 10.903 -19.044 1.00 61.51 N
ATOM 6702 CA ASN C 16 2.126 11.681 -20.198 1.00 61.55 C
ATOM 6703 C ASN C 16 0.747 11.254 -20.690 1.00 61.50 C
ATOM 6704 O ASN C 16 -0.101 12.100 -20.992 1.00 60.61 O
ATOM 6705 CB ASN C 16 3.151 11.521 -21.328 1.00 61.83 C
ATOM 6706 CG ASN C 16 2.835 12.397 -22.546 1.00 62.76 C
ATOM 6707 OD1 ASN C 16 2.822 13.628 -22.456 1.00 62.15 O
ATOM 6708 ND2 ASN C 16 2.581 11.758 -23.685 1.00 61.81 N
ATOM 6709 N ASN C 17 0.515 9.945 -20.758 1.00 61.09 N
ATOM 6710 CA ASN C 17 -0.762 9.443 -21.251 1.00 61.91 C
ATOM 6711 C ASN C 17 -1.933 9.558 -20.281 1.00 61.66 C
ATOM 6712 O ASN C 17 -3.063 9.209 -20.627 1.00 62.61 O
ATOM 6713 CB ASN C 17 -0.631 7.983 -21.696 1.00 63.58 C
ATOM 6714 CG ASN C 17 0.317 7.807 -22.875 1.00 64.94 C
ATOM 6715 OD1 ASN C 17 0.460 8.700 -23.717 1.00 65.21 O
ATOM 6716 ND2 ASN C 17 0.953 6.638 -22.950 1.00 64.97 N
ATOM 6717 N SER C 18 -1.678 10.049 -19.073 1.00 60.88 N
ATOM 6718 CA SER C 18 -2.749 10.175 -18.097 1.00 59.24 C
ATOM 6719 C SER C 18 -2.829 11.546 -17.442 1.00 57.95 C
ATOM 6720 O SER C 18 -3.822 11.869 -16.799 1.00 58.97 O
ATOM 6721 CB SER C 18 -2.603 9.091 -17.028 1.00 59.57 C
ATOM 6722 OG SER C 18 -1.350 9.191 -16.382 1.00 63.69 O
ATOM 6723 N LEU C 19 -1.800 12.365 -17.600 1.00 56.36 N
ATOM 6724 CA LEU C 19 -1.847 13.683 -16.989 1.00 56.42 C
ATOM 6725 C LEU C 19 -1.255 14.820 -17.809 1.00 55.72 C
ATOM 6726 O LEU C 19 -1.133 15.939 -17.320 1.00 56.25 O
ATOM 6727 CB LEU C 19 -1.169 13.644 -15.621 1.00 56.25 C
ATOM 6728 CG LEU C 19 -1.957 12.952 -14.515 1.00 55.49 C
ATOM 6729 CD1 LEU C 19 -1.104 12.859 -13.258 1.00 54.88 C
ATOM 6730 CD2 LEU C 19 -3.231 13.730 -14.257 1.00 53.58 C
ATOM 6731 N ILE C 20 -0.894 14.564 -19.055 1.00 53.87 N
ATOM 6732 CA ILE C 20 -0.320 15.635 -19.836 1.00 52.13 C
ATOM 6733 C ILE C 20 -0.927 15.703 -21.220 1.00 52.07 C
ATOM 6734 O ILE C 20 -1.527 16.709 -21.583 1.00 52.83 O
ATOM 6735 CB ILE C 20 1.218 15.488 -19.899 1.00 51.53 C
ATOM 6736 CG1 ILE C 20 1.789 15.548 -18.478 1.00 49.17 C
ATOM 6737 CG2 ILE C 20 1.833 16.618 -20.701 1.00 51.37 C
ATOM 6738 CD1 ILE C 20 3.269 15.305 -18.403 1.00 48.19 C
ATOM 6739 N ASP C 21 -0.802 14.631 -21.986 1.00 51.93 N
ATOM 6740 CA ASP C 21 -1.354 14.604 -23.335 1.00 50.37 C
ATOM 6741 C ASP C 21 -2.713 13.921 -23.377 1.00 48.00 C
ATOM 6742 O ASP C 21 -3.316 13.799 -24.444 1.00 48.42 O
ATOM 6743 CB ASP C 21 -0.381 13.890 -24.277 1.00 54.26 C
ATOM 6744 CG ASP C 21 0.818 14.755 -24.641 1.00 56.76 C
ATOM 6745 OD1 ASP C 21 1.205 15.615 -23.816 1.00 52.85 O
ATOM 6746 OD2 ASP C 21 1.374 14.564 -25.751 1.00 60.47 O
ATOM 6747 N LEU C 22 -3.187 13.474 -22.218 1.00 44.95 N
ATOM 6748 CA LEU C 22 -4.483 12.813 -22.121 1.00 42.86 C
ATOM 6749 C LEU C 22 -5.574 13.665 -22.750 1.00 42.43 C
ATOM 6750 O LEU C 22 -5.762 14.828 -22.382 1.00 41.82 O
ATOM 6751 CB LEU C 22 -4.820 12.560 -20.662 1.00 43.87 C
ATOM 6752 CG LEU C 22 -6.264 12.174 -20.319 1.00 44.71 C
ATOM 6753 CD1 LEU C 22 -6.680 10.890 -21.021 1.00 44.72 C
ATOM 6754 CD2 LEU C 22 -6.362 12.016 -18.812 1.00 45.42 C
ATOM 6755 N PRO C 23 -6.309 13.105 -23.717 1.00 40.83 N
ATOM 6756 CA PRO C 23 -7.369 13.885 -24.355 1.00 41.10 C
ATOM 6757 C PRO C 23 -8.543 14.056 -23.406 1.00 39.52 C
ATOM 6758 O PRO C 23 -9.053 13.075 -22.866 1.00 42.50 O
ATOM 6759 CB PRO C 23 -7.733 13.041 -25.589 1.00 41.50 C
ATOM 6760 CG PRO C 23 -6.478 12.266 -25.864 1.00 40.87 C
ATOM 6761 CD PRO C 23 -6.082 11.858 -24.455 1.00 41.92 C
ATOM 6762 N ALA C 24 -8.963 15.300 -23.195 1.00 36.13 N
ATOM 6763 CA ALA C 24 -10.084 15.573 -22.311 1.00 33.95 C
ATOM 6764 C ALA C 24 -11.155 16.404 -23.010 1.00 33.92 C
ATOM 6765 O ALA C 24 -10.865 17.206 -23.898 1.00 34.35 O
ATOM 6766 CB ALA C 24 -9.607 16.284 -21.074 1.00 30.26 C
ATOM 6767 N PRO C 25 -12.425 16.199 -22.634 1.00 33.08 N
ATOM 6768 CA PRO C 25 -13.484 16.984 -23.271 1.00 31.95 C
ATOM 6769 C PRO C 25 -13.248 18.454 -22.939 1.00 32.79 C
ATOM 6770 O PRO C 25 -12.895 18.801 -21.812 1.00 31.12 O
ATOM 6771 CB PRO C 25 -14.745 16.450 -22.614 1.00 30.51 C
ATOM 6772 CG PRO C 25 -14.365 15.036 -22.269 1.00 30.26 C
ATOM 6773 CD PRO C 25 -12.982 15.168 -21.743 1.00 29.88 C
ATOM 6774 N SER C 26 -13.448 19.319 -23.920 1.00 34.85 N
ATOM 6775 CA SER C 26 -13.243 20.747 -23.719 1.00 36.52 C
ATOM 6776 C SER C 26 -14.242 21.386 -22.764 1.00 36.26 C
ATOM 6777 O SER C 26 -13.915 22.365 -22.108 1.00 37.34 O
ATOM 6778 CB SER C 26 -13.332 21.473 -25.061 1.00 38.57 C
ATOM 6779 OG SER C 26 -14.595 21.236 -25.666 1.00 38.45 O
ATOM 6780 N ASN C 27 -15.443 20.818 -22.669 1.00 35.89 N
ATOM 6781 CA ASN C 27 -16.498 21.387 -21.837 1.00 35.25 C
ATOM 6782 C ASN C 27 -16.850 20.778 -20.478 1.00 35.12 C
ATOM 6783 O ASN C 27 -17.938 21.037 -19.969 1.00 35.86 O
ATOM 6784 CB ASN C 27 -17.773 21.449 -22.662 1.00 37.90 C
ATOM 6785 CG ASN C 27 -18.363 20.098 -22.889 1.00 39.81 C
ATOM 6786 OD1 ASN C 27 -17.636 19.131 -23.114 1.00 42.60 O
ATOM 6787 ND2 ASN C 27 -19.690 20.009 -22.837 1.00 43.42 N
ATOM 6788 N ILE C 28 -15.981 19.985 -19.866 1.00 34.56 N
ATOM 6789 CA ILE C 28 -16.367 19.433 -18.578 1.00 33.22 C
ATOM 6790 C ILE C 28 -16.368 20.543 -17.536 1.00 32.21 C
ATOM 6791 O ILE C 28 -15.480 21.390 -17.538 1.00 29.45 O
ATOM 6792 CB ILE C 28 -15.455 18.259 -18.127 1.00 33.71 C
ATOM 6793 CG1 ILE C 28 -13.999 18.665 -18.169 1.00 34.32 C
ATOM 6794 CG2 ILE C 28 -15.698 17.044 -18.992 1.00 33.03 C
ATOM 6795 CD1 ILE C 28 -13.083 17.586 -17.658 1.00 35.97 C
ATOM 6796 N SER C 29 -17.373 20.525 -16.656 1.00 31.64 N
ATOM 6797 CA SER C 29 -17.522 21.548 -15.630 1.00 32.98 C
ATOM 6798 C SER C 29 -16.866 21.270 -14.286 1.00 35.19 C
ATOM 6799 O SER C 29 -16.038 20.369 -14.148 1.00 37.38 O
ATOM 6800 CB SER C 29 -19.001 21.850 -15.404 1.00 33.73 C
ATOM 6801 OG SER C 29 -19.734 20.705 -15.008 1.00 36.99 O
ATOM 6802 N ALA C 30 -17.241 22.068 -13.291 1.00 34.01 N
ATOM 6803 CA ALA C 30 -16.693 21.917 -11.962 1.00 33.41 C
ATOM 6804 C ALA C 30 -17.042 20.555 -11.388 1.00 33.18 C
ATOM 6805 O ALA C 30 -16.352 20.060 -10.509 1.00 33.67 O
ATOM 6806 CB ALA C 30 -17.221 23.009 -11.056 1.00 34.82 C
ATOM 6807 N TRP C 31 -18.110 19.945 -11.883 1.00 33.06 N
ATOM 6808 CA TRP C 31 -18.502 18.642 -11.371 1.00 33.64 C
ATOM 6809 C TRP C 31 -17.494 17.539 -11.717 1.00 32.34 C
ATOM 6810 O TRP C 31 -17.577 16.420 -11.209 1.00 32.37 O
ATOM 6811 CB TRP C 31 -19.891 18.269 -11.895 1.00 33.92 C
ATOM 6812 CG TRP C 31 -20.938 19.177 -11.412 1.00 32.65 C
ATOM 6813 CD1 TRP C 31 -21.683 20.025 -12.164 1.00 34.79 C
ATOM 6814 CD2 TRP C 31 -21.314 19.406 -10.054 1.00 33.77 C
ATOM 6815 NE1 TRP C 31 -22.499 20.782 -11.364 1.00 34.71 N
ATOM 6816 CE2 TRP C 31 -22.296 20.426 -10.060 1.00 34.61 C
ATOM 6817 CE3 TRP C 31 -20.920 18.857 -8.829 1.00 33.11 C
ATOM 6818 CZ2 TRP C 31 -22.891 20.913 -8.885 1.00 34.15 C
ATOM 6819 CZ3 TRP C 31 -21.513 19.339 -7.654 1.00 33.41 C
ATOM 6820 CH2 TRP C 31 -22.490 20.361 -7.696 1.00 32.77 C
ATOM 6821 N TRP C 32 -16.543 17.859 -12.581 1.00 30.50 N
ATOM 6822 CA TRP C 32 -15.536 16.887 -12.981 1.00 29.50 C
ATOM 6823 C TRP C 32 -14.228 17.138 -12.215 1.00 30.14 C
ATOM 6824 O TRP C 32 -13.187 16.569 -12.517 1.00 30.96 O
ATOM 6825 CB TRP C 32 -15.318 16.971 -14.495 1.00 26.42 C
ATOM 6826 CG TRP C 32 -16.186 16.037 -15.278 1.00 24.73 C
ATOM 6827 CD1 TRP C 32 -15.806 14.861 -15.827 1.00 27.40 C
ATOM 6828 CD2 TRP C 32 -17.571 16.207 -15.619 1.00 27.89 C
ATOM 6829 NE1 TRP C 32 -16.853 14.275 -16.498 1.00 29.04 N
ATOM 6830 CE2 TRP C 32 -17.953 15.082 -16.387 1.00 28.15 C
ATOM 6831 CE3 TRP C 32 -18.530 17.204 -15.356 1.00 27.65 C
ATOM 6832 CZ2 TRP C 32 -19.249 14.919 -16.901 1.00 27.52 C
ATOM 6833 CZ3 TRP C 32 -19.824 17.042 -15.870 1.00 26.11 C
ATOM 6834 CH2 TRP C 32 -20.167 15.904 -16.635 1.00 24.76 C
ATOM 6835 N ASN C 33 -14.318 17.975 -11.194 1.00 30.54 N
ATOM 6836 CA ASN C 33 -13.184 18.339 -10.371 1.00 32.14 C
ATOM 6837 C ASN C 33 -13.045 17.433 -9.162 1.00 33.23 C
ATOM 6838 O ASN C 33 -11.963 17.330 -8.586 1.00 36.55 O
ATOM 6839 CB ASN C 33 -13.341 19.785 -9.854 1.00 34.08 C
ATOM 6840 CG ASN C 33 -12.687 20.803 -10.747 1.00 34.65 C
ATOM 6841 OD1 ASN C 33 -13.137 21.076 -11.862 1.00 38.63 O
ATOM 6842 ND2 ASN C 33 -11.605 21.366 -10.266 1.00 36.71 N
ATOM 6843 N PHE C 34 -14.129 16.785 -8.759 1.00 31.33 N
ATOM 6844 CA PHE C 34 -14.085 15.943 -7.569 1.00 29.18 C
ATOM 6845 C PHE C 34 -13.257 14.664 -7.644 1.00 29.32 C
ATOM 6846 O PHE C 34 -12.888 14.101 -6.599 1.00 28.93 O
ATOM 6847 CB PHE C 34 -15.515 15.679 -7.115 1.00 27.43 C
ATOM 6848 CG PHE C 34 -16.218 16.932 -6.718 1.00 27.06 C
ATOM 6849 CD1 PHE C 34 -15.891 17.567 -5.530 1.00 26.73 C
ATOM 6850 CD2 PHE C 34 -17.085 17.568 -7.596 1.00 26.22 C
ATOM 6851 CE1 PHE C 34 -16.407 18.826 -5.230 1.00 27.76 C
ATOM 6852 CE2 PHE C 34 -17.599 18.823 -7.298 1.00 25.01 C
ATOM 6853 CZ PHE C 34 -17.259 19.451 -6.121 1.00 24.62 C
ATOM 6854 N GLY C 35 -12.965 14.212 -8.865 1.00 28.28 N
ATOM 6855 CA GLY C 35 -12.133 13.036 -9.033 1.00 27.76 C
ATOM 6856 C GLY C 35 -10.744 13.375 -8.494 1.00 28.49 C
ATOM 6857 O GLY C 35 -10.202 12.696 -7.604 1.00 28.00 O
ATOM 6858 N SER C 36 -10.159 14.450 -9.010 1.00 27.11 N
ATOM 6859 CA SER C 36 -8.853 14.852 -8.536 1.00 27.53 C
ATOM 6860 C SER C 36 -8.890 15.238 -7.058 1.00 27.55 C
ATOM 6861 O SER C 36 -7.937 14.966 -6.330 1.00 29.79 O
ATOM 6862 CB SER C 36 -8.309 15.998 -9.374 1.00 26.70 C
ATOM 6863 OG SER C 36 -9.217 17.076 -9.381 1.00 28.76 O
ATOM 6864 N LEU C 37 -9.966 15.869 -6.590 1.00 26.99 N
ATOM 6865 CA LEU C 37 -10.012 16.222 -5.170 1.00 26.43 C
ATOM 6866 C LEU C 37 -10.046 14.938 -4.345 1.00 26.70 C
ATOM 6867 O LEU C 37 -9.408 14.855 -3.290 1.00 25.87 O
ATOM 6868 CB LEU C 37 -11.229 17.084 -4.832 1.00 28.11 C
ATOM 6869 CG LEU C 37 -11.313 18.465 -5.498 1.00 30.13 C
ATOM 6870 CD1 LEU C 37 -12.506 19.226 -4.956 1.00 27.49 C
ATOM 6871 CD2 LEU C 37 -10.056 19.250 -5.252 1.00 30.44 C
ATOM 6872 N LEU C 38 -10.773 13.929 -4.828 1.00 25.57 N
ATOM 6873 CA LEU C 38 -10.822 12.662 -4.112 1.00 23.27 C
ATOM 6874 C LEU C 38 -9.427 12.077 -4.036 1.00 22.59 C
ATOM 6875 O LEU C 38 -9.011 11.585 -2.995 1.00 21.20 O
ATOM 6876 CB LEU C 38 -11.768 11.681 -4.786 1.00 20.20 C
ATOM 6877 CG LEU C 38 -13.233 11.964 -4.481 1.00 20.34 C
ATOM 6878 CD1 LEU C 38 -14.101 11.148 -5.430 1.00 18.62 C
ATOM 6879 CD2 LEU C 38 -13.542 11.631 -3.007 1.00 16.69 C
ATOM 6880 N ALA C 39 -8.687 12.156 -5.133 1.00 23.96 N
ATOM 6881 CA ALA C 39 -7.328 11.627 -5.134 1.00 24.72 C
ATOM 6882 C ALA C 39 -6.457 12.382 -4.125 1.00 24.98 C
ATOM 6883 O ALA C 39 -5.654 11.776 -3.407 1.00 26.24 O
ATOM 6884 CB ALA C 39 -6.743 11.727 -6.506 1.00 23.88 C
ATOM 6885 N VAL C 40 -6.615 13.696 -4.052 1.00 25.04 N
ATOM 6886 CA VAL C 40 -5.832 14.471 -3.101 1.00 28.30 C
ATOM 6887 C VAL C 40 -6.249 14.194 -1.641 1.00 29.88 C
ATOM 6888 O VAL C 40 -5.414 14.231 -0.746 1.00 31.16 O
ATOM 6889 CB VAL C 40 -5.917 15.993 -3.416 1.00 30.32 C
ATOM 6890 CG1 VAL C 40 -5.425 16.812 -2.221 1.00 28.78 C
ATOM 6891 CG2 VAL C 40 -5.067 16.318 -4.644 1.00 24.05 C
ATOM 6892 N CYS C 41 -7.522 13.925 -1.376 1.00 30.09 N
ATOM 6893 CA CYS C 41 -7.877 13.599 -0.001 1.00 33.60 C
ATOM 6894 C CYS C 41 -7.147 12.324 0.355 1.00 33.78 C
ATOM 6895 O CYS C 41 -6.597 12.195 1.448 1.00 35.77 O
ATOM 6896 CB CYS C 41 -9.351 13.272 0.172 1.00 36.99 C
ATOM 6897 SG CYS C 41 -10.457 14.626 0.138 1.00 49.47 S
ATOM 6898 N LEU C 42 -7.176 11.368 -0.566 1.00 31.92 N
ATOM 6899 CA LEU C 42 -6.559 10.093 -0.320 1.00 31.85 C
ATOM 6900 C LEU C 42 -5.105 10.248 0.038 1.00 34.15 C
ATOM 6901 O LEU C 42 -4.641 9.681 1.029 1.00 34.46 O
ATOM 6902 CB LEU C 42 -6.705 9.183 -1.531 1.00 29.46 C
ATOM 6903 CG LEU C 42 -6.221 7.753 -1.287 1.00 27.29 C
ATOM 6904 CD1 LEU C 42 -6.832 7.202 -0.010 1.00 23.97 C
ATOM 6905 CD2 LEU C 42 -6.599 6.894 -2.478 1.00 26.85 C
ATOM 6906 N MET C 43 -4.373 11.028 -0.742 1.00 36.30 N
ATOM 6907 CA MET C 43 -2.970 11.178 -0.425 1.00 38.90 C
ATOM 6908 C MET C 43 -2.803 11.968 0.852 1.00 37.40 C
ATOM 6909 O MET C 43 -1.930 11.679 1.662 1.00 38.56 O
ATOM 6910 CB MET C 43 -2.236 11.800 -1.596 1.00 43.63 C
ATOM 6911 CG MET C 43 -2.117 10.803 -2.749 1.00 50.64 C
ATOM 6912 SD MET C 43 -1.540 11.553 -4.293 1.00 62.32 S
ATOM 6913 CE MET C 43 0.307 11.202 -4.227 1.00 58.34 C
ATOM 6914 N THR C 44 -3.669 12.945 1.055 1.00 35.81 N
ATOM 6915 CA THR C 44 -3.625 13.747 2.267 1.00 34.18 C
ATOM 6916 C THR C 44 -3.936 12.900 3.507 1.00 33.33 C
ATOM 6917 O THR C 44 -3.257 13.012 4.531 1.00 33.85 O
ATOM 6918 CB THR C 44 -4.647 14.890 2.187 1.00 35.09 C
ATOM 6919 OG1 THR C 44 -4.158 15.877 1.284 1.00 34.04 O
ATOM 6920 CG2 THR C 44 -4.891 15.524 3.576 1.00 36.57 C
ATOM 6921 N GLN C 45 -4.981 12.079 3.427 1.00 29.60 N
ATOM 6922 CA GLN C 45 -5.353 11.242 4.546 1.00 28.27 C
ATOM 6923 C GLN C 45 -4.230 10.286 4.935 1.00 28.70 C
ATOM 6924 O GLN C 45 -3.897 10.141 6.114 1.00 26.93 O
ATOM 6925 CB GLN C 45 -6.610 10.449 4.212 1.00 29.46 C
ATOM 6926 CG GLN C 45 -7.904 11.236 4.324 1.00 30.13 C
ATOM 6927 CD GLN C 45 -8.083 11.839 5.691 1.00 30.43 C
ATOM 6928 OE1 GLN C 45 -7.742 13.000 5.918 1.00 34.27 O
ATOM 6929 NE2 GLN C 45 -8.589 11.044 6.625 1.00 31.42 N
ATOM 6930 N ILE C 46 -3.652 9.628 3.935 1.00 29.19 N
ATOM 6931 CA ILE C 46 -2.562 8.683 4.163 1.00 27.72 C
ATOM 6932 C ILE C 46 -1.384 9.359 4.851 1.00 28.01 C
ATOM 6933 O ILE C 46 -0.800 8.830 5.799 1.00 30.90 O
ATOM 6934 CB ILE C 46 -2.080 8.072 2.833 1.00 24.61 C
ATOM 6935 CG1 ILE C 46 -3.071 7.005 2.362 1.00 20.71 C
ATOM 6936 CG2 ILE C 46 -0.712 7.473 3.006 1.00 25.23 C
ATOM 6937 CD1 ILE C 46 -2.929 6.639 0.891 1.00 15.44 C
ATOM 6938 N LEU C 47 -1.043 10.540 4.380 1.00 27.59 N
ATOM 6939 CA LEU C 47 0.073 11.262 4.945 1.00 29.38 C
ATOM 6940 C LEU C 47 -0.171 11.652 6.393 1.00 29.55 C
ATOM 6941 O LEU C 47 0.681 11.442 7.256 1.00 32.22 O
ATOM 6942 CB LEU C 47 0.366 12.498 4.089 1.00 32.68 C
ATOM 6943 CG LEU C 47 1.535 13.373 4.544 1.00 36.71 C
ATOM 6944 CD1 LEU C 47 2.812 12.543 4.527 1.00 38.06 C
ATOM 6945 CD2 LEU C 47 1.665 14.592 3.638 1.00 37.12 C
ATOM 6946 N THR C 48 -1.338 12.209 6.675 1.00 28.84 N
ATOM 6947 CA THR C 48 -1.639 12.617 8.038 1.00 27.54 C
ATOM 6948 C THR C 48 -1.830 11.397 8.912 1.00 26.06 C
ATOM 6949 O THR C 48 -1.480 11.407 10.085 1.00 25.68 O
ATOM 6950 CB THR C 48 -2.912 13.536 8.103 1.00 27.72 C
ATOM 6951 OG1 THR C 48 -4.021 12.895 7.471 1.00 28.89 O
ATOM 6952 CG2 THR C 48 -2.660 14.846 7.387 1.00 26.92 C
ATOM 6953 N GLY C 49 -2.380 10.340 8.329 1.00 26.05 N
ATOM 6954 CA GLY C 49 -2.601 9.112 9.072 1.00 26.88 C
ATOM 6955 C GLY C 49 -1.308 8.470 9.541 1.00 27.66 C
ATOM 6956 O GLY C 49 -1.209 8.065 10.700 1.00 27.21 O
ATOM 6957 N LEU C 50 -0.320 8.357 8.650 1.00 28.12 N
ATOM 6958 CA LEU C 50 0.974 7.789 9.041 1.00 28.22 C
ATOM 6959 C LEU C 50 1.525 8.630 10.181 1.00 28.20 C
ATOM 6960 O LEU C 50 1.956 8.107 11.214 1.00 29.09 O
ATOM 6961 CB LEU C 50 1.966 7.833 7.883 1.00 30.25 C
ATOM 6962 CG LEU C 50 1.769 6.874 6.711 1.00 32.33 C
ATOM 6963 CD1 LEU C 50 2.664 7.299 5.556 1.00 32.69 C
ATOM 6964 CD2 LEU C 50 2.088 5.452 7.157 1.00 32.34 C
ATOM 6965 N LEU C 51 1.506 9.944 9.990 1.00 27.59 N
ATOM 6966 CA LEU C 51 2.005 10.836 11.012 1.00 28.43 C
ATOM 6967 C LEU C 51 1.323 10.600 12.358 1.00 28.36 C
ATOM 6968 O LEU C 51 2.003 10.603 13.387 1.00 28.50 O
ATOM 6969 CB LEU C 51 1.872 12.297 10.559 1.00 29.14 C
ATOM 6970 CG LEU C 51 2.854 12.668 9.424 1.00 28.36 C
ATOM 6971 CD1 LEU C 51 2.572 14.092 8.951 1.00 28.13 C
ATOM 6972 CD2 LEU C 51 4.306 12.544 9.903 1.00 24.84 C
ATOM 6973 N LEU C 52 0.005 10.373 12.363 1.00 27.78 N
ATOM 6974 CA LEU C 52 -0.699 10.111 13.626 1.00 27.61 C
ATOM 6975 C LEU C 52 -0.337 8.724 14.130 1.00 29.52 C
ATOM 6976 O LEU C 52 -0.085 8.537 15.321 1.00 30.54 O
ATOM 6977 CB LEU C 52 -2.218 10.181 13.472 1.00 26.10 C
ATOM 6978 CG LEU C 52 -2.866 11.527 13.138 1.00 27.59 C
ATOM 6979 CD1 LEU C 52 -4.369 11.379 13.101 1.00 25.18 C
ATOM 6980 CD2 LEU C 52 -2.461 12.550 14.170 1.00 28.94 C
ATOM 6981 N ALA C 53 -0.301 7.756 13.215 1.00 30.78 N
ATOM 6982 CA ALA C 53 0.025 6.384 13.562 1.00 31.05 C
ATOM 6983 C ALA C 53 1.355 6.281 14.280 1.00 33.60 C
ATOM 6984 O ALA C 53 1.562 5.368 15.079 1.00 35.92 O
ATOM 6985 CB ALA C 53 0.047 5.546 12.334 1.00 29.42 C
ATOM 6986 N MET C 54 2.261 7.216 14.017 1.00 35.78 N
ATOM 6987 CA MET C 54 3.570 7.181 14.673 1.00 37.08 C
ATOM 6988 C MET C 54 3.597 7.582 16.144 1.00 35.18 C
ATOM 6989 O MET C 54 4.656 7.567 16.774 1.00 35.49 O
ATOM 6990 CB MET C 54 4.562 8.014 13.872 1.00 40.20 C
ATOM 6991 CG MET C 54 4.791 7.378 12.517 1.00 44.72 C
ATOM 6992 SD MET C 54 5.785 8.326 11.403 1.00 49.74 S
ATOM 6993 CE MET C 54 6.060 7.099 10.150 1.00 48.48 C
ATOM 6994 N HIS C 55 2.435 7.938 16.688 1.00 33.21 N
ATOM 6995 CA HIS C 55 2.326 8.296 18.097 1.00 29.64 C
ATOM 6996 C HIS C 55 1.115 7.630 18.720 1.00 30.89 C
ATOM 6997 O HIS C 55 0.814 7.843 19.896 1.00 32.73 O
ATOM 6998 CB HIS C 55 2.194 9.786 18.278 1.00 26.23 C
ATOM 6999 CG HIS C 55 3.331 10.567 17.712 1.00 25.69 C
ATOM 7000 ND1 HIS C 55 3.347 11.018 16.413 1.00 25.61 N
ATOM 7001 CD2 HIS C 55 4.485 10.994 18.276 1.00 25.17 C
ATOM 7002 CE1 HIS C 55 4.461 11.697 16.198 1.00 25.96 C
ATOM 7003 NE2 HIS C 55 5.168 11.698 17.313 1.00 25.97 N
ATOM 7004 N TYR C 56 0.426 6.817 17.929 1.00 30.71 N
ATOM 7005 CA TYR C 56 -0.763 6.130 18.393 1.00 30.79 C
ATOM 7006 C TYR C 56 -0.389 4.823 19.069 1.00 31.41 C
ATOM 7007 O TYR C 56 0.674 4.283 18.816 1.00 33.87 O
ATOM 7008 CB TYR C 56 -1.687 5.859 17.212 1.00 29.52 C
ATOM 7009 CG TYR C 56 -2.950 5.143 17.594 1.00 29.62 C
ATOM 7010 CD1 TYR C 56 -3.857 5.723 18.492 1.00 27.67 C
ATOM 7011 CD2 TYR C 56 -3.225 3.857 17.098 1.00 28.97 C
ATOM 7012 CE1 TYR C 56 -5.012 5.030 18.897 1.00 28.79 C
ATOM 7013 CE2 TYR C 56 -4.379 3.155 17.497 1.00 28.57 C
ATOM 7014 CZ TYR C 56 -5.263 3.745 18.398 1.00 28.44 C
ATOM 7015 OH TYR C 56 -6.370 3.043 18.817 1.00 27.20 O
ATOM 7016 N THR C 57 -1.254 4.327 19.940 1.00 31.44 N
ATOM 7017 CA THR C 57 -1.014 3.077 20.630 1.00 30.85 C
ATOM 7018 C THR C 57 -2.318 2.309 20.714 1.00 30.62 C
ATOM 7019 O THR C 57 -3.207 2.679 21.451 1.00 30.65 O
ATOM 7020 CB THR C 57 -0.471 3.314 22.029 1.00 32.79 C
ATOM 7021 OG1 THR C 57 0.865 3.830 21.942 1.00 38.85 O
ATOM 7022 CG2 THR C 57 -0.429 2.017 22.796 1.00 35.70 C
ATOM 7023 N ALA C 58 -2.422 1.236 19.938 1.00 32.65 N
ATOM 7024 CA ALA C 58 -3.619 0.404 19.895 1.00 32.78 C
ATOM 7025 C ALA C 58 -3.718 -0.582 21.047 1.00 33.75 C
ATOM 7026 O ALA C 58 -3.240 -1.719 20.964 1.00 34.58 O
ATOM 7027 CB ALA C 58 -3.687 -0.345 18.568 1.00 32.68 C
ATOM 7028 N ASP C 59 -4.339 -0.121 22.123 1.00 34.85 N
ATOM 7029 CA ASP C 59 -4.577 -0.916 23.317 1.00 34.67 C
ATOM 7030 C ASP C 59 -5.608 -0.108 24.074 1.00 36.37 C
ATOM 7031 O ASP C 59 -5.440 1.111 24.270 1.00 36.99 O
ATOM 7032 CB ASP C 59 -3.327 -1.035 24.153 1.00 37.20 C
ATOM 7033 CG ASP C 59 -3.481 -2.037 25.257 1.00 40.50 C
ATOM 7034 OD1 ASP C 59 -3.299 -3.250 24.988 1.00 43.78 O
ATOM 7035 OD2 ASP C 59 -3.802 -1.612 26.386 1.00 41.44 O
ATOM 7036 N THR C 60 -6.683 -0.765 24.492 1.00 36.02 N
ATOM 7037 CA THR C 60 -7.764 -0.065 25.189 1.00 33.70 C
ATOM 7038 C THR C 60 -7.305 0.787 26.376 1.00 34.20 C
ATOM 7039 O THR C 60 -7.895 1.820 26.672 1.00 33.78 O
ATOM 7040 CB THR C 60 -8.827 -1.047 25.660 1.00 30.83 C
ATOM 7041 OG1 THR C 60 -8.218 -2.042 26.483 1.00 29.89 O
ATOM 7042 CG2 THR C 60 -9.492 -1.713 24.474 1.00 28.58 C
ATOM 7043 N SER C 61 -6.237 0.383 27.041 1.00 33.74 N
ATOM 7044 CA SER C 61 -5.776 1.155 28.182 1.00 33.18 C
ATOM 7045 C SER C 61 -4.928 2.340 27.757 1.00 31.93 C
ATOM 7046 O SER C 61 -4.661 3.223 28.567 1.00 31.96 O
ATOM 7047 CB SER C 61 -4.958 0.273 29.126 1.00 34.17 C
ATOM 7048 OG SER C 61 -3.708 -0.071 28.534 1.00 37.94 O
ATOM 7049 N LEU C 62 -4.511 2.382 26.494 1.00 29.94 N
ATOM 7050 CA LEU C 62 -3.668 3.485 26.053 1.00 27.71 C
ATOM 7051 C LEU C 62 -4.167 4.266 24.835 1.00 27.82 C
ATOM 7052 O LEU C 62 -3.702 5.367 24.569 1.00 27.83 O
ATOM 7053 CB LEU C 62 -2.252 2.958 25.808 1.00 28.10 C
ATOM 7054 CG LEU C 62 -1.508 2.300 27.004 1.00 27.46 C
ATOM 7055 CD1 LEU C 62 -0.243 1.600 26.502 1.00 25.58 C
ATOM 7056 CD2 LEU C 62 -1.134 3.341 28.046 1.00 22.84 C
ATOM 7057 N ALA C 63 -5.129 3.719 24.105 1.00 27.89 N
ATOM 7058 CA ALA C 63 -5.662 4.400 22.924 1.00 26.95 C
ATOM 7059 C ALA C 63 -6.036 5.865 23.132 1.00 27.02 C
ATOM 7060 O ALA C 63 -5.445 6.768 22.539 1.00 26.04 O
ATOM 7061 CB ALA C 63 -6.868 3.658 22.423 1.00 28.09 C
ATOM 7062 N PHE C 64 -7.054 6.088 23.959 1.00 27.27 N
ATOM 7063 CA PHE C 64 -7.554 7.428 24.243 1.00 24.66 C
ATOM 7064 C PHE C 64 -6.426 8.371 24.658 1.00 25.27 C
ATOM 7065 O PHE C 64 -6.285 9.467 24.108 1.00 27.77 O
ATOM 7066 CB PHE C 64 -8.613 7.358 25.350 1.00 23.98 C
ATOM 7067 CG PHE C 64 -9.349 8.661 25.597 1.00 22.93 C
ATOM 7068 CD1 PHE C 64 -10.500 8.981 24.879 1.00 21.53 C
ATOM 7069 CD2 PHE C 64 -8.888 9.569 26.545 1.00 20.62 C
ATOM 7070 CE1 PHE C 64 -11.173 10.184 25.106 1.00 19.69 C
ATOM 7071 CE2 PHE C 64 -9.563 10.775 26.771 1.00 18.96 C
ATOM 7072 CZ PHE C 64 -10.698 11.077 26.053 1.00 17.97 C
ATOM 7073 N SER C 65 -5.605 7.955 25.603 1.00 23.37 N
ATOM 7074 CA SER C 65 -4.543 8.840 26.044 1.00 26.12 C
ATOM 7075 C SER C 65 -3.394 9.060 25.037 1.00 24.87 C
ATOM 7076 O SER C 65 -2.753 10.115 25.037 1.00 25.12 O
ATOM 7077 CB SER C 65 -4.007 8.367 27.398 1.00 26.03 C
ATOM 7078 OG SER C 65 -3.499 7.059 27.288 1.00 34.45 O
ATOM 7079 N SER C 66 -3.127 8.090 24.175 1.00 24.71 N
ATOM 7080 CA SER C 66 -2.068 8.278 23.188 1.00 23.44 C
ATOM 7081 C SER C 66 -2.516 9.369 22.208 1.00 24.02 C
ATOM 7082 O SER C 66 -1.703 10.165 21.717 1.00 25.84 O
ATOM 7083 CB SER C 66 -1.780 6.970 22.445 1.00 21.90 C
ATOM 7084 OG SER C 66 -2.706 6.737 21.414 1.00 24.85 O
ATOM 7085 N VAL C 67 -3.814 9.412 21.933 1.00 21.35 N
ATOM 7086 CA VAL C 67 -4.345 10.425 21.054 1.00 20.18 C
ATOM 7087 C VAL C 67 -4.232 11.778 21.764 1.00 23.05 C
ATOM 7088 O VAL C 67 -3.899 12.807 21.158 1.00 22.14 O
ATOM 7089 CB VAL C 67 -5.796 10.105 20.718 1.00 18.81 C
ATOM 7090 CG1 VAL C 67 -6.421 11.224 19.903 1.00 16.24 C
ATOM 7091 CG2 VAL C 67 -5.842 8.811 19.942 1.00 16.16 C
ATOM 7092 N ALA C 68 -4.502 11.761 23.062 1.00 24.74 N
ATOM 7093 CA ALA C 68 -4.430 12.963 23.867 1.00 26.18 C
ATOM 7094 C ALA C 68 -2.976 13.384 23.886 1.00 27.83 C
ATOM 7095 O ALA C 68 -2.672 14.565 23.717 1.00 29.50 O
ATOM 7096 CB ALA C 68 -4.930 12.692 25.291 1.00 25.60 C
ATOM 7097 N HIS C 69 -2.076 12.416 24.076 1.00 28.92 N
ATOM 7098 CA HIS C 69 -0.646 12.706 24.101 1.00 28.00 C
ATOM 7099 C HIS C 69 -0.262 13.361 22.766 1.00 28.93 C
ATOM 7100 O HIS C 69 0.497 14.343 22.742 1.00 25.72 O
ATOM 7101 CB HIS C 69 0.159 11.416 24.322 1.00 30.09 C
ATOM 7102 CG HIS C 69 1.629 11.542 24.002 1.00 35.05 C
ATOM 7103 ND1 HIS C 69 2.194 11.016 22.854 1.00 32.18 N
ATOM 7104 CD2 HIS C 69 2.635 12.181 24.656 1.00 34.65 C
ATOM 7105 CE1 HIS C 69 3.478 11.331 22.814 1.00 33.06 C
ATOM 7106 NE2 HIS C 69 3.769 12.039 23.894 1.00 35.66 N
ATOM 7107 N THR C 70 -0.804 12.820 21.668 1.00 28.07 N
ATOM 7108 CA THR C 70 -0.525 13.351 20.346 1.00 27.66 C
ATOM 7109 C THR C 70 -0.962 14.805 20.237 1.00 28.81 C
ATOM 7110 O THR C 70 -0.178 15.657 19.812 1.00 28.62 O
ATOM 7111 CB THR C 70 -1.248 12.555 19.233 1.00 28.45 C
ATOM 7112 OG1 THR C 70 -0.800 11.197 19.235 1.00 30.07 O
ATOM 7113 CG2 THR C 70 -0.947 13.152 17.868 1.00 26.41 C
ATOM 7114 N CYS C 71 -2.207 15.099 20.621 1.00 29.25 N
ATOM 7115 CA CYS C 71 -2.721 16.474 20.521 1.00 27.61 C
ATOM 7116 C CYS C 71 -2.076 17.415 21.523 1.00 28.91 C
ATOM 7117 O CYS C 71 -1.898 18.591 21.243 1.00 32.17 O
ATOM 7118 CB CYS C 71 -4.247 16.518 20.705 1.00 23.44 C
ATOM 7119 SG CYS C 71 -5.204 15.533 19.483 1.00 22.46 S
ATOM 7120 N ARG C 72 -1.704 16.903 22.684 1.00 26.97 N
ATOM 7121 CA ARG C 72 -1.115 17.765 23.686 1.00 27.24 C
ATOM 7122 C ARG C 72 0.411 17.920 23.684 1.00 28.92 C
ATOM 7123 O ARG C 72 0.908 18.989 24.024 1.00 31.16 O
ATOM 7124 CB ARG C 72 -1.566 17.316 25.080 1.00 26.27 C
ATOM 7125 CG ARG C 72 -3.029 17.602 25.418 1.00 23.28 C
ATOM 7126 CD ARG C 72 -3.421 16.960 26.761 1.00 24.87 C
ATOM 7127 NE ARG C 72 -4.845 17.115 27.058 1.00 28.37 N
ATOM 7128 CZ ARG C 72 -5.420 18.238 27.515 1.00 29.29 C
ATOM 7129 NH1 ARG C 72 -4.699 19.334 27.757 1.00 26.22 N
ATOM 7130 NH2 ARG C 72 -6.740 18.280 27.681 1.00 24.85 N
ATOM 7131 N ASN C 73 1.149 16.875 23.313 1.00 29.42 N
ATOM 7132 CA ASN C 73 2.619 16.915 23.330 1.00 28.05 C
ATOM 7133 C ASN C 73 3.383 16.948 21.995 1.00 27.87 C
ATOM 7134 O ASN C 73 4.441 17.562 21.891 1.00 28.62 O
ATOM 7135 CB ASN C 73 3.140 15.729 24.140 1.00 29.37 C
ATOM 7136 CG ASN C 73 2.656 15.743 25.572 1.00 29.22 C
ATOM 7137 OD1 ASN C 73 2.700 16.774 26.238 1.00 31.01 O
ATOM 7138 ND2 ASN C 73 2.205 14.595 26.060 1.00 27.38 N
ATOM 7139 N VAL C 74 2.868 16.264 20.986 1.00 25.42 N
ATOM 7140 CA VAL C 74 3.526 16.220 19.704 1.00 22.97 C
ATOM 7141 C VAL C 74 3.461 17.561 18.984 1.00 25.70 C
ATOM 7142 O VAL C 74 2.393 18.131 18.824 1.00 28.08 O
ATOM 7143 CB VAL C 74 2.891 15.106 18.821 1.00 21.39 C
ATOM 7144 CG1 VAL C 74 3.462 15.153 17.400 1.00 16.26 C
ATOM 7145 CG2 VAL C 74 3.125 13.719 19.473 1.00 14.44 C
ATOM 7146 N GLN C 75 4.611 18.074 18.563 1.00 27.31 N
ATOM 7147 CA GLN C 75 4.653 19.328 17.819 1.00 27.49 C
ATOM 7148 C GLN C 75 3.596 19.223 16.716 1.00 28.26 C
ATOM 7149 O GLN C 75 3.607 18.274 15.938 1.00 29.49 O
ATOM 7150 CB GLN C 75 6.018 19.489 17.175 1.00 31.55 C
ATOM 7151 CG GLN C 75 7.158 19.309 18.136 1.00 37.68 C
ATOM 7152 CD GLN C 75 7.033 20.259 19.304 1.00 41.76 C
ATOM 7153 OE1 GLN C 75 6.893 21.469 19.104 1.00 44.48 O
ATOM 7154 NE2 GLN C 75 7.084 19.725 20.534 1.00 42.97 N
ATOM 7155 N TYR C 76 2.702 20.201 16.646 1.00 27.11 N
ATOM 7156 CA TYR C 76 1.625 20.211 15.665 1.00 27.57 C
ATOM 7157 C TYR C 76 0.777 18.943 15.622 1.00 28.97 C
ATOM 7158 O TYR C 76 0.056 18.701 14.652 1.00 29.32 O
ATOM 7159 CB TYR C 76 2.174 20.516 14.286 1.00 27.79 C
ATOM 7160 CG TYR C 76 2.872 21.836 14.293 1.00 30.14 C
ATOM 7161 CD1 TYR C 76 4.265 21.898 14.393 1.00 28.69 C
ATOM 7162 CD2 TYR C 76 2.135 23.036 14.322 1.00 28.27 C
ATOM 7163 CE1 TYR C 76 4.917 23.109 14.529 1.00 31.13 C
ATOM 7164 CE2 TYR C 76 2.775 24.269 14.468 1.00 30.35 C
ATOM 7165 CZ TYR C 76 4.175 24.298 14.574 1.00 32.92 C
ATOM 7166 OH TYR C 76 4.843 25.497 14.764 1.00 34.01 O
ATOM 7167 N GLY C 77 0.857 18.139 16.676 1.00 28.77 N
ATOM 7168 CA GLY C 77 0.068 16.926 16.722 1.00 29.37 C
ATOM 7169 C GLY C 77 -1.413 17.266 16.621 1.00 30.66 C
ATOM 7170 O GLY C 77 -2.168 16.615 15.889 1.00 31.21 O
ATOM 7171 N TRP C 78 -1.834 18.296 17.351 1.00 29.62 N
ATOM 7172 CA TRP C 78 -3.231 18.696 17.334 1.00 28.73 C
ATOM 7173 C TRP C 78 -3.658 19.067 15.920 1.00 28.39 C
ATOM 7174 O TRP C 78 -4.739 18.692 15.461 1.00 28.45 O
ATOM 7175 CB TRP C 78 -3.476 19.889 18.287 1.00 26.50 C
ATOM 7176 CG TRP C 78 -2.749 21.122 17.899 1.00 23.64 C
ATOM 7177 CD1 TRP C 78 -1.487 21.484 18.267 1.00 23.46 C
ATOM 7178 CD2 TRP C 78 -3.204 22.125 16.985 1.00 23.34 C
ATOM 7179 NE1 TRP C 78 -1.119 22.653 17.637 1.00 21.15 N
ATOM 7180 CE2 TRP C 78 -2.155 23.067 16.842 1.00 23.02 C
ATOM 7181 CE3 TRP C 78 -4.398 22.318 16.269 1.00 22.05 C
ATOM 7182 CZ2 TRP C 78 -2.262 24.185 16.009 1.00 20.95 C
ATOM 7183 CZ3 TRP C 78 -4.503 23.424 15.445 1.00 23.54 C
ATOM 7184 CH2 TRP C 78 -3.433 24.350 15.322 1.00 21.73 C
ATOM 7185 N LEU C 79 -2.802 19.793 15.221 1.00 27.43 N
ATOM 7186 CA LEU C 79 -3.137 20.224 13.875 1.00 27.56 C
ATOM 7187 C LEU C 79 -3.299 19.045 12.930 1.00 28.44 C
ATOM 7188 O LEU C 79 -4.226 19.007 12.093 1.00 28.87 O
ATOM 7189 CB LEU C 79 -2.054 21.156 13.335 1.00 26.45 C
ATOM 7190 CG LEU C 79 -2.218 21.380 11.842 1.00 26.00 C
ATOM 7191 CD1 LEU C 79 -3.507 22.144 11.642 1.00 24.99 C
ATOM 7192 CD2 LEU C 79 -1.034 22.099 11.257 1.00 25.37 C
ATOM 7193 N ILE C 80 -2.371 18.098 13.043 1.00 27.62 N
ATOM 7194 CA ILE C 80 -2.394 16.923 12.194 1.00 25.65 C
ATOM 7195 C ILE C 80 -3.645 16.105 12.503 1.00 26.63 C
ATOM 7196 O ILE C 80 -4.294 15.588 11.603 1.00 26.41 O
ATOM 7197 CB ILE C 80 -1.114 16.113 12.392 1.00 23.91 C
ATOM 7198 CG1 ILE C 80 0.050 16.895 11.793 1.00 22.50 C
ATOM 7199 CG2 ILE C 80 -1.225 14.759 11.736 1.00 21.41 C
ATOM 7200 CD1 ILE C 80 1.415 16.356 12.200 1.00 27.02 C
ATOM 7201 N ARG C 81 -4.018 16.016 13.772 1.00 27.13 N
ATOM 7202 CA ARG C 81 -5.219 15.276 14.092 1.00 25.91 C
ATOM 7203 C ARG C 81 -6.446 15.963 13.494 1.00 26.92 C
ATOM 7204 O ARG C 81 -7.312 15.300 12.923 1.00 27.70 O
ATOM 7205 CB ARG C 81 -5.399 15.142 15.592 1.00 25.69 C
ATOM 7206 CG ARG C 81 -6.409 14.068 15.895 1.00 27.01 C
ATOM 7207 CD ARG C 81 -7.158 14.291 17.175 1.00 26.12 C
ATOM 7208 NE ARG C 81 -8.210 13.292 17.327 1.00 25.19 N
ATOM 7209 CZ ARG C 81 -8.910 13.120 18.439 1.00 26.40 C
ATOM 7210 NH1 ARG C 81 -8.676 13.891 19.500 1.00 25.73 N
ATOM 7211 NH2 ARG C 81 -9.831 12.167 18.497 1.00 26.64 N
ATOM 7212 N ASN C 82 -6.533 17.283 13.614 1.00 26.75 N
ATOM 7213 CA ASN C 82 -7.672 17.985 13.045 1.00 29.24 C
ATOM 7214 C ASN C 82 -7.723 17.741 11.543 1.00 29.79 C
ATOM 7215 O ASN C 82 -8.787 17.461 10.990 1.00 30.37 O
ATOM 7216 CB ASN C 82 -7.601 19.501 13.307 1.00 33.07 C
ATOM 7217 CG ASN C 82 -7.743 19.854 14.787 1.00 41.08 C
ATOM 7218 OD1 ASN C 82 -7.717 21.034 15.162 1.00 45.25 O
ATOM 7219 ND2 ASN C 82 -7.892 18.832 15.640 1.00 44.01 N
ATOM 7220 N LEU C 83 -6.579 17.853 10.873 1.00 29.35 N
ATOM 7221 CA LEU C 83 -6.568 17.650 9.438 1.00 29.17 C
ATOM 7222 C LEU C 83 -7.014 16.238 9.087 1.00 29.13 C
ATOM 7223 O LEU C 83 -7.698 16.031 8.085 1.00 29.71 O
ATOM 7224 CB LEU C 83 -5.181 17.934 8.868 1.00 29.68 C
ATOM 7225 CG LEU C 83 -4.714 19.391 9.002 1.00 30.75 C
ATOM 7226 CD1 LEU C 83 -3.270 19.503 8.533 1.00 30.53 C
ATOM 7227 CD2 LEU C 83 -5.605 20.302 8.175 1.00 27.42 C
ATOM 7228 N HIS C 84 -6.667 15.257 9.914 1.00 28.56 N
ATOM 7229 CA HIS C 84 -7.065 13.890 9.603 1.00 28.26 C
ATOM 7230 C HIS C 84 -8.563 13.700 9.844 1.00 27.35 C
ATOM 7231 O HIS C 84 -9.291 13.193 8.986 1.00 26.52 O
ATOM 7232 CB HIS C 84 -6.256 12.884 10.437 1.00 28.48 C
ATOM 7233 CG HIS C 84 -6.332 11.477 9.923 1.00 30.04 C
ATOM 7234 ND1 HIS C 84 -5.738 11.091 8.738 1.00 30.24 N
ATOM 7235 CD2 HIS C 84 -6.949 10.369 10.414 1.00 29.04 C
ATOM 7236 CE1 HIS C 84 -5.983 9.809 8.521 1.00 29.68 C
ATOM 7237 NE2 HIS C 84 -6.716 9.344 9.521 1.00 29.39 N
ATOM 7238 N ALA C 85 -9.032 14.111 11.013 1.00 27.22 N
ATOM 7239 CA ALA C 85 -10.450 13.970 11.328 1.00 27.03 C
ATOM 7240 C ALA C 85 -11.322 14.713 10.321 1.00 27.30 C
ATOM 7241 O ALA C 85 -12.267 14.150 9.766 1.00 28.86 O
ATOM 7242 CB ALA C 85 -10.723 14.481 12.713 1.00 25.13 C
ATOM 7243 N ASN C 86 -11.002 15.974 10.065 1.00 27.83 N
ATOM 7244 CA ASN C 86 -11.805 16.736 9.122 1.00 29.69 C
ATOM 7245 C ASN C 86 -11.615 16.328 7.675 1.00 30.13 C
ATOM 7246 O ASN C 86 -12.543 16.452 6.857 1.00 29.59 O
ATOM 7247 CB ASN C 86 -11.601 18.228 9.367 1.00 28.39 C
ATOM 7248 CG ASN C 86 -12.268 18.666 10.678 1.00 32.18 C
ATOM 7249 OD1 ASN C 86 -11.638 19.264 11.569 1.00 30.90 O
ATOM 7250 ND2 ASN C 86 -13.554 18.321 10.816 1.00 30.56 N
ATOM 7251 N GLY C 87 -10.427 15.794 7.377 1.00 30.26 N
ATOM 7252 CA GLY C 87 -10.140 15.305 6.041 1.00 27.32 C
ATOM 7253 C GLY C 87 -11.089 14.157 5.715 1.00 26.60 C
ATOM 7254 O GLY C 87 -11.532 14.009 4.562 1.00 27.49 O
ATOM 7255 N ALA C 88 -11.430 13.343 6.717 1.00 23.97 N
ATOM 7256 CA ALA C 88 -12.349 12.236 6.462 1.00 24.48 C
ATOM 7257 C ALA C 88 -13.690 12.765 5.952 1.00 26.23 C
ATOM 7258 O ALA C 88 -14.288 12.167 5.055 1.00 27.43 O
ATOM 7259 CB ALA C 88 -12.547 11.402 7.713 1.00 21.41 C
ATOM 7260 N SER C 89 -14.145 13.890 6.513 1.00 27.60 N
ATOM 7261 CA SER C 89 -15.405 14.527 6.113 1.00 27.67 C
ATOM 7262 C SER C 89 -15.355 15.090 4.701 1.00 27.48 C
ATOM 7263 O SER C 89 -16.280 14.879 3.918 1.00 27.87 O
ATOM 7264 CB SER C 89 -15.774 15.666 7.075 1.00 28.77 C
ATOM 7265 OG SER C 89 -16.549 15.193 8.164 1.00 31.24 O
ATOM 7266 N PHE C 90 -14.292 15.833 4.395 1.00 27.68 N
ATOM 7267 CA PHE C 90 -14.092 16.439 3.075 1.00 28.35 C
ATOM 7268 C PHE C 90 -14.078 15.283 2.076 1.00 26.97 C
ATOM 7269 O PHE C 90 -14.533 15.409 0.938 1.00 24.36 O
ATOM 7270 CB PHE C 90 -12.749 17.179 3.080 1.00 33.67 C
ATOM 7271 CG PHE C 90 -12.371 17.861 1.767 1.00 41.19 C
ATOM 7272 CD1 PHE C 90 -12.578 19.240 1.580 1.00 43.39 C
ATOM 7273 CD2 PHE C 90 -11.694 17.154 0.754 1.00 41.66 C
ATOM 7274 CE1 PHE C 90 -12.093 19.898 0.388 1.00 44.83 C
ATOM 7275 CE2 PHE C 90 -11.213 17.806 -0.427 1.00 41.97 C
ATOM 7276 CZ PHE C 90 -11.413 19.177 -0.603 1.00 40.93 C
ATOM 7277 N PHE C 91 -13.573 14.138 2.534 1.00 26.80 N
ATOM 7278 CA PHE C 91 -13.495 12.954 1.692 1.00 27.10 C
ATOM 7279 C PHE C 91 -14.908 12.515 1.308 1.00 26.65 C
ATOM 7280 O PHE C 91 -15.177 12.222 0.147 1.00 27.84 O
ATOM 7281 CB PHE C 91 -12.751 11.820 2.424 1.00 26.93 C
ATOM 7282 CG PHE C 91 -12.019 10.862 1.500 1.00 24.31 C
ATOM 7283 CD1 PHE C 91 -12.613 10.391 0.339 1.00 23.67 C
ATOM 7284 CD2 PHE C 91 -10.736 10.428 1.807 1.00 23.60 C
ATOM 7285 CE1 PHE C 91 -11.940 9.506 -0.501 1.00 22.65 C
ATOM 7286 CE2 PHE C 91 -10.061 9.545 0.970 1.00 22.70 C
ATOM 7287 CZ PHE C 91 -10.665 9.084 -0.181 1.00 20.91 C
ATOM 7288 N PHE C 92 -15.811 12.470 2.281 1.00 27.05 N
ATOM 7289 CA PHE C 92 -17.197 12.090 1.994 1.00 26.92 C
ATOM 7290 C PHE C 92 -17.971 13.175 1.224 1.00 27.27 C
ATOM 7291 O PHE C 92 -18.769 12.863 0.334 1.00 26.42 O
ATOM 7292 CB PHE C 92 -17.925 11.734 3.283 1.00 25.50 C
ATOM 7293 CG PHE C 92 -17.593 10.375 3.787 1.00 23.43 C
ATOM 7294 CD1 PHE C 92 -16.589 10.190 4.728 1.00 23.82 C
ATOM 7295 CD2 PHE C 92 -18.228 9.261 3.250 1.00 22.55 C
ATOM 7296 CE1 PHE C 92 -16.222 8.901 5.123 1.00 25.89 C
ATOM 7297 CE2 PHE C 92 -17.871 7.974 3.628 1.00 21.87 C
ATOM 7298 CZ PHE C 92 -16.871 7.785 4.561 1.00 24.04 C
ATOM 7299 N ILE C 93 -17.735 14.444 1.555 1.00 25.69 N
ATOM 7300 CA ILE C 93 -18.414 15.504 0.831 1.00 25.14 C
ATOM 7301 C ILE C 93 -18.057 15.321 -0.631 1.00 25.55 C
ATOM 7302 O ILE C 93 -18.930 15.302 -1.494 1.00 25.05 O
ATOM 7303 CB ILE C 93 -17.969 16.922 1.296 1.00 24.71 C
ATOM 7304 CG1 ILE C 93 -18.475 17.178 2.721 1.00 25.28 C
ATOM 7305 CG2 ILE C 93 -18.543 17.973 0.374 1.00 17.14 C
ATOM 7306 CD1 ILE C 93 -18.047 18.522 3.344 1.00 24.83 C
ATOM 7307 N CYS C 94 -16.767 15.167 -0.908 1.00 25.51 N
ATOM 7308 CA CYS C 94 -16.324 14.989 -2.278 1.00 26.04 C
ATOM 7309 C CYS C 94 -16.824 13.706 -2.914 1.00 26.56 C
ATOM 7310 O CYS C 94 -17.127 13.690 -4.106 1.00 27.96 O
ATOM 7311 CB CYS C 94 -14.803 15.007 -2.360 1.00 27.70 C
ATOM 7312 SG CYS C 94 -14.049 16.587 -1.943 1.00 33.26 S
ATOM 7313 N ILE C 95 -16.914 12.617 -2.156 1.00 25.75 N
ATOM 7314 CA ILE C 95 -17.375 11.397 -2.800 1.00 24.71 C
ATOM 7315 C ILE C 95 -18.856 11.509 -3.123 1.00 24.88 C
ATOM 7316 O ILE C 95 -19.295 11.033 -4.174 1.00 25.98 O
ATOM 7317 CB ILE C 95 -17.073 10.104 -1.963 1.00 25.38 C
ATOM 7318 CG1 ILE C 95 -16.877 8.940 -2.925 1.00 23.38 C
ATOM 7319 CG2 ILE C 95 -18.221 9.761 -1.014 1.00 23.78 C
ATOM 7320 CD1 ILE C 95 -16.583 7.651 -2.263 1.00 27.17 C
ATOM 7321 N PHE C 96 -19.623 12.162 -2.250 1.00 23.29 N
ATOM 7322 CA PHE C 96 -21.055 12.337 -2.508 1.00 22.83 C
ATOM 7323 C PHE C 96 -21.334 13.194 -3.739 1.00 21.34 C
ATOM 7324 O PHE C 96 -22.202 12.868 -4.543 1.00 22.28 O
ATOM 7325 CB PHE C 96 -21.756 12.947 -1.297 1.00 23.48 C
ATOM 7326 CG PHE C 96 -21.850 12.017 -0.127 1.00 25.56 C
ATOM 7327 CD1 PHE C 96 -21.950 10.640 -0.323 1.00 26.81 C
ATOM 7328 CD2 PHE C 96 -21.880 12.511 1.170 1.00 26.11 C
ATOM 7329 CE1 PHE C 96 -22.083 9.770 0.766 1.00 27.35 C
ATOM 7330 CE2 PHE C 96 -22.014 11.654 2.263 1.00 26.46 C
ATOM 7331 CZ PHE C 96 -22.118 10.285 2.060 1.00 26.31 C
ATOM 7332 N LEU C 97 -20.606 14.291 -3.885 1.00 20.90 N
ATOM 7333 CA LEU C 97 -20.780 15.153 -5.045 1.00 20.63 C
ATOM 7334 C LEU C 97 -20.300 14.433 -6.313 1.00 22.29 C
ATOM 7335 O LEU C 97 -20.882 14.631 -7.388 1.00 22.16 O
ATOM 7336 CB LEU C 97 -20.016 16.471 -4.845 1.00 20.98 C
ATOM 7337 CG LEU C 97 -20.454 17.333 -3.629 1.00 21.67 C
ATOM 7338 CD1 LEU C 97 -19.609 18.590 -3.536 1.00 20.28 C
ATOM 7339 CD2 LEU C 97 -21.917 17.725 -3.748 1.00 18.97 C
ATOM 7340 N HIS C 98 -19.268 13.579 -6.183 1.00 21.96 N
ATOM 7341 CA HIS C 98 -18.702 12.826 -7.315 1.00 20.97 C
ATOM 7342 C HIS C 98 -19.792 11.875 -7.806 1.00 20.55 C
ATOM 7343 O HIS C 98 -20.027 11.750 -9.016 1.00 21.50 O
ATOM 7344 CB HIS C 98 -17.438 12.063 -6.847 1.00 23.66 C
ATOM 7345 CG HIS C 98 -16.666 11.335 -7.931 1.00 25.12 C
ATOM 7346 ND1 HIS C 98 -15.965 11.986 -8.928 1.00 24.85 N
ATOM 7347 CD2 HIS C 98 -16.351 10.021 -8.064 1.00 24.67 C
ATOM 7348 CE1 HIS C 98 -15.245 11.110 -9.613 1.00 23.47 C
ATOM 7349 NE2 HIS C 98 -15.454 9.902 -9.109 1.00 25.41 N
ATOM 7350 N ILE C 99 -20.484 11.238 -6.864 1.00 19.78 N
ATOM 7351 CA ILE C 99 -21.556 10.295 -7.196 1.00 18.59 C
ATOM 7352 C ILE C 99 -22.732 11.035 -7.826 1.00 19.09 C
ATOM 7353 O ILE C 99 -23.287 10.603 -8.854 1.00 16.96 O
ATOM 7354 CB ILE C 99 -22.020 9.539 -5.938 1.00 18.61 C
ATOM 7355 CG1 ILE C 99 -20.871 8.687 -5.400 1.00 18.25 C
ATOM 7356 CG2 ILE C 99 -23.154 8.616 -6.261 1.00 16.27 C
ATOM 7357 CD1 ILE C 99 -21.173 8.065 -4.067 1.00 18.67 C
ATOM 7358 N GLY C 100 -23.088 12.164 -7.213 1.00 20.17 N
ATOM 7359 CA GLY C 100 -24.177 12.997 -7.709 1.00 22.38 C
ATOM 7360 C GLY C 100 -23.971 13.368 -9.162 1.00 23.45 C
ATOM 7361 O GLY C 100 -24.869 13.200 -9.990 1.00 24.49 O
ATOM 7362 N ARG C 101 -22.783 13.890 -9.460 1.00 24.62 N
ATOM 7363 CA ARG C 101 -22.395 14.236 -10.822 1.00 24.86 C
ATOM 7364 C ARG C 101 -22.573 12.984 -11.686 1.00 25.36 C
ATOM 7365 O ARG C 101 -23.121 13.049 -12.781 1.00 27.79 O
ATOM 7366 CB ARG C 101 -20.917 14.669 -10.846 1.00 24.94 C
ATOM 7367 CG ARG C 101 -20.303 14.920 -12.227 1.00 27.02 C
ATOM 7368 CD ARG C 101 -20.140 13.643 -13.069 1.00 31.70 C
ATOM 7369 NE ARG C 101 -19.219 12.684 -12.458 1.00 36.21 N
ATOM 7370 CZ ARG C 101 -17.895 12.795 -12.493 1.00 37.46 C
ATOM 7371 NH1 ARG C 101 -17.336 13.827 -13.114 1.00 41.18 N
ATOM 7372 NH2 ARG C 101 -17.130 11.882 -11.911 1.00 36.16 N
ATOM 7373 N GLY C 102 -22.112 11.844 -11.190 1.00 24.04 N
ATOM 7374 CA GLY C 102 -22.218 10.628 -11.970 1.00 27.07 C
ATOM 7375 C GLY C 102 -23.619 10.234 -12.386 1.00 28.41 C
ATOM 7376 O GLY C 102 -23.866 9.859 -13.552 1.00 26.71 O
ATOM 7377 N LEU C 103 -24.538 10.309 -11.422 1.00 29.22 N
ATOM 7378 CA LEU C 103 -25.932 9.958 -11.658 1.00 29.02 C
ATOM 7379 C LEU C 103 -26.588 10.948 -12.606 1.00 30.39 C
ATOM 7380 O LEU C 103 -27.295 10.569 -13.540 1.00 32.36 O
ATOM 7381 CB LEU C 103 -26.681 9.939 -10.335 1.00 28.29 C
ATOM 7382 CG LEU C 103 -28.205 9.839 -10.378 1.00 29.82 C
ATOM 7383 CD1 LEU C 103 -28.638 8.524 -10.990 1.00 29.21 C
ATOM 7384 CD2 LEU C 103 -28.750 9.969 -8.963 1.00 28.91 C
ATOM 7385 N TYR C 104 -26.334 12.227 -12.374 1.00 30.41 N
ATOM 7386 CA TYR C 104 -26.926 13.272 -13.194 1.00 29.80 C
ATOM 7387 C TYR C 104 -26.490 13.227 -14.647 1.00 30.09 C
ATOM 7388 O TYR C 104 -27.306 13.382 -15.564 1.00 30.47 O
ATOM 7389 CB TYR C 104 -26.559 14.631 -12.626 1.00 30.22 C
ATOM 7390 CG TYR C 104 -27.364 15.772 -13.186 1.00 30.78 C
ATOM 7391 CD1 TYR C 104 -28.608 16.101 -12.648 1.00 32.17 C
ATOM 7392 CD2 TYR C 104 -26.879 16.536 -14.240 1.00 30.82 C
ATOM 7393 CE1 TYR C 104 -29.350 17.168 -13.144 1.00 32.59 C
ATOM 7394 CE2 TYR C 104 -27.608 17.606 -14.744 1.00 33.74 C
ATOM 7395 CZ TYR C 104 -28.843 17.920 -14.195 1.00 34.10 C
ATOM 7396 OH TYR C 104 -29.567 18.983 -14.702 1.00 35.39 O
ATOM 7397 N TYR C 105 -25.199 13.041 -14.867 1.00 28.18 N
ATOM 7398 CA TYR C 105 -24.700 13.030 -16.228 1.00 27.32 C
ATOM 7399 C TYR C 105 -24.590 11.655 -16.871 1.00 26.93 C
ATOM 7400 O TYR C 105 -24.011 11.515 -17.942 1.00 27.52 O
ATOM 7401 CB TYR C 105 -23.371 13.769 -16.281 1.00 22.88 C
ATOM 7402 CG TYR C 105 -23.542 15.213 -15.920 1.00 23.65 C
ATOM 7403 CD1 TYR C 105 -23.260 15.679 -14.621 1.00 25.27 C
ATOM 7404 CD2 TYR C 105 -24.004 16.133 -16.869 1.00 22.05 C
ATOM 7405 CE1 TYR C 105 -23.426 17.051 -14.281 1.00 23.74 C
ATOM 7406 CE2 TYR C 105 -24.185 17.488 -16.551 1.00 21.33 C
ATOM 7407 CZ TYR C 105 -23.890 17.948 -15.264 1.00 24.62 C
ATOM 7408 OH TYR C 105 -24.016 19.300 -14.991 1.00 24.30 O
ATOM 7409 N GLY C 106 -25.148 10.647 -16.216 1.00 25.58 N
ATOM 7410 CA GLY C 106 -25.113 9.313 -16.775 1.00 24.35 C
ATOM 7411 C GLY C 106 -23.703 8.793 -16.954 1.00 25.47 C
ATOM 7412 O GLY C 106 -23.427 8.060 -17.908 1.00 22.75 O
ATOM 7413 N SER C 107 -22.808 9.180 -16.046 1.00 24.98 N
ATOM 7414 CA SER C 107 -21.433 8.724 -16.109 1.00 26.44 C
ATOM 7415 C SER C 107 -21.411 7.223 -15.873 1.00 27.69 C
ATOM 7416 O SER C 107 -20.475 6.524 -16.283 1.00 27.42 O
ATOM 7417 CB SER C 107 -20.604 9.401 -15.038 1.00 25.98 C
ATOM 7418 OG SER C 107 -20.630 10.784 -15.231 1.00 32.31 O
ATOM 7419 N TYR C 108 -22.459 6.730 -15.218 1.00 28.04 N
ATOM 7420 CA TYR C 108 -22.561 5.316 -14.909 1.00 28.96 C
ATOM 7421 C TYR C 108 -22.660 4.419 -16.119 1.00 28.65 C
ATOM 7422 O TYR C 108 -22.573 3.207 -15.976 1.00 30.82 O
ATOM 7423 CB TYR C 108 -23.747 5.049 -13.990 1.00 28.73 C
ATOM 7424 CG TYR C 108 -25.032 5.622 -14.490 1.00 27.70 C
ATOM 7425 CD1 TYR C 108 -25.713 5.032 -15.552 1.00 25.77 C
ATOM 7426 CD2 TYR C 108 -25.568 6.767 -13.895 1.00 29.69 C
ATOM 7427 CE1 TYR C 108 -26.908 5.565 -16.012 1.00 30.23 C
ATOM 7428 CE2 TYR C 108 -26.759 7.317 -14.339 1.00 31.87 C
ATOM 7429 CZ TYR C 108 -27.433 6.716 -15.393 1.00 32.64 C
ATOM 7430 OH TYR C 108 -28.649 7.247 -15.772 1.00 34.48 O
ATOM 7431 N LEU C 109 -22.863 4.989 -17.303 1.00 28.07 N
ATOM 7432 CA LEU C 109 -22.933 4.145 -18.482 1.00 28.19 C
ATOM 7433 C LEU C 109 -21.538 3.572 -18.766 1.00 29.84 C
ATOM 7434 O LEU C 109 -21.377 2.696 -19.616 1.00 30.36 O
ATOM 7435 CB LEU C 109 -23.488 4.906 -19.683 1.00 26.25 C
ATOM 7436 CG LEU C 109 -24.990 5.198 -19.594 1.00 26.15 C
ATOM 7437 CD1 LEU C 109 -25.515 5.583 -20.991 1.00 25.25 C
ATOM 7438 CD2 LEU C 109 -25.736 3.983 -19.084 1.00 24.44 C
ATOM 7439 N TYR C 110 -20.529 4.087 -18.061 1.00 28.85 N
ATOM 7440 CA TYR C 110 -19.183 3.548 -18.160 1.00 28.47 C
ATOM 7441 C TYR C 110 -19.211 2.547 -17.016 1.00 30.68 C
ATOM 7442 O TYR C 110 -18.635 2.794 -15.957 1.00 33.33 O
ATOM 7443 CB TYR C 110 -18.131 4.593 -17.831 1.00 28.01 C
ATOM 7444 CG TYR C 110 -17.948 5.665 -18.869 1.00 27.58 C
ATOM 7445 CD1 TYR C 110 -18.168 5.398 -20.211 1.00 24.58 C
ATOM 7446 CD2 TYR C 110 -17.487 6.930 -18.511 1.00 26.12 C
ATOM 7447 CE1 TYR C 110 -17.945 6.357 -21.168 1.00 25.72 C
ATOM 7448 CE2 TYR C 110 -17.247 7.897 -19.460 1.00 27.44 C
ATOM 7449 CZ TYR C 110 -17.487 7.610 -20.791 1.00 28.19 C
ATOM 7450 OH TYR C 110 -17.350 8.599 -21.737 1.00 27.73 O
ATOM 7451 N LYS C 111 -19.901 1.432 -17.223 1.00 31.19 N
ATOM 7452 CA LYS C 111 -20.069 0.412 -16.195 1.00 33.29 C
ATOM 7453 C LYS C 111 -18.891 -0.037 -15.313 1.00 32.55 C
ATOM 7454 O LYS C 111 -19.062 -0.205 -14.098 1.00 30.90 O
ATOM 7455 CB LYS C 111 -20.730 -0.812 -16.818 1.00 36.94 C
ATOM 7456 CG LYS C 111 -22.158 -0.577 -17.273 1.00 40.38 C
ATOM 7457 CD LYS C 111 -22.759 -1.883 -17.769 1.00 47.09 C
ATOM 7458 CE LYS C 111 -24.284 -1.802 -17.890 1.00 53.32 C
ATOM 7459 NZ LYS C 111 -24.747 -0.662 -18.767 1.00 57.64 N
ATOM 7460 N GLU C 112 -17.707 -0.235 -15.883 1.00 32.51 N
ATOM 7461 CA GLU C 112 -16.583 -0.680 -15.057 1.00 33.62 C
ATOM 7462 C GLU C 112 -16.049 0.428 -14.198 1.00 32.64 C
ATOM 7463 O GLU C 112 -15.636 0.205 -13.050 1.00 32.44 O
ATOM 7464 CB GLU C 112 -15.450 -1.253 -15.904 1.00 37.34 C
ATOM 7465 CG GLU C 112 -15.845 -2.509 -16.659 1.00 46.56 C
ATOM 7466 CD GLU C 112 -16.192 -2.243 -18.123 1.00 53.70 C
ATOM 7467 OE1 GLU C 112 -16.947 -1.264 -18.409 1.00 54.80 O
ATOM 7468 OE2 GLU C 112 -15.701 -3.030 -18.981 1.00 57.89 O
ATOM 7469 N THR C 113 -16.049 1.633 -14.751 1.00 31.66 N
ATOM 7470 CA THR C 113 -15.575 2.772 -13.992 1.00 30.62 C
ATOM 7471 C THR C 113 -16.564 2.974 -12.858 1.00 30.29 C
ATOM 7472 O THR C 113 -16.180 3.235 -11.720 1.00 31.19 O
ATOM 7473 CB THR C 113 -15.498 4.025 -14.856 1.00 30.89 C
ATOM 7474 OG1 THR C 113 -14.575 3.799 -15.927 1.00 30.13 O
ATOM 7475 CG2 THR C 113 -15.017 5.205 -14.029 1.00 30.96 C
ATOM 7476 N TRP C 114 -17.845 2.828 -13.160 1.00 29.06 N
ATOM 7477 CA TRP C 114 -18.857 2.984 -12.131 1.00 27.60 C
ATOM 7478 C TRP C 114 -18.733 1.906 -11.058 1.00 28.33 C
ATOM 7479 O TRP C 114 -18.596 2.220 -9.884 1.00 29.39 O
ATOM 7480 CB TRP C 114 -20.246 2.962 -12.763 1.00 25.97 C
ATOM 7481 CG TRP C 114 -21.372 3.154 -11.798 1.00 25.50 C
ATOM 7482 CD1 TRP C 114 -22.131 2.177 -11.220 1.00 25.33 C
ATOM 7483 CD2 TRP C 114 -21.883 4.402 -11.302 1.00 27.19 C
ATOM 7484 NE1 TRP C 114 -23.082 2.734 -10.401 1.00 25.49 N
ATOM 7485 CE2 TRP C 114 -22.951 4.099 -10.429 1.00 26.35 C
ATOM 7486 CE3 TRP C 114 -21.541 5.749 -11.511 1.00 29.25 C
ATOM 7487 CZ2 TRP C 114 -23.683 5.092 -9.759 1.00 25.86 C
ATOM 7488 CZ3 TRP C 114 -22.273 6.738 -10.843 1.00 28.38 C
ATOM 7489 CH2 TRP C 114 -23.332 6.399 -9.979 1.00 26.08 C
ATOM 7490 N ASN C 115 -18.763 0.634 -11.446 1.00 29.54 N
ATOM 7491 CA ASN C 115 -18.680 -0.440 -10.457 1.00 29.47 C
ATOM 7492 C ASN C 115 -17.471 -0.359 -9.540 1.00 29.51 C
ATOM 7493 O ASN C 115 -17.594 -0.536 -8.315 1.00 30.77 O
ATOM 7494 CB ASN C 115 -18.729 -1.805 -11.134 1.00 30.51 C
ATOM 7495 CG ASN C 115 -20.103 -2.116 -11.703 1.00 32.83 C
ATOM 7496 OD1 ASN C 115 -21.119 -1.610 -11.227 1.00 34.17 O
ATOM 7497 ND2 ASN C 115 -20.140 -2.954 -12.720 1.00 35.89 N
ATOM 7498 N THR C 116 -16.299 -0.104 -10.105 1.00 28.03 N
ATOM 7499 CA THR C 116 -15.127 0.021 -9.249 1.00 27.87 C
ATOM 7500 C THR C 116 -15.358 1.247 -8.357 1.00 27.86 C
ATOM 7501 O THR C 116 -14.880 1.321 -7.216 1.00 28.33 O
ATOM 7502 CB THR C 116 -13.844 0.217 -10.072 1.00 27.41 C
ATOM 7503 OG1 THR C 116 -14.038 1.255 -11.032 1.00 27.76 O
ATOM 7504 CG2 THR C 116 -13.501 -1.028 -10.798 1.00 26.82 C
ATOM 7505 N GLY C 117 -16.095 2.212 -8.898 1.00 27.10 N
ATOM 7506 CA GLY C 117 -16.403 3.410 -8.151 1.00 24.57 C
ATOM 7507 C GLY C 117 -17.169 3.006 -6.912 1.00 24.96 C
ATOM 7508 O GLY C 117 -16.891 3.504 -5.823 1.00 26.86 O
ATOM 7509 N VAL C 118 -18.130 2.096 -7.051 1.00 25.07 N
ATOM 7510 CA VAL C 118 -18.886 1.661 -5.876 1.00 25.11 C
ATOM 7511 C VAL C 118 -17.981 0.884 -4.918 1.00 27.42 C
ATOM 7512 O VAL C 118 -18.111 1.013 -3.697 1.00 29.71 O
ATOM 7513 CB VAL C 118 -20.104 0.795 -6.251 1.00 23.84 C
ATOM 7514 CG1 VAL C 118 -20.945 0.515 -5.011 1.00 19.61 C
ATOM 7515 CG2 VAL C 118 -20.934 1.504 -7.319 1.00 21.49 C
ATOM 7516 N ILE C 119 -17.067 0.074 -5.447 1.00 26.88 N
ATOM 7517 CA ILE C 119 -16.160 -0.654 -4.555 1.00 25.68 C
ATOM 7518 C ILE C 119 -15.378 0.400 -3.743 1.00 25.32 C
ATOM 7519 O ILE C 119 -15.176 0.264 -2.527 1.00 24.32 O
ATOM 7520 CB ILE C 119 -15.140 -1.539 -5.345 1.00 27.29 C
ATOM 7521 CG1 ILE C 119 -15.859 -2.632 -6.133 1.00 26.80 C
ATOM 7522 CG2 ILE C 119 -14.151 -2.177 -4.392 1.00 25.26 C
ATOM 7523 CD1 ILE C 119 -16.744 -3.496 -5.277 1.00 29.73 C
ATOM 7524 N LEU C 120 -14.939 1.457 -4.417 1.00 23.88 N
ATOM 7525 CA LEU C 120 -14.199 2.501 -3.721 1.00 24.13 C
ATOM 7526 C LEU C 120 -15.022 3.081 -2.572 1.00 25.44 C
ATOM 7527 O LEU C 120 -14.511 3.243 -1.454 1.00 26.44 O
ATOM 7528 CB LEU C 120 -13.782 3.601 -4.699 1.00 22.36 C
ATOM 7529 CG LEU C 120 -12.567 3.270 -5.581 1.00 20.45 C
ATOM 7530 CD1 LEU C 120 -12.579 4.134 -6.795 1.00 16.38 C
ATOM 7531 CD2 LEU C 120 -11.271 3.468 -4.798 1.00 18.19 C
ATOM 7532 N LEU C 121 -16.300 3.367 -2.827 1.00 24.77 N
ATOM 7533 CA LEU C 121 -17.169 3.911 -1.781 1.00 24.19 C
ATOM 7534 C LEU C 121 -17.183 2.957 -0.594 1.00 24.34 C
ATOM 7535 O LEU C 121 -16.836 3.334 0.520 1.00 25.32 O
ATOM 7536 CB LEU C 121 -18.591 4.097 -2.310 1.00 23.68 C
ATOM 7537 CG LEU C 121 -19.667 4.585 -1.327 1.00 22.84 C
ATOM 7538 CD1 LEU C 121 -19.238 5.889 -0.697 1.00 19.73 C
ATOM 7539 CD2 LEU C 121 -20.994 4.770 -2.077 1.00 20.65 C
ATOM 7540 N LEU C 122 -17.583 1.721 -0.844 1.00 24.44 N
ATOM 7541 CA LEU C 122 -17.610 0.687 0.184 1.00 25.41 C
ATOM 7542 C LEU C 122 -16.308 0.609 0.983 1.00 25.07 C
ATOM 7543 O LEU C 122 -16.320 0.550 2.224 1.00 24.45 O
ATOM 7544 CB LEU C 122 -17.869 -0.671 -0.464 1.00 26.72 C
ATOM 7545 CG LEU C 122 -19.282 -0.801 -1.023 1.00 28.36 C
ATOM 7546 CD1 LEU C 122 -19.408 -2.094 -1.764 1.00 30.01 C
ATOM 7547 CD2 LEU C 122 -20.281 -0.741 0.126 1.00 27.17 C
ATOM 7548 N THR C 123 -15.176 0.604 0.286 1.00 24.21 N
ATOM 7549 CA THR C 123 -13.898 0.526 0.991 1.00 23.78 C
ATOM 7550 C THR C 123 -13.675 1.770 1.835 1.00 24.19 C
ATOM 7551 O THR C 123 -13.199 1.674 2.968 1.00 23.76 O
ATOM 7552 CB THR C 123 -12.740 0.332 0.005 1.00 23.97 C
ATOM 7553 OG1 THR C 123 -12.973 -0.866 -0.727 1.00 24.85 O
ATOM 7554 CG2 THR C 123 -11.409 0.186 0.716 1.00 22.17 C
ATOM 7555 N LEU C 124 -14.020 2.939 1.298 1.00 24.41 N
ATOM 7556 CA LEU C 124 -13.855 4.162 2.078 1.00 23.94 C
ATOM 7557 C LEU C 124 -14.698 4.073 3.348 1.00 23.09 C
ATOM 7558 O LEU C 124 -14.283 4.502 4.414 1.00 21.56 O
ATOM 7559 CB LEU C 124 -14.267 5.393 1.273 1.00 23.05 C
ATOM 7560 CG LEU C 124 -14.298 6.677 2.106 1.00 24.42 C
ATOM 7561 CD1 LEU C 124 -12.877 7.053 2.581 1.00 25.50 C
ATOM 7562 CD2 LEU C 124 -14.896 7.784 1.285 1.00 24.16 C
ATOM 7563 N MET C 125 -15.886 3.493 3.232 1.00 25.22 N
ATOM 7564 CA MET C 125 -16.772 3.364 4.384 1.00 27.44 C
ATOM 7565 C MET C 125 -16.140 2.506 5.456 1.00 27.04 C
ATOM 7566 O MET C 125 -16.087 2.884 6.627 1.00 27.63 O
ATOM 7567 CB MET C 125 -18.107 2.769 3.954 1.00 30.43 C
ATOM 7568 CG MET C 125 -18.908 3.717 3.082 1.00 36.03 C
ATOM 7569 SD MET C 125 -20.441 2.966 2.493 1.00 46.29 S
ATOM 7570 CE MET C 125 -21.600 3.291 4.016 1.00 48.97 C
ATOM 7571 N ALA C 126 -15.643 1.346 5.059 1.00 27.18 N
ATOM 7572 CA ALA C 126 -15.006 0.458 6.019 1.00 26.05 C
ATOM 7573 C ALA C 126 -13.866 1.194 6.695 1.00 26.82 C
ATOM 7574 O ALA C 126 -13.726 1.158 7.918 1.00 28.44 O
ATOM 7575 CB ALA C 126 -14.476 -0.764 5.314 1.00 23.58 C
ATOM 7576 N THR C 127 -13.063 1.882 5.889 1.00 25.27 N
ATOM 7577 CA THR C 127 -11.911 2.599 6.396 1.00 24.79 C
ATOM 7578 C THR C 127 -12.300 3.617 7.462 1.00 25.13 C
ATOM 7579 O THR C 127 -11.741 3.626 8.571 1.00 23.03 O
ATOM 7580 CB THR C 127 -11.154 3.317 5.241 1.00 26.53 C
ATOM 7581 OG1 THR C 127 -10.694 2.348 4.276 1.00 24.76 O
ATOM 7582 CG2 THR C 127 -9.974 4.103 5.786 1.00 22.21 C
ATOM 7583 N ALA C 128 -13.253 4.477 7.122 1.00 24.52 N
ATOM 7584 CA ALA C 128 -13.718 5.508 8.049 1.00 25.55 C
ATOM 7585 C ALA C 128 -14.241 4.857 9.336 1.00 26.24 C
ATOM 7586 O ALA C 128 -13.995 5.345 10.457 1.00 24.11 O
ATOM 7587 CB ALA C 128 -14.819 6.341 7.398 1.00 24.65 C
ATOM 7588 N PHE C 129 -14.961 3.752 9.178 1.00 25.00 N
ATOM 7589 CA PHE C 129 -15.486 3.076 10.343 1.00 26.46 C
ATOM 7590 C PHE C 129 -14.377 2.582 11.277 1.00 25.70 C
ATOM 7591 O PHE C 129 -14.315 2.997 12.431 1.00 26.72 O
ATOM 7592 CB PHE C 129 -16.387 1.906 9.927 1.00 27.78 C
ATOM 7593 CG PHE C 129 -16.771 1.004 11.069 1.00 29.61 C
ATOM 7594 CD1 PHE C 129 -17.347 1.528 12.233 1.00 29.54 C
ATOM 7595 CD2 PHE C 129 -16.522 -0.367 11.001 1.00 27.77 C
ATOM 7596 CE1 PHE C 129 -17.662 0.693 13.317 1.00 30.52 C
ATOM 7597 CE2 PHE C 129 -16.839 -1.200 12.076 1.00 29.79 C
ATOM 7598 CZ PHE C 129 -17.408 -0.670 13.238 1.00 28.83 C
ATOM 7599 N VAL C 130 -13.497 1.709 10.801 1.00 25.04 N
ATOM 7600 CA VAL C 130 -12.446 1.199 11.691 1.00 26.00 C
ATOM 7601 C VAL C 130 -11.574 2.319 12.238 1.00 25.58 C
ATOM 7602 O VAL C 130 -11.059 2.224 13.353 1.00 26.06 O
ATOM 7603 CB VAL C 130 -11.536 0.096 11.004 1.00 25.69 C
ATOM 7604 CG1 VAL C 130 -12.358 -1.143 10.724 1.00 22.73 C
ATOM 7605 CG2 VAL C 130 -10.919 0.611 9.715 1.00 23.76 C
ATOM 7606 N GLY C 131 -11.427 3.383 11.455 1.00 25.92 N
ATOM 7607 CA GLY C 131 -10.617 4.510 11.879 1.00 26.41 C
ATOM 7608 C GLY C 131 -11.267 5.268 13.013 1.00 27.06 C
ATOM 7609 O GLY C 131 -10.611 5.621 13.995 1.00 26.25 O
ATOM 7610 N TYR C 132 -12.569 5.507 12.872 1.00 28.49 N
ATOM 7611 CA TYR C 132 -13.349 6.228 13.874 1.00 27.47 C
ATOM 7612 C TYR C 132 -13.319 5.555 15.240 1.00 26.64 C
ATOM 7613 O TYR C 132 -13.432 6.230 16.267 1.00 26.42 O
ATOM 7614 CB TYR C 132 -14.803 6.355 13.440 1.00 27.19 C
ATOM 7615 CG TYR C 132 -15.594 7.207 14.391 1.00 28.18 C
ATOM 7616 CD1 TYR C 132 -15.340 8.572 14.484 1.00 29.06 C
ATOM 7617 CD2 TYR C 132 -16.586 6.664 15.207 1.00 26.70 C
ATOM 7618 CE1 TYR C 132 -16.036 9.374 15.348 1.00 27.62 C
ATOM 7619 CE2 TYR C 132 -17.301 7.465 16.090 1.00 28.00 C
ATOM 7620 CZ TYR C 132 -17.012 8.831 16.155 1.00 30.95 C
ATOM 7621 OH TYR C 132 -17.650 9.678 17.051 1.00 35.32 O
ATOM 7622 N VAL C 133 -13.159 4.237 15.247 1.00 24.90 N
ATOM 7623 CA VAL C 133 -13.127 3.477 16.494 1.00 25.99 C
ATOM 7624 C VAL C 133 -11.840 3.606 17.310 1.00 27.09 C
ATOM 7625 O VAL C 133 -11.859 3.432 18.528 1.00 27.58 O
ATOM 7626 CB VAL C 133 -13.348 1.972 16.215 1.00 25.40 C
ATOM 7627 CG1 VAL C 133 -13.261 1.175 17.510 1.00 23.24 C
ATOM 7628 CG2 VAL C 133 -14.702 1.772 15.530 1.00 26.05 C
ATOM 7629 N LEU C 134 -10.733 3.936 16.645 1.00 27.61 N
ATOM 7630 CA LEU C 134 -9.419 4.002 17.292 1.00 26.86 C
ATOM 7631 C LEU C 134 -9.236 4.900 18.506 1.00 28.32 C
ATOM 7632 O LEU C 134 -8.616 4.497 19.479 1.00 29.11 O
ATOM 7633 CB LEU C 134 -8.339 4.326 16.245 1.00 26.43 C
ATOM 7634 CG LEU C 134 -8.230 3.424 14.991 1.00 23.99 C
ATOM 7635 CD1 LEU C 134 -7.103 3.923 14.104 1.00 22.33 C
ATOM 7636 CD2 LEU C 134 -7.969 1.998 15.370 1.00 20.86 C
ATOM 7637 N PRO C 135 -9.748 6.138 18.466 1.00 31.19 N
ATOM 7638 CA PRO C 135 -9.577 7.014 19.637 1.00 29.27 C
ATOM 7639 C PRO C 135 -10.197 6.420 20.879 1.00 28.12 C
ATOM 7640 O PRO C 135 -9.862 6.794 22.001 1.00 29.58 O
ATOM 7641 CB PRO C 135 -10.218 8.326 19.193 1.00 30.21 C
ATOM 7642 CG PRO C 135 -11.150 7.901 18.079 1.00 32.04 C
ATOM 7643 CD PRO C 135 -10.389 6.858 17.353 1.00 30.65 C
ATOM 7644 N TRP C 136 -11.134 5.503 20.678 1.00 27.50 N
ATOM 7645 CA TRP C 136 -11.727 4.787 21.797 1.00 26.19 C
ATOM 7646 C TRP C 136 -12.460 5.643 22.842 1.00 26.54 C
ATOM 7647 O TRP C 136 -12.284 5.466 24.057 1.00 23.22 O
ATOM 7648 CB TRP C 136 -10.627 3.951 22.468 1.00 23.14 C
ATOM 7649 CG TRP C 136 -11.078 2.690 23.119 1.00 22.01 C
ATOM 7650 CD1 TRP C 136 -11.032 2.401 24.451 1.00 19.47 C
ATOM 7651 CD2 TRP C 136 -11.649 1.539 22.479 1.00 21.26 C
ATOM 7652 NE1 TRP C 136 -11.543 1.147 24.686 1.00 20.38 N
ATOM 7653 CE2 TRP C 136 -11.934 0.592 23.496 1.00 21.25 C
ATOM 7654 CE3 TRP C 136 -11.945 1.216 21.157 1.00 22.28 C
ATOM 7655 CZ2 TRP C 136 -12.507 -0.660 23.228 1.00 19.22 C
ATOM 7656 CZ3 TRP C 136 -12.519 -0.040 20.887 1.00 24.70 C
ATOM 7657 CH2 TRP C 136 -12.794 -0.958 21.923 1.00 21.79 C
ATOM 7658 N GLY C 137 -13.274 6.577 22.350 1.00 26.67 N
ATOM 7659 CA GLY C 137 -14.101 7.380 23.225 1.00 25.04 C
ATOM 7660 C GLY C 137 -15.428 6.622 23.333 1.00 27.25 C
ATOM 7661 O GLY C 137 -15.547 5.481 22.871 1.00 28.89 O
ATOM 7662 N GLN C 138 -16.438 7.238 23.930 1.00 28.36 N
ATOM 7663 CA GLN C 138 -17.738 6.591 24.087 1.00 27.08 C
ATOM 7664 C GLN C 138 -18.390 6.324 22.759 1.00 28.27 C
ATOM 7665 O GLN C 138 -18.951 5.242 22.535 1.00 29.54 O
ATOM 7666 CB GLN C 138 -18.662 7.455 24.940 1.00 24.54 C
ATOM 7667 CG GLN C 138 -18.551 7.157 26.410 1.00 28.19 C
ATOM 7668 CD GLN C 138 -19.167 5.820 26.750 1.00 28.86 C
ATOM 7669 OE1 GLN C 138 -18.794 4.784 26.194 1.00 31.59 O
ATOM 7670 NE2 GLN C 138 -20.129 5.833 27.653 1.00 27.45 N
ATOM 7671 N MET C 139 -18.312 7.300 21.865 1.00 28.24 N
ATOM 7672 CA MET C 139 -18.945 7.148 20.572 1.00 30.40 C
ATOM 7673 C MET C 139 -18.206 6.120 19.713 1.00 30.04 C
ATOM 7674 O MET C 139 -18.820 5.355 18.975 1.00 27.41 O
ATOM 7675 CB MET C 139 -19.044 8.511 19.874 1.00 32.81 C
ATOM 7676 CG MET C 139 -20.247 8.601 18.957 1.00 38.27 C
ATOM 7677 SD MET C 139 -21.732 7.855 19.736 1.00 44.03 S
ATOM 7678 CE MET C 139 -22.469 9.326 20.435 1.00 42.62 C
ATOM 7679 N SER C 140 -16.883 6.094 19.829 1.00 32.16 N
ATOM 7680 CA SER C 140 -16.069 5.127 19.093 1.00 32.43 C
ATOM 7681 C SER C 140 -16.508 3.714 19.495 1.00 31.68 C
ATOM 7682 O SER C 140 -16.750 2.839 18.661 1.00 29.99 O
ATOM 7683 CB SER C 140 -14.589 5.309 19.448 1.00 33.29 C
ATOM 7684 OG SER C 140 -14.104 6.555 18.987 1.00 37.97 O
ATOM 7685 N PHE C 141 -16.624 3.513 20.799 1.00 31.46 N
ATOM 7686 CA PHE C 141 -17.006 2.221 21.324 1.00 31.81 C
ATOM 7687 C PHE C 141 -18.411 1.768 20.966 1.00 31.71 C
ATOM 7688 O PHE C 141 -18.601 0.684 20.420 1.00 31.22 O
ATOM 7689 CB PHE C 141 -16.871 2.207 22.833 1.00 29.51 C
ATOM 7690 CG PHE C 141 -17.161 0.886 23.425 1.00 31.35 C
ATOM 7691 CD1 PHE C 141 -16.163 -0.076 23.516 1.00 33.87 C
ATOM 7692 CD2 PHE C 141 -18.445 0.570 23.859 1.00 31.83 C
ATOM 7693 CE1 PHE C 141 -16.442 -1.347 24.035 1.00 32.83 C
ATOM 7694 CE2 PHE C 141 -18.727 -0.685 24.373 1.00 32.06 C
ATOM 7695 CZ PHE C 141 -17.719 -1.646 24.460 1.00 32.06 C
ATOM 7696 N TRP C 142 -19.400 2.589 21.276 1.00 31.80 N
ATOM 7697 CA TRP C 142 -20.765 2.189 21.003 1.00 31.90 C
ATOM 7698 C TRP C 142 -21.112 2.115 19.525 1.00 31.15 C
ATOM 7699 O TRP C 142 -21.895 1.258 19.118 1.00 30.61 O
ATOM 7700 CB TRP C 142 -21.716 3.089 21.792 1.00 34.27 C
ATOM 7701 CG TRP C 142 -21.546 2.843 23.284 1.00 36.59 C
ATOM 7702 CD1 TRP C 142 -20.822 3.597 24.174 1.00 35.22 C
ATOM 7703 CD2 TRP C 142 -21.951 1.667 24.001 1.00 35.62 C
ATOM 7704 NE1 TRP C 142 -20.744 2.955 25.386 1.00 34.36 N
ATOM 7705 CE2 TRP C 142 -21.427 1.769 25.307 1.00 35.62 C
ATOM 7706 CE3 TRP C 142 -22.700 0.530 23.660 1.00 36.51 C
ATOM 7707 CZ2 TRP C 142 -21.627 0.773 26.273 1.00 36.22 C
ATOM 7708 CZ3 TRP C 142 -22.894 -0.463 24.623 1.00 34.65 C
ATOM 7709 CH2 TRP C 142 -22.358 -0.332 25.909 1.00 34.14 C
ATOM 7710 N GLY C 143 -20.514 2.991 18.718 1.00 29.97 N
ATOM 7711 CA GLY C 143 -20.751 2.943 17.286 1.00 28.35 C
ATOM 7712 C GLY C 143 -20.190 1.626 16.770 1.00 28.11 C
ATOM 7713 O GLY C 143 -20.805 0.939 15.934 1.00 25.32 O
ATOM 7714 N ALA C 144 -19.011 1.273 17.290 1.00 27.90 N
ATOM 7715 CA ALA C 144 -18.352 0.027 16.941 1.00 27.80 C
ATOM 7716 C ALA C 144 -19.267 -1.120 17.363 1.00 28.90 C
ATOM 7717 O ALA C 144 -19.340 -2.131 16.683 1.00 30.27 O
ATOM 7718 CB ALA C 144 -17.023 -0.079 17.656 1.00 26.74 C
ATOM 7719 N THR C 145 -19.964 -0.964 18.489 1.00 30.16 N
ATOM 7720 CA THR C 145 -20.901 -1.993 18.973 1.00 29.53 C
ATOM 7721 C THR C 145 -22.130 -2.110 18.053 1.00 29.00 C
ATOM 7722 O THR C 145 -22.486 -3.212 17.605 1.00 28.93 O
ATOM 7723 CB THR C 145 -21.390 -1.684 20.408 1.00 28.64 C
ATOM 7724 OG1 THR C 145 -20.298 -1.803 21.319 1.00 29.79 O
ATOM 7725 CG2 THR C 145 -22.457 -2.648 20.825 1.00 27.17 C
ATOM 7726 N VAL C 146 -22.768 -0.979 17.764 1.00 26.73 N
ATOM 7727 CA VAL C 146 -23.942 -0.989 16.901 1.00 28.09 C
ATOM 7728 C VAL C 146 -23.605 -1.546 15.525 1.00 28.86 C
ATOM 7729 O VAL C 146 -24.242 -2.477 15.069 1.00 30.13 O
ATOM 7730 CB VAL C 146 -24.548 0.434 16.728 1.00 28.32 C
ATOM 7731 CG1 VAL C 146 -25.716 0.393 15.785 1.00 27.18 C
ATOM 7732 CG2 VAL C 146 -25.004 0.977 18.055 1.00 26.65 C
ATOM 7733 N ILE C 147 -22.601 -0.978 14.864 1.00 29.30 N
ATOM 7734 CA ILE C 147 -22.222 -1.442 13.537 1.00 28.94 C
ATOM 7735 C ILE C 147 -21.866 -2.925 13.497 1.00 30.54 C
ATOM 7736 O ILE C 147 -22.424 -3.666 12.699 1.00 30.04 O
ATOM 7737 CB ILE C 147 -21.027 -0.631 12.977 1.00 29.34 C
ATOM 7738 CG1 ILE C 147 -21.436 0.833 12.792 1.00 29.81 C
ATOM 7739 CG2 ILE C 147 -20.536 -1.231 11.660 1.00 26.15 C
ATOM 7740 CD1 ILE C 147 -22.635 1.045 11.898 1.00 24.26 C
ATOM 7741 N THR C 148 -20.939 -3.377 14.337 1.00 32.48 N
ATOM 7742 CA THR C 148 -20.591 -4.795 14.297 1.00 35.37 C
ATOM 7743 C THR C 148 -21.815 -5.678 14.567 1.00 38.02 C
ATOM 7744 O THR C 148 -21.995 -6.706 13.920 1.00 38.71 O
ATOM 7745 CB THR C 148 -19.471 -5.168 15.295 1.00 34.03 C
ATOM 7746 OG1 THR C 148 -19.799 -4.675 16.598 1.00 34.88 O
ATOM 7747 CG2 THR C 148 -18.137 -4.605 14.832 1.00 32.12 C
ATOM 7748 N ASN C 149 -22.673 -5.283 15.498 1.00 39.60 N
ATOM 7749 CA ASN C 149 -23.848 -6.097 15.763 1.00 42.55 C
ATOM 7750 C ASN C 149 -24.833 -6.132 14.604 1.00 44.45 C
ATOM 7751 O ASN C 149 -25.814 -6.874 14.628 1.00 45.06 O
ATOM 7752 CB ASN C 149 -24.560 -5.620 17.015 1.00 43.28 C
ATOM 7753 CG ASN C 149 -24.002 -6.243 18.258 1.00 44.57 C
ATOM 7754 OD1 ASN C 149 -24.048 -7.463 18.436 1.00 46.44 O
ATOM 7755 ND2 ASN C 149 -23.460 -5.411 19.137 1.00 46.44 N
ATOM 7756 N LEU C 150 -24.591 -5.333 13.582 1.00 46.31 N
ATOM 7757 CA LEU C 150 -25.495 -5.366 12.455 1.00 49.58 C
ATOM 7758 C LEU C 150 -25.354 -6.745 11.804 1.00 51.40 C
ATOM 7759 O LEU C 150 -26.344 -7.389 11.444 1.00 51.95 O
ATOM 7760 CB LEU C 150 -25.140 -4.265 11.451 1.00 49.51 C
ATOM 7761 CG LEU C 150 -25.437 -2.812 11.832 1.00 47.72 C
ATOM 7762 CD1 LEU C 150 -24.871 -1.893 10.742 1.00 47.60 C
ATOM 7763 CD2 LEU C 150 -26.933 -2.611 12.003 1.00 43.32 C
ATOM 7764 N PHE C 151 -24.111 -7.201 11.682 1.00 52.96 N
ATOM 7765 CA PHE C 151 -23.824 -8.487 11.062 1.00 54.41 C
ATOM 7766 C PHE C 151 -24.442 -9.663 11.781 1.00 53.72 C
ATOM 7767 O PHE C 151 -24.667 -10.713 11.177 1.00 54.42 O
ATOM 7768 CB PHE C 151 -22.313 -8.666 10.926 1.00 57.18 C
ATOM 7769 CG PHE C 151 -21.692 -7.690 9.970 1.00 61.06 C
ATOM 7770 CD1 PHE C 151 -21.432 -8.053 8.647 1.00 61.33 C
ATOM 7771 CD2 PHE C 151 -21.448 -6.367 10.367 1.00 61.91 C
ATOM 7772 CE1 PHE C 151 -20.941 -7.105 7.727 1.00 61.64 C
ATOM 7773 CE2 PHE C 151 -20.959 -5.418 9.458 1.00 61.49 C
ATOM 7774 CZ PHE C 151 -20.707 -5.788 8.136 1.00 60.56 C
ATOM 7775 N SER C 152 -24.740 -9.499 13.060 1.00 52.47 N
ATOM 7776 CA SER C 152 -25.353 -10.595 13.793 1.00 52.72 C
ATOM 7777 C SER C 152 -26.769 -10.868 13.266 1.00 53.15 C
ATOM 7778 O SER C 152 -27.371 -11.876 13.611 1.00 53.14 O
ATOM 7779 CB SER C 152 -25.408 -10.278 15.282 1.00 50.28 C
ATOM 7780 OG SER C 152 -26.439 -9.354 15.547 1.00 52.31 O
ATOM 7781 N ALA C 153 -27.295 -9.970 12.432 1.00 54.37 N
ATOM 7782 CA ALA C 153 -28.639 -10.131 11.863 1.00 55.03 C
ATOM 7783 C ALA C 153 -28.664 -11.188 10.737 1.00 55.78 C
ATOM 7784 O ALA C 153 -29.723 -11.701 10.360 1.00 54.69 O
ATOM 7785 CB ALA C 153 -29.152 -8.782 11.340 1.00 54.37 C
ATOM 7786 N ILE C 154 -27.495 -11.503 10.192 1.00 56.27 N
ATOM 7787 CA ILE C 154 -27.415 -12.511 9.153 1.00 57.18 C
ATOM 7788 C ILE C 154 -27.836 -13.818 9.806 1.00 58.68 C
ATOM 7789 O ILE C 154 -27.332 -14.180 10.865 1.00 58.46 O
ATOM 7790 CB ILE C 154 -25.988 -12.657 8.636 1.00 56.47 C
ATOM 7791 CG1 ILE C 154 -25.504 -11.315 8.083 1.00 56.00 C
ATOM 7792 CG2 ILE C 154 -25.933 -13.728 7.568 1.00 55.50 C
ATOM 7793 CD1 ILE C 154 -24.047 -11.317 7.651 1.00 56.50 C
ATOM 7794 N PRO C 155 -28.777 -14.546 9.190 1.00 60.24 N
ATOM 7795 CA PRO C 155 -29.231 -15.811 9.769 1.00 60.61 C
ATOM 7796 C PRO C 155 -28.185 -16.921 9.775 1.00 62.03 C
ATOM 7797 O PRO C 155 -27.371 -17.030 8.854 1.00 61.85 O
ATOM 7798 CB PRO C 155 -30.446 -16.148 8.920 1.00 60.12 C
ATOM 7799 CG PRO C 155 -30.090 -15.573 7.599 1.00 59.99 C
ATOM 7800 CD PRO C 155 -29.529 -14.232 7.966 1.00 60.25 C
ATOM 7801 N TYR C 156 -28.212 -17.724 10.842 1.00 63.32 N
ATOM 7802 CA TYR C 156 -27.308 -18.861 11.036 1.00 64.81 C
ATOM 7803 C TYR C 156 -25.864 -18.493 11.360 1.00 64.39 C
ATOM 7804 O TYR C 156 -25.400 -18.698 12.484 1.00 65.51 O
ATOM 7805 CB TYR C 156 -27.336 -19.779 9.805 1.00 68.50 C
ATOM 7806 CG TYR C 156 -28.727 -20.230 9.395 1.00 73.15 C
ATOM 7807 CD1 TYR C 156 -28.954 -20.791 8.136 1.00 74.96 C
ATOM 7808 CD2 TYR C 156 -29.831 -20.046 10.247 1.00 75.58 C
ATOM 7809 CE1 TYR C 156 -30.246 -21.146 7.729 1.00 76.99 C
ATOM 7810 CE2 TYR C 156 -31.123 -20.395 9.851 1.00 76.47 C
ATOM 7811 CZ TYR C 156 -31.324 -20.939 8.590 1.00 77.47 C
ATOM 7812 OH TYR C 156 -32.603 -21.232 8.178 1.00 78.16 O
ATOM 7813 N ILE C 157 -25.151 -17.951 10.382 1.00 62.75 N
ATOM 7814 CA ILE C 157 -23.760 -17.586 10.595 1.00 62.63 C
ATOM 7815 C ILE C 157 -23.561 -16.244 11.321 1.00 62.23 C
ATOM 7816 O ILE C 157 -22.444 -15.905 11.718 1.00 61.97 O
ATOM 7817 CB ILE C 157 -23.004 -17.543 9.251 1.00 63.02 C
ATOM 7818 CG1 ILE C 157 -23.538 -16.404 8.375 1.00 63.79 C
ATOM 7819 CG2 ILE C 157 -23.168 -18.859 8.537 1.00 62.45 C
ATOM 7820 CD1 ILE C 157 -22.766 -16.198 7.086 1.00 61.85 C
ATOM 7821 N GLY C 158 -24.646 -15.495 11.505 1.00 61.25 N
ATOM 7822 CA GLY C 158 -24.568 -14.191 12.151 1.00 60.39 C
ATOM 7823 C GLY C 158 -23.784 -14.043 13.446 1.00 59.27 C
ATOM 7824 O GLY C 158 -22.818 -13.289 13.506 1.00 57.40 O
ATOM 7825 N HIS C 159 -24.210 -14.747 14.488 1.00 59.93 N
ATOM 7826 CA HIS C 159 -23.549 -14.677 15.785 1.00 60.92 C
ATOM 7827 C HIS C 159 -22.101 -15.111 15.662 1.00 58.90 C
ATOM 7828 O HIS C 159 -21.192 -14.500 16.236 1.00 58.75 O
ATOM 7829 CB HIS C 159 -24.270 -15.582 16.792 1.00 66.25 C
ATOM 7830 CG HIS C 159 -23.584 -15.678 18.126 1.00 72.80 C
ATOM 7831 ND1 HIS C 159 -23.434 -14.595 18.970 1.00 76.21 N
ATOM 7832 CD2 HIS C 159 -22.990 -16.726 18.750 1.00 74.26 C
ATOM 7833 CE1 HIS C 159 -22.776 -14.971 20.053 1.00 76.14 C
ATOM 7834 NE2 HIS C 159 -22.495 -16.259 19.945 1.00 75.86 N
ATOM 7835 N THR C 160 -21.901 -16.180 14.907 1.00 56.00 N
ATOM 7836 CA THR C 160 -20.584 -16.736 14.686 1.00 53.54 C
ATOM 7837 C THR C 160 -19.642 -15.718 14.039 1.00 51.49 C
ATOM 7838 O THR C 160 -18.511 -15.564 14.487 1.00 52.11 O
ATOM 7839 CB THR C 160 -20.697 -17.998 13.803 1.00 55.60 C
ATOM 7840 OG1 THR C 160 -21.676 -18.887 14.367 1.00 53.80 O
ATOM 7841 CG2 THR C 160 -19.360 -18.710 13.701 1.00 52.77 C
ATOM 7842 N LEU C 161 -20.097 -15.017 13.002 1.00 49.52 N
ATOM 7843 CA LEU C 161 -19.247 -14.016 12.334 1.00 48.72 C
ATOM 7844 C LEU C 161 -18.896 -12.851 13.234 1.00 46.84 C
ATOM 7845 O LEU C 161 -17.757 -12.394 13.258 1.00 47.95 O
ATOM 7846 CB LEU C 161 -19.915 -13.432 11.092 1.00 50.36 C
ATOM 7847 CG LEU C 161 -20.285 -14.329 9.912 1.00 54.21 C
ATOM 7848 CD1 LEU C 161 -20.753 -13.416 8.786 1.00 55.85 C
ATOM 7849 CD2 LEU C 161 -19.097 -15.183 9.459 1.00 52.21 C
ATOM 7850 N VAL C 162 -19.880 -12.348 13.962 1.00 43.93 N
ATOM 7851 CA VAL C 162 -19.629 -11.232 14.840 1.00 42.61 C
ATOM 7852 C VAL C 162 -18.582 -11.567 15.888 1.00 42.42 C
ATOM 7853 O VAL C 162 -17.601 -10.836 16.049 1.00 42.37 O
ATOM 7854 CB VAL C 162 -20.919 -10.783 15.506 1.00 42.24 C
ATOM 7855 CG1 VAL C 162 -20.637 -9.712 16.519 1.00 41.41 C
ATOM 7856 CG2 VAL C 162 -21.861 -10.255 14.444 1.00 43.50 C
ATOM 7857 N GLU C 163 -18.763 -12.671 16.600 1.00 42.57 N
ATOM 7858 CA GLU C 163 -17.779 -13.028 17.618 1.00 43.15 C
ATOM 7859 C GLU C 163 -16.409 -13.262 17.015 1.00 40.42 C
ATOM 7860 O GLU C 163 -15.382 -13.042 17.672 1.00 38.09 O
ATOM 7861 CB GLU C 163 -18.224 -14.255 18.404 1.00 46.38 C
ATOM 7862 CG GLU C 163 -19.145 -13.902 19.552 1.00 53.58 C
ATOM 7863 CD GLU C 163 -19.469 -15.093 20.424 1.00 58.17 C
ATOM 7864 OE1 GLU C 163 -20.069 -14.887 21.507 1.00 59.11 O
ATOM 7865 OE2 GLU C 163 -19.120 -16.231 20.019 1.00 61.67 O
ATOM 7866 N TRP C 164 -16.395 -13.704 15.762 1.00 38.18 N
ATOM 7867 CA TRP C 164 -15.139 -13.948 15.079 1.00 37.62 C
ATOM 7868 C TRP C 164 -14.464 -12.598 14.852 1.00 37.99 C
ATOM 7869 O TRP C 164 -13.331 -12.383 15.284 1.00 39.65 O
ATOM 7870 CB TRP C 164 -15.377 -14.648 13.740 1.00 36.41 C
ATOM 7871 CG TRP C 164 -14.109 -14.845 12.981 1.00 37.11 C
ATOM 7872 CD1 TRP C 164 -13.089 -15.707 13.285 1.00 37.69 C
ATOM 7873 CD2 TRP C 164 -13.684 -14.113 11.829 1.00 36.49 C
ATOM 7874 NE1 TRP C 164 -12.052 -15.553 12.393 1.00 37.37 N
ATOM 7875 CE2 TRP C 164 -12.389 -14.583 11.487 1.00 36.09 C
ATOM 7876 CE3 TRP C 164 -14.268 -13.102 11.052 1.00 35.30 C
ATOM 7877 CZ2 TRP C 164 -11.672 -14.079 10.401 1.00 35.82 C
ATOM 7878 CZ3 TRP C 164 -13.555 -12.596 9.966 1.00 35.86 C
ATOM 7879 CH2 TRP C 164 -12.267 -13.087 9.650 1.00 36.79 C
ATOM 7880 N ALA C 165 -15.172 -11.696 14.182 1.00 36.65 N
ATOM 7881 CA ALA C 165 -14.672 -10.364 13.905 1.00 35.85 C
ATOM 7882 C ALA C 165 -14.170 -9.674 15.172 1.00 36.54 C
ATOM 7883 O ALA C 165 -13.151 -8.987 15.139 1.00 35.97 O
ATOM 7884 CB ALA C 165 -15.771 -9.534 13.266 1.00 36.78 C
ATOM 7885 N TRP C 166 -14.887 -9.857 16.283 1.00 37.20 N
ATOM 7886 CA TRP C 166 -14.515 -9.245 17.568 1.00 37.98 C
ATOM 7887 C TRP C 166 -13.270 -9.825 18.207 1.00 38.17 C
ATOM 7888 O TRP C 166 -12.558 -9.134 18.950 1.00 37.63 O
ATOM 7889 CB TRP C 166 -15.631 -9.394 18.602 1.00 37.67 C
ATOM 7890 CG TRP C 166 -16.798 -8.505 18.403 1.00 40.62 C
ATOM 7891 CD1 TRP C 166 -16.832 -7.316 17.719 1.00 41.42 C
ATOM 7892 CD2 TRP C 166 -18.111 -8.697 18.933 1.00 41.32 C
ATOM 7893 NE1 TRP C 166 -18.090 -6.762 17.789 1.00 38.70 N
ATOM 7894 CE2 TRP C 166 -18.894 -7.587 18.531 1.00 40.29 C
ATOM 7895 CE3 TRP C 166 -18.706 -9.699 19.712 1.00 42.61 C
ATOM 7896 CZ2 TRP C 166 -20.242 -7.455 18.881 1.00 39.64 C
ATOM 7897 CZ3 TRP C 166 -20.050 -9.568 20.060 1.00 42.76 C
ATOM 7898 CH2 TRP C 166 -20.801 -8.450 19.642 1.00 41.60 C
ATOM 7899 N GLY C 167 -13.028 -11.107 17.946 1.00 38.27 N
ATOM 7900 CA GLY C 167 -11.886 -11.770 18.546 1.00 37.95 C
ATOM 7901 C GLY C 167 -12.213 -12.084 20.004 1.00 36.62 C
ATOM 7902 O GLY C 167 -11.332 -12.369 20.813 1.00 37.02 O
ATOM 7903 N GLY C 168 -13.501 -12.035 20.328 1.00 35.08 N
ATOM 7904 CA GLY C 168 -13.943 -12.296 21.677 1.00 34.58 C
ATOM 7905 C GLY C 168 -15.453 -12.227 21.789 1.00 36.17 C
ATOM 7906 O GLY C 168 -16.180 -12.396 20.810 1.00 34.52 O
ATOM 7907 N PHE C 169 -15.936 -11.935 22.988 1.00 39.04 N
ATOM 7908 CA PHE C 169 -17.369 -11.896 23.208 1.00 41.72 C
ATOM 7909 C PHE C 169 -17.987 -10.536 23.119 1.00 42.77 C
ATOM 7910 O PHE C 169 -19.178 -10.390 23.367 1.00 45.62 O
ATOM 7911 CB PHE C 169 -17.689 -12.506 24.559 1.00 43.59 C
ATOM 7912 CG PHE C 169 -17.078 -13.857 24.750 1.00 45.63 C
ATOM 7913 CD1 PHE C 169 -15.993 -14.024 25.610 1.00 45.77 C
ATOM 7914 CD2 PHE C 169 -17.550 -14.950 24.024 1.00 46.14 C
ATOM 7915 CE1 PHE C 169 -15.379 -15.260 25.746 1.00 47.50 C
ATOM 7916 CE2 PHE C 169 -16.946 -16.189 24.150 1.00 49.26 C
ATOM 7917 CZ PHE C 169 -15.852 -16.348 25.016 1.00 49.41 C
ATOM 7918 N SER C 170 -17.189 -9.543 22.744 1.00 42.76 N
ATOM 7919 CA SER C 170 -17.680 -8.174 22.618 1.00 41.96 C
ATOM 7920 C SER C 170 -16.565 -7.327 22.051 1.00 41.60 C
ATOM 7921 O SER C 170 -15.425 -7.781 21.956 1.00 42.05 O
ATOM 7922 CB SER C 170 -18.037 -7.613 23.984 1.00 41.44 C
ATOM 7923 OG SER C 170 -16.857 -7.509 24.765 1.00 44.53 O
ATOM 7924 N VAL C 171 -16.890 -6.093 21.680 1.00 39.87 N
ATOM 7925 CA VAL C 171 -15.879 -5.189 21.164 1.00 37.27 C
ATOM 7926 C VAL C 171 -14.895 -5.009 22.304 1.00 36.81 C
ATOM 7927 O VAL C 171 -15.278 -4.591 23.388 1.00 35.97 O
ATOM 7928 CB VAL C 171 -16.483 -3.826 20.806 1.00 37.31 C
ATOM 7929 CG1 VAL C 171 -15.386 -2.769 20.704 1.00 36.39 C
ATOM 7930 CG2 VAL C 171 -17.238 -3.930 19.505 1.00 35.76 C
ATOM 7931 N ASP C 172 -13.631 -5.335 22.068 1.00 37.40 N
ATOM 7932 CA ASP C 172 -12.623 -5.211 23.111 1.00 37.10 C
ATOM 7933 C ASP C 172 -11.236 -5.015 22.488 1.00 37.20 C
ATOM 7934 O ASP C 172 -11.128 -4.712 21.294 1.00 37.13 O
ATOM 7935 CB ASP C 172 -12.641 -6.455 23.991 1.00 39.16 C
ATOM 7936 CG ASP C 172 -12.215 -6.172 25.416 1.00 40.76 C
ATOM 7937 OD1 ASP C 172 -11.249 -5.407 25.600 1.00 41.63 O
ATOM 7938 OD2 ASP C 172 -12.836 -6.732 26.354 1.00 41.63 O
ATOM 7939 N ASN C 173 -10.180 -5.219 23.275 1.00 34.92 N
ATOM 7940 CA ASN C 173 -8.838 -4.985 22.780 1.00 33.77 C
ATOM 7941 C ASN C 173 -8.448 -5.700 21.486 1.00 33.74 C
ATOM 7942 O ASN C 173 -7.799 -5.127 20.608 1.00 34.58 O
ATOM 7943 CB ASN C 173 -7.823 -5.296 23.856 1.00 32.40 C
ATOM 7944 CG ASN C 173 -6.570 -4.476 23.700 1.00 35.63 C
ATOM 7945 OD1 ASN C 173 -6.608 -3.242 23.809 1.00 37.28 O
ATOM 7946 ND2 ASN C 173 -5.448 -5.141 23.423 1.00 35.44 N
ATOM 7947 N PRO C 174 -8.813 -6.968 21.348 1.00 31.86 N
ATOM 7948 CA PRO C 174 -8.401 -7.571 20.082 1.00 31.25 C
ATOM 7949 C PRO C 174 -9.158 -6.979 18.899 1.00 30.85 C
ATOM 7950 O PRO C 174 -8.772 -7.145 17.743 1.00 32.24 O
ATOM 7951 CB PRO C 174 -8.670 -9.065 20.304 1.00 29.28 C
ATOM 7952 CG PRO C 174 -9.636 -9.105 21.407 1.00 29.93 C
ATOM 7953 CD PRO C 174 -9.226 -7.990 22.310 1.00 29.57 C
ATOM 7954 N THR C 175 -10.254 -6.298 19.192 1.00 30.57 N
ATOM 7955 CA THR C 175 -11.033 -5.686 18.140 1.00 29.46 C
ATOM 7956 C THR C 175 -10.255 -4.429 17.790 1.00 29.97 C
ATOM 7957 O THR C 175 -10.019 -4.129 16.626 1.00 32.00 O
ATOM 7958 CB THR C 175 -12.415 -5.276 18.633 1.00 28.59 C
ATOM 7959 OG1 THR C 175 -12.962 -6.327 19.425 1.00 29.87 O
ATOM 7960 CG2 THR C 175 -13.347 -5.010 17.445 1.00 29.25 C
ATOM 7961 N LEU C 176 -9.815 -3.720 18.818 1.00 27.63 N
ATOM 7962 CA LEU C 176 -9.088 -2.502 18.604 1.00 26.55 C
ATOM 7963 C LEU C 176 -7.812 -2.697 17.834 1.00 28.33 C
ATOM 7964 O LEU C 176 -7.578 -1.984 16.853 1.00 29.75 O
ATOM 7965 CB LEU C 176 -8.787 -1.827 19.927 1.00 25.44 C
ATOM 7966 CG LEU C 176 -8.065 -0.486 19.799 1.00 27.67 C
ATOM 7967 CD1 LEU C 176 -8.780 0.415 18.797 1.00 25.86 C
ATOM 7968 CD2 LEU C 176 -8.001 0.186 21.185 1.00 28.33 C
ATOM 7969 N THR C 177 -6.976 -3.653 18.248 1.00 29.01 N
ATOM 7970 CA THR C 177 -5.720 -3.854 17.530 1.00 28.12 C
ATOM 7971 C THR C 177 -5.945 -4.331 16.119 1.00 29.16 C
ATOM 7972 O THR C 177 -5.203 -3.914 15.223 1.00 30.93 O
ATOM 7973 CB THR C 177 -4.717 -4.821 18.228 1.00 27.40 C
ATOM 7974 OG1 THR C 177 -5.331 -6.081 18.491 1.00 29.97 O
ATOM 7975 CG2 THR C 177 -4.201 -4.205 19.513 1.00 27.92 C
ATOM 7976 N ARG C 178 -6.951 -5.173 15.881 1.00 27.40 N
ATOM 7977 CA ARG C 178 -7.158 -5.593 14.501 1.00 28.11 C
ATOM 7978 C ARG C 178 -7.741 -4.452 13.675 1.00 28.00 C
ATOM 7979 O ARG C 178 -7.480 -4.366 12.472 1.00 27.99 O
ATOM 7980 CB ARG C 178 -8.041 -6.848 14.396 1.00 27.91 C
ATOM 7981 CG ARG C 178 -9.526 -6.658 14.595 1.00 29.48 C
ATOM 7982 CD ARG C 178 -10.223 -8.033 14.631 1.00 28.21 C
ATOM 7983 NE ARG C 178 -9.703 -8.868 15.711 1.00 29.26 N
ATOM 7984 CZ ARG C 178 -9.904 -10.179 15.816 1.00 29.92 C
ATOM 7985 NH1 ARG C 178 -10.622 -10.815 14.913 1.00 29.71 N
ATOM 7986 NH2 ARG C 178 -9.353 -10.865 16.809 1.00 31.64 N
ATOM 7987 N PHE C 179 -8.502 -3.562 14.314 1.00 28.46 N
ATOM 7988 CA PHE C 179 -9.095 -2.427 13.594 1.00 28.53 C
ATOM 7989 C PHE C 179 -8.016 -1.440 13.154 1.00 28.32 C
ATOM 7990 O PHE C 179 -8.095 -0.847 12.070 1.00 26.08 O
ATOM 7991 CB PHE C 179 -10.144 -1.720 14.453 1.00 28.23 C
ATOM 7992 CG PHE C 179 -11.549 -2.273 14.295 1.00 31.69 C
ATOM 7993 CD1 PHE C 179 -11.771 -3.520 13.695 1.00 30.93 C
ATOM 7994 CD2 PHE C 179 -12.658 -1.560 14.789 1.00 32.11 C
ATOM 7995 CE1 PHE C 179 -13.069 -4.045 13.592 1.00 30.13 C
ATOM 7996 CE2 PHE C 179 -13.961 -2.084 14.689 1.00 29.85 C
ATOM 7997 CZ PHE C 179 -14.164 -3.320 14.093 1.00 29.75 C
ATOM 7998 N PHE C 180 -6.998 -1.274 13.989 1.00 28.25 N
ATOM 7999 CA PHE C 180 -5.905 -0.378 13.649 1.00 27.68 C
ATOM 8000 C PHE C 180 -5.227 -0.921 12.389 1.00 28.96 C
ATOM 8001 O PHE C 180 -5.044 -0.201 11.401 1.00 32.80 O
ATOM 8002 CB PHE C 180 -4.898 -0.322 14.786 1.00 26.61 C
ATOM 8003 CG PHE C 180 -3.706 0.533 14.496 1.00 26.36 C
ATOM 8004 CD1 PHE C 180 -2.437 0.146 14.928 1.00 23.49 C
ATOM 8005 CD2 PHE C 180 -3.852 1.758 13.841 1.00 26.43 C
ATOM 8006 CE1 PHE C 180 -1.347 0.957 14.722 1.00 22.61 C
ATOM 8007 CE2 PHE C 180 -2.756 2.589 13.629 1.00 24.29 C
ATOM 8008 CZ PHE C 180 -1.504 2.194 14.068 1.00 23.99 C
ATOM 8009 N ALA C 181 -4.865 -2.198 12.417 1.00 26.84 N
ATOM 8010 CA ALA C 181 -4.222 -2.811 11.276 1.00 24.57 C
ATOM 8011 C ALA C 181 -5.077 -2.631 10.025 1.00 26.29 C
ATOM 8012 O ALA C 181 -4.560 -2.259 8.973 1.00 27.45 O
ATOM 8013 CB ALA C 181 -3.995 -4.260 11.548 1.00 25.44 C
ATOM 8014 N LEU C 182 -6.378 -2.899 10.123 1.00 26.42 N
ATOM 8015 CA LEU C 182 -7.258 -2.728 8.976 1.00 27.34 C
ATOM 8016 C LEU C 182 -7.268 -1.276 8.516 1.00 28.40 C
ATOM 8017 O LEU C 182 -7.220 -0.966 7.318 1.00 27.58 O
ATOM 8018 CB LEU C 182 -8.687 -3.106 9.328 1.00 29.01 C
ATOM 8019 CG LEU C 182 -9.031 -4.590 9.311 1.00 34.85 C
ATOM 8020 CD1 LEU C 182 -10.541 -4.772 9.529 1.00 34.24 C
ATOM 8021 CD2 LEU C 182 -8.617 -5.177 7.962 1.00 35.03 C
ATOM 8022 N HIS C 183 -7.338 -0.375 9.480 1.00 27.78 N
ATOM 8023 CA HIS C 183 -7.402 1.013 9.127 1.00 26.86 C
ATOM 8024 C HIS C 183 -6.139 1.433 8.414 1.00 27.60 C
ATOM 8025 O HIS C 183 -6.184 2.291 7.518 1.00 28.35 O
ATOM 8026 CB HIS C 183 -7.641 1.875 10.363 1.00 27.15 C
ATOM 8027 CG HIS C 183 -7.859 3.317 10.040 1.00 26.34 C
ATOM 8028 ND1 HIS C 183 -8.836 3.730 9.164 1.00 26.79 N
ATOM 8029 CD2 HIS C 183 -7.193 4.436 10.420 1.00 25.21 C
ATOM 8030 CE1 HIS C 183 -8.757 5.039 9.012 1.00 27.92 C
ATOM 8031 NE2 HIS C 183 -7.770 5.492 9.762 1.00 25.85 N
ATOM 8032 N PHE C 184 -5.014 0.827 8.797 1.00 25.82 N
ATOM 8033 CA PHE C 184 -3.719 1.148 8.186 1.00 25.57 C
ATOM 8034 C PHE C 184 -3.669 0.592 6.759 1.00 25.03 C
ATOM 8035 O PHE C 184 -3.209 1.233 5.842 1.00 26.62 O
ATOM 8036 CB PHE C 184 -2.598 0.521 9.027 1.00 25.22 C
ATOM 8037 CG PHE C 184 -1.238 1.132 8.809 1.00 24.48 C
ATOM 8038 CD1 PHE C 184 -0.535 1.678 9.885 1.00 23.97 C
ATOM 8039 CD2 PHE C 184 -0.665 1.183 7.546 1.00 23.00 C
ATOM 8040 CE1 PHE C 184 0.721 2.276 9.709 1.00 24.76 C
ATOM 8041 CE2 PHE C 184 0.590 1.778 7.359 1.00 23.60 C
ATOM 8042 CZ PHE C 184 1.283 2.326 8.438 1.00 22.93 C
ATOM 8043 N LEU C 185 -4.200 -0.599 6.579 1.00 25.58 N
ATOM 8044 CA LEU C 185 -4.161 -1.273 5.301 1.00 25.68 C
ATOM 8045 C LEU C 185 -5.085 -0.773 4.225 1.00 26.86 C
ATOM 8046 O LEU C 185 -4.626 -0.453 3.121 1.00 28.22 O
ATOM 8047 CB LEU C 185 -4.408 -2.773 5.531 1.00 28.60 C
ATOM 8048 CG LEU C 185 -4.611 -3.721 4.350 1.00 28.28 C
ATOM 8049 CD1 LEU C 185 -3.324 -3.824 3.557 1.00 29.89 C
ATOM 8050 CD2 LEU C 185 -5.027 -5.081 4.869 1.00 26.82 C
ATOM 8051 N LEU C 186 -6.388 -0.726 4.530 1.00 27.28 N
ATOM 8052 CA LEU C 186 -7.420 -0.317 3.563 1.00 24.86 C
ATOM 8053 C LEU C 186 -7.146 0.927 2.721 1.00 25.76 C
ATOM 8054 O LEU C 186 -7.412 0.943 1.512 1.00 26.42 O
ATOM 8055 CB LEU C 186 -8.764 -0.179 4.273 1.00 23.53 C
ATOM 8056 CG LEU C 186 -9.300 -1.515 4.805 1.00 21.31 C
ATOM 8057 CD1 LEU C 186 -10.590 -1.328 5.594 1.00 17.67 C
ATOM 8058 CD2 LEU C 186 -9.522 -2.436 3.637 1.00 17.31 C
ATOM 8059 N PRO C 187 -6.643 2.001 3.337 1.00 25.48 N
ATOM 8060 CA PRO C 187 -6.380 3.179 2.516 1.00 27.34 C
ATOM 8061 C PRO C 187 -5.532 2.827 1.283 1.00 28.90 C
ATOM 8062 O PRO C 187 -5.708 3.407 0.198 1.00 28.33 O
ATOM 8063 CB PRO C 187 -5.655 4.105 3.475 1.00 27.97 C
ATOM 8064 CG PRO C 187 -6.314 3.797 4.768 1.00 28.29 C
ATOM 8065 CD PRO C 187 -6.439 2.291 4.763 1.00 25.39 C
ATOM 8066 N PHE C 188 -4.618 1.873 1.442 1.00 29.22 N
ATOM 8067 CA PHE C 188 -3.790 1.478 0.309 1.00 30.12 C
ATOM 8068 C PHE C 188 -4.590 0.655 -0.716 1.00 29.95 C
ATOM 8069 O PHE C 188 -4.311 0.700 -1.915 1.00 30.11 O
ATOM 8070 CB PHE C 188 -2.530 0.758 0.796 1.00 30.13 C
ATOM 8071 CG PHE C 188 -1.617 1.652 1.604 1.00 34.34 C
ATOM 8072 CD1 PHE C 188 -1.713 1.706 2.997 1.00 34.84 C
ATOM 8073 CD2 PHE C 188 -0.713 2.503 0.966 1.00 35.08 C
ATOM 8074 CE1 PHE C 188 -0.923 2.593 3.746 1.00 35.17 C
ATOM 8075 CE2 PHE C 188 0.082 3.401 1.707 1.00 36.05 C
ATOM 8076 CZ PHE C 188 -0.027 3.443 3.102 1.00 36.52 C
ATOM 8077 N ALA C 189 -5.601 -0.078 -0.267 1.00 27.45 N
ATOM 8078 CA ALA C 189 -6.412 -0.808 -1.216 1.00 24.73 C
ATOM 8079 C ALA C 189 -7.186 0.259 -1.985 1.00 26.50 C
ATOM 8080 O ALA C 189 -7.460 0.117 -3.184 1.00 28.75 O
ATOM 8081 CB ALA C 189 -7.367 -1.725 -0.501 1.00 22.92 C
ATOM 8082 N ILE C 190 -7.540 1.339 -1.295 1.00 25.35 N
ATOM 8083 CA ILE C 190 -8.280 2.402 -1.943 1.00 25.04 C
ATOM 8084 C ILE C 190 -7.412 2.989 -3.026 1.00 24.33 C
ATOM 8085 O ILE C 190 -7.855 3.184 -4.152 1.00 25.94 O
ATOM 8086 CB ILE C 190 -8.675 3.488 -0.933 1.00 27.35 C
ATOM 8087 CG1 ILE C 190 -9.776 2.952 -0.035 1.00 26.73 C
ATOM 8088 CG2 ILE C 190 -9.176 4.741 -1.645 1.00 27.95 C
ATOM 8089 CD1 ILE C 190 -10.175 3.920 1.029 1.00 27.50 C
ATOM 8090 N ALA C 191 -6.162 3.270 -2.689 1.00 25.02 N
ATOM 8091 CA ALA C 191 -5.224 3.818 -3.667 1.00 24.40 C
ATOM 8092 C ALA C 191 -5.091 2.860 -4.865 1.00 24.32 C
ATOM 8093 O ALA C 191 -5.226 3.256 -6.025 1.00 25.01 O
ATOM 8094 CB ALA C 191 -3.875 4.041 -3.014 1.00 22.74 C
ATOM 8095 N GLY C 192 -4.849 1.587 -4.593 1.00 23.87 N
ATOM 8096 CA GLY C 192 -4.734 0.644 -5.691 1.00 25.87 C
ATOM 8097 C GLY C 192 -5.964 0.581 -6.596 1.00 26.67 C
ATOM 8098 O GLY C 192 -5.855 0.672 -7.824 1.00 26.56 O
ATOM 8099 N ILE C 193 -7.138 0.408 -5.996 1.00 25.60 N
ATOM 8100 CA ILE C 193 -8.358 0.336 -6.775 1.00 24.66 C
ATOM 8101 C ILE C 193 -8.612 1.644 -7.519 1.00 25.98 C
ATOM 8102 O ILE C 193 -9.315 1.651 -8.536 1.00 23.16 O
ATOM 8103 CB ILE C 193 -9.534 0.006 -5.879 1.00 24.57 C
ATOM 8104 CG1 ILE C 193 -9.294 -1.370 -5.259 1.00 19.74 C
ATOM 8105 CG2 ILE C 193 -10.841 0.069 -6.676 1.00 22.03 C
ATOM 8106 CD1 ILE C 193 -10.179 -1.645 -4.078 1.00 20.18 C
ATOM 8107 N THR C 194 -8.047 2.748 -7.023 1.00 24.92 N
ATOM 8108 CA THR C 194 -8.219 4.013 -7.726 1.00 26.47 C
ATOM 8109 C THR C 194 -7.566 3.848 -9.097 1.00 26.99 C
ATOM 8110 O THR C 194 -8.139 4.236 -10.103 1.00 28.46 O
ATOM 8111 CB THR C 194 -7.575 5.202 -6.973 1.00 26.68 C
ATOM 8112 OG1 THR C 194 -8.285 5.440 -5.755 1.00 28.37 O
ATOM 8113 CG2 THR C 194 -7.636 6.454 -7.797 1.00 21.88 C
ATOM 8114 N ILE C 195 -6.375 3.257 -9.137 1.00 28.29 N
ATOM 8115 CA ILE C 195 -5.670 3.017 -10.410 1.00 28.91 C
ATOM 8116 C ILE C 195 -6.553 2.206 -11.362 1.00 29.59 C
ATOM 8117 O ILE C 195 -6.614 2.503 -12.561 1.00 29.41 O
ATOM 8118 CB ILE C 195 -4.345 2.215 -10.213 1.00 30.02 C
ATOM 8119 CG1 ILE C 195 -3.378 2.976 -9.294 1.00 30.80 C
ATOM 8120 CG2 ILE C 195 -3.691 1.977 -11.545 1.00 28.34 C
ATOM 8121 CD1 ILE C 195 -3.088 4.396 -9.757 1.00 30.78 C
ATOM 8122 N ILE C 196 -7.219 1.170 -10.845 1.00 28.68 N
ATOM 8123 CA ILE C 196 -8.115 0.371 -11.695 1.00 28.99 C
ATOM 8124 C ILE C 196 -9.266 1.268 -12.225 1.00 28.06 C
ATOM 8125 O ILE C 196 -9.683 1.163 -13.379 1.00 27.55 O
ATOM 8126 CB ILE C 196 -8.787 -0.805 -10.921 1.00 30.09 C
ATOM 8127 CG1 ILE C 196 -7.763 -1.638 -10.155 1.00 30.31 C
ATOM 8128 CG2 ILE C 196 -9.566 -1.658 -11.884 1.00 29.66 C
ATOM 8129 CD1 ILE C 196 -6.722 -2.249 -11.010 1.00 34.56 C
ATOM 8130 N HIS C 197 -9.768 2.136 -11.349 1.00 26.43 N
ATOM 8131 CA HIS C 197 -10.861 3.050 -11.643 1.00 25.36 C
ATOM 8132 C HIS C 197 -10.443 3.895 -12.840 1.00 27.47 C
ATOM 8133 O HIS C 197 -11.119 3.889 -13.887 1.00 26.22 O
ATOM 8134 CB HIS C 197 -11.103 3.911 -10.389 1.00 26.20 C
ATOM 8135 CG HIS C 197 -12.319 4.796 -10.436 1.00 24.73 C
ATOM 8136 ND1 HIS C 197 -13.594 4.313 -10.637 1.00 24.51 N
ATOM 8137 CD2 HIS C 197 -12.459 6.120 -10.176 1.00 23.18 C
ATOM 8138 CE1 HIS C 197 -14.465 5.297 -10.492 1.00 23.64 C
ATOM 8139 NE2 HIS C 197 -13.805 6.408 -10.209 1.00 22.21 N
ATOM 8140 N LEU C 198 -9.319 4.603 -12.697 1.00 27.66 N
ATOM 8141 CA LEU C 198 -8.822 5.454 -13.762 1.00 29.61 C
ATOM 8142 C LEU C 198 -8.391 4.655 -14.995 1.00 31.79 C
ATOM 8143 O LEU C 198 -8.376 5.175 -16.122 1.00 32.69 O
ATOM 8144 CB LEU C 198 -7.666 6.303 -13.260 1.00 31.12 C
ATOM 8145 CG LEU C 198 -8.017 7.359 -12.212 1.00 33.79 C
ATOM 8146 CD1 LEU C 198 -6.755 8.113 -11.831 1.00 33.51 C
ATOM 8147 CD2 LEU C 198 -9.055 8.324 -12.760 1.00 35.31 C
ATOM 8148 N THR C 199 -8.043 3.391 -14.797 1.00 31.45 N
ATOM 8149 CA THR C 199 -7.648 2.577 -15.928 1.00 32.60 C
ATOM 8150 C THR C 199 -8.856 2.280 -16.805 1.00 32.12 C
ATOM 8151 O THR C 199 -8.791 2.403 -18.024 1.00 33.10 O
ATOM 8152 CB THR C 199 -7.006 1.261 -15.470 1.00 34.11 C
ATOM 8153 OG1 THR C 199 -5.653 1.516 -15.083 1.00 35.80 O
ATOM 8154 CG2 THR C 199 -7.041 0.217 -16.591 1.00 31.86 C
ATOM 8155 N PHE C 200 -9.956 1.873 -16.192 1.00 31.50 N
ATOM 8156 CA PHE C 200 -11.159 1.588 -16.956 1.00 31.02 C
ATOM 8157 C PHE C 200 -11.621 2.883 -17.605 1.00 31.79 C
ATOM 8158 O PHE C 200 -12.009 2.908 -18.764 1.00 31.09 O
ATOM 8159 CB PHE C 200 -12.249 1.061 -16.033 1.00 30.63 C
ATOM 8160 CG PHE C 200 -12.138 -0.397 -15.741 1.00 30.54 C
ATOM 8161 CD1 PHE C 200 -12.268 -1.326 -16.765 1.00 31.20 C
ATOM 8162 CD2 PHE C 200 -11.936 -0.849 -14.442 1.00 30.19 C
ATOM 8163 CE1 PHE C 200 -12.205 -2.694 -16.500 1.00 30.68 C
ATOM 8164 CE2 PHE C 200 -11.872 -2.214 -14.164 1.00 29.87 C
ATOM 8165 CZ PHE C 200 -12.009 -3.137 -15.199 1.00 31.13 C
ATOM 8166 N LEU C 201 -11.574 3.969 -16.844 1.00 31.82 N
ATOM 8167 CA LEU C 201 -11.990 5.264 -17.354 1.00 31.63 C
ATOM 8168 C LEU C 201 -11.282 5.680 -18.641 1.00 33.40 C
ATOM 8169 O LEU C 201 -11.909 6.163 -19.586 1.00 31.48 O
ATOM 8170 CB LEU C 201 -11.740 6.331 -16.300 1.00 29.62 C
ATOM 8171 CG LEU C 201 -11.970 7.756 -16.775 1.00 26.32 C
ATOM 8172 CD1 LEU C 201 -13.441 7.975 -17.130 1.00 20.96 C
ATOM 8173 CD2 LEU C 201 -11.486 8.693 -15.680 1.00 27.49 C
ATOM 8174 N HIS C 202 -9.969 5.509 -18.680 1.00 35.37 N
ATOM 8175 CA HIS C 202 -9.238 5.918 -19.864 1.00 38.23 C
ATOM 8176 C HIS C 202 -9.572 5.115 -21.103 1.00 37.98 C
ATOM 8177 O HIS C 202 -9.207 5.510 -22.209 1.00 36.93 O
ATOM 8178 CB HIS C 202 -7.743 5.900 -19.584 1.00 42.33 C
ATOM 8179 CG HIS C 202 -7.327 6.901 -18.552 1.00 48.24 C
ATOM 8180 ND1 HIS C 202 -6.047 6.965 -18.046 1.00 52.08 N
ATOM 8181 CD2 HIS C 202 -8.031 7.868 -17.914 1.00 49.71 C
ATOM 8182 CE1 HIS C 202 -5.982 7.923 -17.138 1.00 51.65 C
ATOM 8183 NE2 HIS C 202 -7.170 8.485 -17.039 1.00 49.94 N
ATOM 8184 N GLU C 203 -10.271 3.999 -20.932 1.00 37.38 N
ATOM 8185 CA GLU C 203 -10.654 3.201 -22.091 1.00 38.97 C
ATOM 8186 C GLU C 203 -11.539 4.054 -22.980 1.00 37.97 C
ATOM 8187 O GLU C 203 -11.599 3.848 -24.180 1.00 37.57 O
ATOM 8188 CB GLU C 203 -11.442 1.955 -21.675 1.00 41.52 C
ATOM 8189 CG GLU C 203 -10.591 0.829 -21.177 1.00 47.99 C
ATOM 8190 CD GLU C 203 -9.563 0.446 -22.204 1.00 54.36 C
ATOM 8191 OE1 GLU C 203 -9.941 -0.215 -23.205 1.00 57.65 O
ATOM 8192 OE2 GLU C 203 -8.381 0.826 -22.018 1.00 56.77 O
ATOM 8193 N SER C 204 -12.212 5.025 -22.366 1.00 38.52 N
ATOM 8194 CA SER C 204 -13.154 5.906 -23.059 1.00 36.85 C
ATOM 8195 C SER C 204 -12.929 7.376 -22.818 1.00 35.13 C
ATOM 8196 O SER C 204 -13.479 8.206 -23.518 1.00 35.56 O
ATOM 8197 CB SER C 204 -14.570 5.592 -22.595 1.00 36.03 C
ATOM 8198 OG SER C 204 -14.609 5.570 -21.175 1.00 37.53 O
ATOM 8199 N GLY C 205 -12.127 7.709 -21.822 1.00 35.29 N
ATOM 8200 CA GLY C 205 -11.935 9.108 -21.518 1.00 32.99 C
ATOM 8201 C GLY C 205 -13.220 9.584 -20.858 1.00 32.46 C
ATOM 8202 O GLY C 205 -14.222 8.845 -20.762 1.00 32.35 O
ATOM 8203 N SER C 206 -13.207 10.825 -20.401 1.00 30.92 N
ATOM 8204 CA SER C 206 -14.367 11.389 -19.742 1.00 30.31 C
ATOM 8205 C SER C 206 -15.606 11.621 -20.591 1.00 30.46 C
ATOM 8206 O SER C 206 -15.551 11.723 -21.823 1.00 32.16 O
ATOM 8207 CB SER C 206 -13.974 12.699 -19.092 1.00 29.47 C
ATOM 8208 OG SER C 206 -12.832 12.486 -18.291 1.00 31.50 O
ATOM 8209 N ASN C 207 -16.729 11.669 -19.894 1.00 29.53 N
ATOM 8210 CA ASN C 207 -18.032 11.958 -20.467 1.00 28.97 C
ATOM 8211 C ASN C 207 -18.047 13.505 -20.289 1.00 29.06 C
ATOM 8212 O ASN C 207 -17.056 14.089 -19.835 1.00 27.45 O
ATOM 8213 CB ASN C 207 -19.092 11.268 -19.594 1.00 31.35 C
ATOM 8214 CG ASN C 207 -20.525 11.580 -20.006 1.00 30.86 C
ATOM 8215 OD1 ASN C 207 -21.433 11.572 -19.168 1.00 31.38 O
ATOM 8216 ND2 ASN C 207 -20.737 11.833 -21.283 1.00 31.77 N
ATOM 8217 N ASN C 208 -19.135 14.177 -20.645 1.00 28.17 N
ATOM 8218 CA ASN C 208 -19.193 15.628 -20.483 1.00 27.55 C
ATOM 8219 C ASN C 208 -20.644 16.055 -20.257 1.00 26.85 C
ATOM 8220 O ASN C 208 -21.570 15.321 -20.583 1.00 26.24 O
ATOM 8221 CB ASN C 208 -18.592 16.322 -21.718 1.00 25.69 C
ATOM 8222 CG ASN C 208 -19.510 16.293 -22.906 1.00 24.02 C
ATOM 8223 OD1 ASN C 208 -20.480 17.043 -22.971 1.00 28.20 O
ATOM 8224 ND2 ASN C 208 -19.218 15.432 -23.853 1.00 22.92 N
ATOM 8225 N PRO C 209 -20.861 17.263 -19.718 1.00 27.92 N
ATOM 8226 CA PRO C 209 -22.234 17.731 -19.465 1.00 28.40 C
ATOM 8227 C PRO C 209 -23.329 17.595 -20.547 1.00 27.86 C
ATOM 8228 O PRO C 209 -24.474 17.340 -20.201 1.00 29.02 O
ATOM 8229 CB PRO C 209 -22.029 19.168 -18.956 1.00 26.00 C
ATOM 8230 CG PRO C 209 -20.617 19.530 -19.329 1.00 24.05 C
ATOM 8231 CD PRO C 209 -19.866 18.252 -19.259 1.00 28.24 C
ATOM 8232 N LEU C 210 -23.006 17.726 -21.832 1.00 27.59 N
ATOM 8233 CA LEU C 210 -24.035 17.574 -22.876 1.00 26.61 C
ATOM 8234 C LEU C 210 -24.329 16.124 -23.244 1.00 28.53 C
ATOM 8235 O LEU C 210 -25.281 15.841 -23.980 1.00 29.29 O
ATOM 8236 CB LEU C 210 -23.646 18.327 -24.151 1.00 26.25 C
ATOM 8237 CG LEU C 210 -23.436 19.842 -24.045 1.00 24.06 C
ATOM 8238 CD1 LEU C 210 -23.290 20.437 -25.431 1.00 19.95 C
ATOM 8239 CD2 LEU C 210 -24.621 20.465 -23.310 1.00 23.75 C
ATOM 8240 N GLY C 211 -23.501 15.201 -22.755 1.00 30.47 N
ATOM 8241 CA GLY C 211 -23.712 13.789 -23.029 1.00 29.54 C
ATOM 8242 C GLY C 211 -23.603 13.376 -24.482 1.00 31.38 C
ATOM 8243 O GLY C 211 -24.178 12.373 -24.876 1.00 35.06 O
ATOM 8244 N ILE C 212 -22.889 14.149 -25.289 1.00 32.10 N
ATOM 8245 CA ILE C 212 -22.695 13.819 -26.696 1.00 32.15 C
ATOM 8246 C ILE C 212 -21.183 13.711 -26.899 1.00 32.71 C
ATOM 8247 O ILE C 212 -20.394 14.306 -26.156 1.00 31.81 O
ATOM 8248 CB ILE C 212 -23.264 14.924 -27.642 1.00 32.87 C
ATOM 8249 CG1 ILE C 212 -22.503 16.233 -27.430 1.00 35.38 C
ATOM 8250 CG2 ILE C 212 -24.752 15.147 -27.369 1.00 31.83 C
ATOM 8251 CD1 ILE C 212 -23.106 17.434 -28.144 1.00 36.11 C
ATOM 8252 N SER C 213 -20.777 12.953 -27.908 1.00 32.99 N
ATOM 8253 CA SER C 213 -19.365 12.762 -28.186 1.00 32.88 C
ATOM 8254 C SER C 213 -18.569 14.070 -28.227 1.00 34.39 C
ATOM 8255 O SER C 213 -18.992 15.049 -28.842 1.00 34.23 O
ATOM 8256 CB SER C 213 -19.210 12.026 -29.509 1.00 31.52 C
ATOM 8257 OG SER C 213 -17.843 11.794 -29.793 1.00 32.67 O
ATOM 8258 N SER C 214 -17.410 14.081 -27.578 1.00 35.90 N
ATOM 8259 CA SER C 214 -16.567 15.269 -27.577 1.00 38.94 C
ATOM 8260 C SER C 214 -15.291 15.073 -28.394 1.00 40.88 C
ATOM 8261 O SER C 214 -14.357 15.870 -28.299 1.00 42.20 O
ATOM 8262 CB SER C 214 -16.219 15.687 -26.140 1.00 38.99 C
ATOM 8263 OG SER C 214 -15.777 14.591 -25.353 1.00 40.14 O
ATOM 8264 N ASP C 215 -15.266 14.025 -29.213 1.00 42.84 N
ATOM 8265 CA ASP C 215 -14.105 13.717 -30.047 1.00 44.62 C
ATOM 8266 C ASP C 215 -13.745 14.855 -31.000 1.00 44.84 C
ATOM 8267 O ASP C 215 -12.596 14.995 -31.431 1.00 45.20 O
ATOM 8268 CB ASP C 215 -14.373 12.450 -30.855 1.00 46.30 C
ATOM 8269 CG ASP C 215 -14.375 11.199 -30.001 1.00 48.20 C
ATOM 8270 OD1 ASP C 215 -14.930 10.176 -30.458 1.00 52.51 O
ATOM 8271 OD2 ASP C 215 -13.810 11.226 -28.887 1.00 48.70 O
ATOM 8272 N SER C 216 -14.744 15.664 -31.328 1.00 44.79 N
ATOM 8273 CA SER C 216 -14.565 16.789 -32.233 1.00 44.04 C
ATOM 8274 C SER C 216 -13.943 17.964 -31.521 1.00 43.59 C
ATOM 8275 O SER C 216 -13.458 18.898 -32.163 1.00 44.67 O
ATOM 8276 CB SER C 216 -15.918 17.209 -32.806 1.00 44.65 C
ATOM 8277 OG SER C 216 -16.920 17.117 -31.803 1.00 49.81 O
ATOM 8278 N ASP C 217 -13.942 17.921 -30.191 1.00 42.27 N
ATOM 8279 CA ASP C 217 -13.398 19.031 -29.429 1.00 41.05 C
ATOM 8280 C ASP C 217 -12.635 18.621 -28.178 1.00 39.00 C
ATOM 8281 O ASP C 217 -13.028 18.987 -27.084 1.00 39.93 O
ATOM 8282 CB ASP C 217 -14.542 19.980 -29.042 1.00 43.44 C
ATOM 8283 CG ASP C 217 -14.071 21.416 -28.797 1.00 46.84 C
ATOM 8284 OD1 ASP C 217 -14.908 22.235 -28.335 1.00 45.78 O
ATOM 8285 OD2 ASP C 217 -12.882 21.726 -29.072 1.00 48.34 O
ATOM 8286 N LYS C 218 -11.547 17.878 -28.315 1.00 37.28 N
ATOM 8287 CA LYS C 218 -10.794 17.502 -27.131 1.00 36.37 C
ATOM 8288 C LYS C 218 -9.579 18.386 -26.912 1.00 35.67 C
ATOM 8289 O LYS C 218 -9.104 19.033 -27.849 1.00 36.40 O
ATOM 8290 CB LYS C 218 -10.390 16.040 -27.199 1.00 37.72 C
ATOM 8291 CG LYS C 218 -11.574 15.144 -26.920 1.00 40.54 C
ATOM 8292 CD LYS C 218 -11.179 13.693 -26.763 1.00 42.97 C
ATOM 8293 CE LYS C 218 -12.418 12.794 -26.675 1.00 42.43 C
ATOM 8294 NZ LYS C 218 -13.216 13.027 -25.453 1.00 39.85 N
ATOM 8295 N ILE C 219 -9.099 18.434 -25.672 1.00 33.08 N
ATOM 8296 CA ILE C 219 -7.946 19.257 -25.332 1.00 33.03 C
ATOM 8297 C ILE C 219 -7.000 18.528 -24.373 1.00 33.97 C
ATOM 8298 O ILE C 219 -7.420 17.695 -23.576 1.00 33.81 O
ATOM 8299 CB ILE C 219 -8.375 20.612 -24.675 1.00 31.66 C
ATOM 8300 CG1 ILE C 219 -9.313 20.361 -23.488 1.00 31.52 C
ATOM 8301 CG2 ILE C 219 -9.064 21.484 -25.674 1.00 28.35 C
ATOM 8302 CD1 ILE C 219 -9.683 21.620 -22.729 1.00 31.21 C
ATOM 8303 N PRO C 220 -5.700 18.840 -24.441 1.00 34.70 N
ATOM 8304 CA PRO C 220 -4.751 18.176 -23.542 1.00 35.16 C
ATOM 8305 C PRO C 220 -5.081 18.466 -22.068 1.00 35.81 C
ATOM 8306 O PRO C 220 -5.420 19.605 -21.703 1.00 35.05 O
ATOM 8307 CB PRO C 220 -3.415 18.780 -23.959 1.00 34.55 C
ATOM 8308 CG PRO C 220 -3.815 20.198 -24.353 1.00 34.87 C
ATOM 8309 CD PRO C 220 -5.057 19.943 -25.179 1.00 33.28 C
ATOM 8310 N PHE C 221 -4.980 17.438 -21.227 1.00 35.96 N
ATOM 8311 CA PHE C 221 -5.250 17.596 -19.800 1.00 35.19 C
ATOM 8312 C PHE C 221 -4.433 18.755 -19.239 1.00 35.76 C
ATOM 8313 O PHE C 221 -4.901 19.517 -18.391 1.00 34.50 O
ATOM 8314 CB PHE C 221 -4.884 16.336 -19.045 1.00 34.66 C
ATOM 8315 CG PHE C 221 -5.075 16.461 -17.572 1.00 34.81 C
ATOM 8316 CD1 PHE C 221 -6.326 16.244 -17.001 1.00 33.48 C
ATOM 8317 CD2 PHE C 221 -4.019 16.852 -16.756 1.00 33.47 C
ATOM 8318 CE1 PHE C 221 -6.517 16.420 -15.639 1.00 33.37 C
ATOM 8319 CE2 PHE C 221 -4.205 17.030 -15.383 1.00 34.42 C
ATOM 8320 CZ PHE C 221 -5.456 16.814 -14.824 1.00 32.58 C
ATOM 8321 N HIS C 222 -3.189 18.856 -19.696 1.00 37.71 N
ATOM 8322 CA HIS C 222 -2.309 19.941 -19.280 1.00 37.92 C
ATOM 8323 C HIS C 222 -2.181 20.919 -20.437 1.00 38.88 C
ATOM 8324 O HIS C 222 -1.956 20.506 -21.587 1.00 39.30 O
ATOM 8325 CB HIS C 222 -0.921 19.442 -18.947 1.00 37.57 C
ATOM 8326 CG HIS C 222 0.022 20.548 -18.614 1.00 40.66 C
ATOM 8327 ND1 HIS C 222 -0.126 21.337 -17.492 1.00 41.73 N
ATOM 8328 CD2 HIS C 222 1.102 21.029 -19.273 1.00 39.77 C
ATOM 8329 CE1 HIS C 222 0.824 22.252 -17.472 1.00 40.82 C
ATOM 8330 NE2 HIS C 222 1.582 22.087 -18.541 1.00 41.20 N
ATOM 8331 N PRO C 223 -2.292 22.227 -20.150 1.00 37.79 N
ATOM 8332 CA PRO C 223 -2.519 22.796 -18.825 1.00 37.38 C
ATOM 8333 C PRO C 223 -3.983 23.092 -18.504 1.00 36.69 C
ATOM 8334 O PRO C 223 -4.277 23.656 -17.455 1.00 38.54 O
ATOM 8335 CB PRO C 223 -1.728 24.081 -18.899 1.00 37.48 C
ATOM 8336 CG PRO C 223 -2.156 24.571 -20.265 1.00 36.94 C
ATOM 8337 CD PRO C 223 -2.035 23.307 -21.122 1.00 36.58 C
ATOM 8338 N TYR C 224 -4.908 22.735 -19.382 1.00 35.11 N
ATOM 8339 CA TYR C 224 -6.306 23.056 -19.114 1.00 35.67 C
ATOM 8340 C TYR C 224 -6.894 22.567 -17.801 1.00 35.49 C
ATOM 8341 O TYR C 224 -7.364 23.369 -16.979 1.00 33.76 O
ATOM 8342 CB TYR C 224 -7.167 22.610 -20.282 1.00 35.98 C
ATOM 8343 CG TYR C 224 -6.838 23.445 -21.487 1.00 37.29 C
ATOM 8344 CD1 TYR C 224 -6.303 22.864 -22.645 1.00 37.11 C
ATOM 8345 CD2 TYR C 224 -6.966 24.834 -21.442 1.00 33.63 C
ATOM 8346 CE1 TYR C 224 -5.898 23.650 -23.716 1.00 36.17 C
ATOM 8347 CE2 TYR C 224 -6.567 25.619 -22.508 1.00 36.17 C
ATOM 8348 CZ TYR C 224 -6.030 25.019 -23.642 1.00 34.96 C
ATOM 8349 OH TYR C 224 -5.608 25.794 -24.685 1.00 35.34 O
ATOM 8350 N TYR C 225 -6.854 21.260 -17.588 1.00 35.02 N
ATOM 8351 CA TYR C 225 -7.395 20.721 -16.364 1.00 34.42 C
ATOM 8352 C TYR C 225 -6.420 20.627 -15.207 1.00 34.68 C
ATOM 8353 O TYR C 225 -6.835 20.503 -14.058 1.00 35.89 O
ATOM 8354 CB TYR C 225 -8.072 19.392 -16.661 1.00 32.85 C
ATOM 8355 CG TYR C 225 -9.249 19.622 -17.571 1.00 31.18 C
ATOM 8356 CD1 TYR C 225 -9.201 19.285 -18.924 1.00 31.20 C
ATOM 8357 CD2 TYR C 225 -10.389 20.265 -17.093 1.00 31.57 C
ATOM 8358 CE1 TYR C 225 -10.269 19.586 -19.779 1.00 28.79 C
ATOM 8359 CE2 TYR C 225 -11.453 20.574 -17.931 1.00 29.57 C
ATOM 8360 CZ TYR C 225 -11.387 20.231 -19.263 1.00 28.72 C
ATOM 8361 OH TYR C 225 -12.460 20.515 -20.057 1.00 29.75 O
ATOM 8362 N SER C 226 -5.124 20.704 -15.477 1.00 35.75 N
ATOM 8363 CA SER C 226 -4.184 20.672 -14.360 1.00 35.79 C
ATOM 8364 C SER C 226 -4.424 21.993 -13.622 1.00 35.88 C
ATOM 8365 O SER C 226 -4.575 22.012 -12.407 1.00 34.67 O
ATOM 8366 CB SER C 226 -2.734 20.540 -14.860 1.00 34.34 C
ATOM 8367 OG SER C 226 -2.494 21.346 -15.996 1.00 35.98 O
ATOM 8368 N PHE C 227 -4.501 23.088 -14.379 1.00 36.95 N
ATOM 8369 CA PHE C 227 -4.767 24.415 -13.822 1.00 38.39 C
ATOM 8370 C PHE C 227 -6.168 24.499 -13.224 1.00 38.37 C
ATOM 8371 O PHE C 227 -6.362 25.060 -12.146 1.00 39.17 O
ATOM 8372 CB PHE C 227 -4.631 25.479 -14.899 1.00 40.76 C
ATOM 8373 CG PHE C 227 -3.247 26.014 -15.035 1.00 45.74 C
ATOM 8374 CD1 PHE C 227 -2.826 27.078 -14.264 1.00 47.84 C
ATOM 8375 CD2 PHE C 227 -2.338 25.424 -15.901 1.00 48.21 C
ATOM 8376 CE1 PHE C 227 -1.511 27.544 -14.352 1.00 49.87 C
ATOM 8377 CE2 PHE C 227 -1.029 25.886 -15.991 1.00 48.45 C
ATOM 8378 CZ PHE C 227 -0.616 26.943 -15.216 1.00 47.36 C
ATOM 8379 N LYS C 228 -7.154 23.956 -13.926 1.00 37.22 N
ATOM 8380 CA LYS C 228 -8.510 23.991 -13.406 1.00 36.61 C
ATOM 8381 C LYS C 228 -8.592 23.171 -12.109 1.00 38.06 C
ATOM 8382 O LYS C 228 -9.246 23.579 -11.137 1.00 36.31 O
ATOM 8383 CB LYS C 228 -9.489 23.442 -14.439 1.00 34.38 C
ATOM 8384 CG LYS C 228 -10.932 23.607 -14.030 1.00 32.61 C
ATOM 8385 CD LYS C 228 -11.891 23.306 -15.162 1.00 32.56 C
ATOM 8386 CE LYS C 228 -13.297 23.711 -14.767 1.00 33.96 C
ATOM 8387 NZ LYS C 228 -14.288 23.512 -15.839 1.00 31.37 N
ATOM 8388 N ASP C 229 -7.907 22.025 -12.089 1.00 38.22 N
ATOM 8389 CA ASP C 229 -7.914 21.157 -10.913 1.00 38.79 C
ATOM 8390 C ASP C 229 -7.238 21.779 -9.697 1.00 38.67 C
ATOM 8391 O ASP C 229 -7.744 21.683 -8.586 1.00 38.47 O
ATOM 8392 CB ASP C 229 -7.291 19.794 -11.247 1.00 38.65 C
ATOM 8393 CG ASP C 229 -8.299 18.830 -11.895 1.00 40.38 C
ATOM 8394 OD1 ASP C 229 -7.939 17.652 -12.131 1.00 39.68 O
ATOM 8395 OD2 ASP C 229 -9.452 19.254 -12.165 1.00 39.31 O
ATOM 8396 N ILE C 230 -6.099 22.424 -9.908 1.00 40.39 N
ATOM 8397 CA ILE C 230 -5.380 23.089 -8.827 1.00 39.65 C
ATOM 8398 C ILE C 230 -6.248 24.209 -8.270 1.00 38.21 C
ATOM 8399 O ILE C 230 -6.195 24.521 -7.079 1.00 37.24 O
ATOM 8400 CB ILE C 230 -4.073 23.705 -9.347 1.00 42.08 C
ATOM 8401 CG1 ILE C 230 -3.135 22.592 -9.798 1.00 43.54 C
ATOM 8402 CG2 ILE C 230 -3.430 24.553 -8.272 1.00 41.30 C
ATOM 8403 CD1 ILE C 230 -1.896 23.103 -10.455 1.00 47.90 C
ATOM 8404 N LEU C 231 -7.035 24.833 -9.141 1.00 36.56 N
ATOM 8405 CA LEU C 231 -7.908 25.907 -8.691 1.00 37.09 C
ATOM 8406 C LEU C 231 -9.003 25.311 -7.808 1.00 37.53 C
ATOM 8407 O LEU C 231 -9.268 25.812 -6.708 1.00 38.33 O
ATOM 8408 CB LEU C 231 -8.525 26.648 -9.884 1.00 35.25 C
ATOM 8409 CG LEU C 231 -9.637 27.648 -9.534 1.00 34.21 C
ATOM 8410 CD1 LEU C 231 -9.172 28.660 -8.494 1.00 31.40 C
ATOM 8411 CD2 LEU C 231 -10.077 28.339 -10.801 1.00 34.70 C
ATOM 8412 N GLY C 232 -9.628 24.239 -8.294 1.00 37.20 N
ATOM 8413 CA GLY C 232 -10.668 23.577 -7.534 1.00 36.47 C
ATOM 8414 C GLY C 232 -10.113 23.110 -6.204 1.00 38.68 C
ATOM 8415 O GLY C 232 -10.811 23.106 -5.188 1.00 39.07 O
ATOM 8416 N LEU C 233 -8.843 22.726 -6.192 1.00 38.88 N
ATOM 8417 CA LEU C 233 -8.232 22.275 -4.961 1.00 39.48 C
ATOM 8418 C LEU C 233 -8.227 23.381 -3.932 1.00 41.45 C
ATOM 8419 O LEU C 233 -8.706 23.184 -2.822 1.00 45.05 O
ATOM 8420 CB LEU C 233 -6.805 21.797 -5.198 1.00 39.41 C
ATOM 8421 CG LEU C 233 -6.042 21.427 -3.922 1.00 41.16 C
ATOM 8422 CD1 LEU C 233 -6.868 20.422 -3.121 1.00 42.12 C
ATOM 8423 CD2 LEU C 233 -4.666 20.873 -4.251 1.00 38.53 C
ATOM 8424 N THR C 234 -7.703 24.549 -4.288 1.00 42.36 N
ATOM 8425 CA THR C 234 -7.645 25.660 -3.337 1.00 44.03 C
ATOM 8426 C THR C 234 -9.015 26.216 -2.942 1.00 44.69 C
ATOM 8427 O THR C 234 -9.155 26.802 -1.865 1.00 44.71 O
ATOM 8428 CB THR C 234 -6.777 26.826 -3.868 1.00 44.84 C
ATOM 8429 OG1 THR C 234 -7.488 27.524 -4.897 1.00 48.26 O
ATOM 8430 CG2 THR C 234 -5.467 26.292 -4.440 1.00 43.82 C
ATOM 8431 N LEU C 235 -10.019 26.051 -3.806 1.00 44.83 N
ATOM 8432 CA LEU C 235 -11.357 26.527 -3.481 1.00 45.43 C
ATOM 8433 C LEU C 235 -11.980 25.673 -2.381 1.00 47.94 C
ATOM 8434 O LEU C 235 -12.602 26.199 -1.464 1.00 49.50 O
ATOM 8435 CB LEU C 235 -12.250 26.513 -4.710 1.00 43.24 C
ATOM 8436 CG LEU C 235 -11.944 27.621 -5.714 1.00 42.58 C
ATOM 8437 CD1 LEU C 235 -12.862 27.478 -6.900 1.00 41.23 C
ATOM 8438 CD2 LEU C 235 -12.118 28.986 -5.069 1.00 40.10 C
ATOM 8439 N MET C 236 -11.805 24.357 -2.459 1.00 49.92 N
ATOM 8440 CA MET C 236 -12.349 23.461 -1.439 1.00 51.99 C
ATOM 8441 C MET C 236 -11.452 23.436 -0.212 1.00 52.42 C
ATOM 8442 O MET C 236 -11.893 23.128 0.896 1.00 53.64 O
ATOM 8443 CB MET C 236 -12.480 22.043 -1.983 1.00 53.87 C
ATOM 8444 CG MET C 236 -13.559 21.890 -3.047 1.00 60.04 C
ATOM 8445 SD MET C 236 -15.237 22.012 -2.405 1.00 62.57 S
ATOM 8446 CE MET C 236 -15.371 20.368 -1.583 1.00 60.02 C
ATOM 8447 N LEU C 237 -10.189 23.776 -0.405 1.00 51.24 N
ATOM 8448 CA LEU C 237 -9.245 23.771 0.693 1.00 50.25 C
ATOM 8449 C LEU C 237 -9.524 24.861 1.723 1.00 49.54 C
ATOM 8450 O LEU C 237 -9.141 24.726 2.886 1.00 49.98 O
ATOM 8451 CB LEU C 237 -7.835 23.919 0.142 1.00 50.68 C
ATOM 8452 CG LEU C 237 -6.705 23.350 0.996 1.00 52.15 C
ATOM 8453 CD1 LEU C 237 -6.997 21.889 1.362 1.00 50.40 C
ATOM 8454 CD2 LEU C 237 -5.406 23.474 0.209 1.00 52.61 C
ATOM 8455 N THR C 238 -10.188 25.937 1.309 1.00 49.03 N
ATOM 8456 CA THR C 238 -10.502 27.027 2.234 1.00 48.45 C
ATOM 8457 C THR C 238 -11.508 26.584 3.309 1.00 47.61 C
ATOM 8458 O THR C 238 -11.217 26.666 4.504 1.00 48.71 O
ATOM 8459 CB THR C 238 -11.035 28.250 1.475 1.00 48.65 C
ATOM 8460 OG1 THR C 238 -9.995 28.771 0.644 1.00 48.07 O
ATOM 8461 CG2 THR C 238 -11.480 29.323 2.435 1.00 48.73 C
ATOM 8462 N PRO C 239 -12.702 26.110 2.905 1.00 45.69 N
ATOM 8463 CA PRO C 239 -13.691 25.664 3.895 1.00 43.80 C
ATOM 8464 C PRO C 239 -13.073 24.620 4.826 1.00 43.47 C
ATOM 8465 O PRO C 239 -13.206 24.703 6.042 1.00 44.59 O
ATOM 8466 CB PRO C 239 -14.791 25.071 3.034 1.00 44.75 C
ATOM 8467 CG PRO C 239 -14.716 25.913 1.790 1.00 44.28 C
ATOM 8468 CD PRO C 239 -13.241 26.008 1.537 1.00 43.67 C
ATOM 8469 N PHE C 240 -12.388 23.643 4.239 1.00 42.31 N
ATOM 8470 CA PHE C 240 -11.713 22.578 4.984 1.00 41.86 C
ATOM 8471 C PHE C 240 -10.845 23.185 6.074 1.00 41.20 C
ATOM 8472 O PHE C 240 -11.003 22.871 7.251 1.00 41.36 O
ATOM 8473 CB PHE C 240 -10.836 21.740 4.026 1.00 43.53 C
ATOM 8474 CG PHE C 240 -9.991 20.664 4.702 1.00 43.12 C
ATOM 8475 CD1 PHE C 240 -8.759 20.296 4.166 1.00 45.08 C
ATOM 8476 CD2 PHE C 240 -10.418 20.018 5.842 1.00 43.70 C
ATOM 8477 CE1 PHE C 240 -7.966 19.301 4.760 1.00 43.95 C
ATOM 8478 CE2 PHE C 240 -9.632 19.030 6.438 1.00 44.54 C
ATOM 8479 CZ PHE C 240 -8.403 18.676 5.891 1.00 43.61 C
ATOM 8480 N LEU C 241 -9.921 24.051 5.684 1.00 41.36 N
ATOM 8481 CA LEU C 241 -9.045 24.678 6.667 1.00 42.43 C
ATOM 8482 C LEU C 241 -9.779 25.611 7.626 1.00 41.14 C
ATOM 8483 O LEU C 241 -9.427 25.690 8.801 1.00 39.92 O
ATOM 8484 CB LEU C 241 -7.916 25.434 5.971 1.00 42.14 C
ATOM 8485 CG LEU C 241 -6.993 24.535 5.157 1.00 40.24 C
ATOM 8486 CD1 LEU C 241 -5.803 25.349 4.741 1.00 41.73 C
ATOM 8487 CD2 LEU C 241 -6.556 23.331 5.968 1.00 37.56 C
ATOM 8488 N THR C 242 -10.791 26.312 7.122 1.00 41.24 N
ATOM 8489 CA THR C 242 -11.584 27.212 7.952 1.00 43.01 C
ATOM 8490 C THR C 242 -12.282 26.397 9.035 1.00 44.98 C
ATOM 8491 O THR C 242 -12.290 26.767 10.215 1.00 45.22 O
ATOM 8492 CB THR C 242 -12.646 27.932 7.128 1.00 42.46 C
ATOM 8493 OG1 THR C 242 -12.001 28.809 6.197 1.00 41.64 O
ATOM 8494 CG2 THR C 242 -13.586 28.724 8.039 1.00 39.51 C
ATOM 8495 N LEU C 243 -12.865 25.279 8.625 1.00 45.22 N
ATOM 8496 CA LEU C 243 -13.536 24.404 9.565 1.00 46.16 C
ATOM 8497 C LEU C 243 -12.509 23.871 10.554 1.00 45.12 C
ATOM 8498 O LEU C 243 -12.624 24.071 11.749 1.00 47.48 O
ATOM 8499 CB LEU C 243 -14.182 23.243 8.822 1.00 48.61 C
ATOM 8500 CG LEU C 243 -15.019 22.305 9.681 1.00 50.29 C
ATOM 8501 CD1 LEU C 243 -16.232 23.058 10.210 1.00 49.98 C
ATOM 8502 CD2 LEU C 243 -15.443 21.107 8.845 1.00 50.95 C
ATOM 8503 N ALA C 244 -11.492 23.199 10.046 1.00 43.92 N
ATOM 8504 CA ALA C 244 -10.468 22.643 10.907 1.00 44.82 C
ATOM 8505 C ALA C 244 -9.769 23.654 11.807 1.00 45.01 C
ATOM 8506 O ALA C 244 -9.397 23.339 12.935 1.00 47.19 O
ATOM 8507 CB ALA C 244 -9.426 21.901 10.068 1.00 44.87 C
ATOM 8508 N LEU C 245 -9.568 24.868 11.327 1.00 44.95 N
ATOM 8509 CA LEU C 245 -8.866 25.839 12.151 1.00 43.87 C
ATOM 8510 C LEU C 245 -9.727 26.767 12.989 1.00 43.64 C
ATOM 8511 O LEU C 245 -9.247 27.315 13.978 1.00 43.67 O
ATOM 8512 CB LEU C 245 -7.918 26.667 11.292 1.00 42.26 C
ATOM 8513 CG LEU C 245 -6.662 25.931 10.863 1.00 40.58 C
ATOM 8514 CD1 LEU C 245 -5.746 26.887 10.115 1.00 39.15 C
ATOM 8515 CD2 LEU C 245 -5.967 25.393 12.102 1.00 40.13 C
ATOM 8516 N PHE C 246 -10.988 26.950 12.613 1.00 42.56 N
ATOM 8517 CA PHE C 246 -11.844 27.837 13.384 1.00 42.85 C
ATOM 8518 C PHE C 246 -13.012 27.142 14.063 1.00 43.96 C
ATOM 8519 O PHE C 246 -13.662 27.733 14.919 1.00 45.15 O
ATOM 8520 CB PHE C 246 -12.371 28.962 12.498 1.00 42.10 C
ATOM 8521 CG PHE C 246 -11.307 29.934 12.060 1.00 44.00 C
ATOM 8522 CD1 PHE C 246 -10.937 30.033 10.717 1.00 41.97 C
ATOM 8523 CD2 PHE C 246 -10.674 30.756 12.989 1.00 43.52 C
ATOM 8524 CE1 PHE C 246 -9.962 30.932 10.313 1.00 40.81 C
ATOM 8525 CE2 PHE C 246 -9.694 31.662 12.585 1.00 43.33 C
ATOM 8526 CZ PHE C 246 -9.343 31.745 11.243 1.00 41.51 C
ATOM 8527 N SER C 247 -13.258 25.885 13.705 1.00 43.71 N
ATOM 8528 CA SER C 247 -14.370 25.136 14.260 1.00 41.86 C
ATOM 8529 C SER C 247 -14.044 23.634 14.233 1.00 41.65 C
ATOM 8530 O SER C 247 -14.800 22.820 13.698 1.00 41.74 O
ATOM 8531 CB SER C 247 -15.596 25.442 13.419 1.00 41.43 C
ATOM 8532 OG SER C 247 -16.772 25.013 14.064 1.00 49.56 O
ATOM 8533 N PRO C 248 -12.921 23.249 14.852 1.00 41.43 N
ATOM 8534 CA PRO C 248 -12.422 21.871 14.930 1.00 40.86 C
ATOM 8535 C PRO C 248 -13.440 20.837 15.336 1.00 41.54 C
ATOM 8536 O PRO C 248 -13.402 19.704 14.866 1.00 44.07 O
ATOM 8537 CB PRO C 248 -11.319 21.944 15.980 1.00 39.25 C
ATOM 8538 CG PRO C 248 -10.956 23.366 16.040 1.00 41.77 C
ATOM 8539 CD PRO C 248 -12.249 24.090 15.853 1.00 41.66 C
ATOM 8540 N ASN C 249 -14.354 21.223 16.211 1.00 42.02 N
ATOM 8541 CA ASN C 249 -15.323 20.271 16.725 1.00 41.86 C
ATOM 8542 C ASN C 249 -16.740 20.450 16.250 1.00 41.22 C
ATOM 8543 O ASN C 249 -17.666 19.878 16.811 1.00 43.78 O
ATOM 8544 CB ASN C 249 -15.281 20.312 18.244 1.00 43.54 C
ATOM 8545 CG ASN C 249 -13.874 20.132 18.779 1.00 47.98 C
ATOM 8546 OD1 ASN C 249 -13.188 19.158 18.434 1.00 48.42 O
ATOM 8547 ND2 ASN C 249 -13.426 21.075 19.621 1.00 48.90 N
ATOM 8548 N LEU C 250 -16.930 21.241 15.217 1.00 38.57 N
ATOM 8549 CA LEU C 250 -18.270 21.431 14.738 1.00 38.18 C
ATOM 8550 C LEU C 250 -18.927 20.089 14.376 1.00 38.29 C
ATOM 8551 O LEU C 250 -20.079 19.846 14.691 1.00 38.89 O
ATOM 8552 CB LEU C 250 -18.243 22.346 13.515 1.00 39.36 C
ATOM 8553 CG LEU C 250 -19.609 22.684 12.928 1.00 39.82 C
ATOM 8554 CD1 LEU C 250 -20.314 23.667 13.837 1.00 38.95 C
ATOM 8555 CD2 LEU C 250 -19.431 23.261 11.548 1.00 40.22 C
ATOM 8556 N LEU C 251 -18.180 19.198 13.745 1.00 39.04 N
ATOM 8557 CA LEU C 251 -18.745 17.930 13.296 1.00 40.31 C
ATOM 8558 C LEU C 251 -18.700 16.705 14.220 1.00 40.39 C
ATOM 8559 O LEU C 251 -19.376 15.708 13.944 1.00 41.65 O
ATOM 8560 CB LEU C 251 -18.106 17.560 11.951 1.00 40.23 C
ATOM 8561 CG LEU C 251 -18.251 18.614 10.855 1.00 40.83 C
ATOM 8562 CD1 LEU C 251 -17.365 18.254 9.678 1.00 39.14 C
ATOM 8563 CD2 LEU C 251 -19.725 18.723 10.445 1.00 40.52 C
ATOM 8564 N GLY C 252 -17.920 16.765 15.297 1.00 38.30 N
ATOM 8565 CA GLY C 252 -17.813 15.621 16.186 1.00 37.12 C
ATOM 8566 C GLY C 252 -18.754 15.597 17.373 1.00 36.37 C
ATOM 8567 O GLY C 252 -19.283 16.630 17.778 1.00 39.41 O
ATOM 8568 N ASP C 253 -18.943 14.417 17.950 1.00 33.53 N
ATOM 8569 CA ASP C 253 -19.831 14.266 19.083 1.00 33.70 C
ATOM 8570 C ASP C 253 -19.059 14.463 20.368 1.00 33.53 C
ATOM 8571 O ASP C 253 -18.096 13.744 20.636 1.00 35.01 O
ATOM 8572 CB ASP C 253 -20.453 12.873 19.092 1.00 35.14 C
ATOM 8573 CG ASP C 253 -21.607 12.758 20.074 1.00 38.55 C
ATOM 8574 OD1 ASP C 253 -21.479 13.251 21.221 1.00 38.38 O
ATOM 8575 OD2 ASP C 253 -22.645 12.166 19.700 1.00 43.23 O
ATOM 8576 N PRO C 254 -19.474 15.433 21.195 1.00 31.96 N
ATOM 8577 CA PRO C 254 -18.768 15.672 22.460 1.00 30.04 C
ATOM 8578 C PRO C 254 -18.591 14.398 23.265 1.00 29.10 C
ATOM 8579 O PRO C 254 -17.697 14.292 24.117 1.00 30.61 O
ATOM 8580 CB PRO C 254 -19.667 16.674 23.181 1.00 29.05 C
ATOM 8581 CG PRO C 254 -21.016 16.431 22.566 1.00 31.03 C
ATOM 8582 CD PRO C 254 -20.693 16.250 21.113 1.00 29.48 C
ATOM 8583 N GLU C 255 -19.446 13.428 22.979 1.00 26.70 N
ATOM 8584 CA GLU C 255 -19.417 12.166 23.690 1.00 26.90 C
ATOM 8585 C GLU C 255 -18.085 11.451 23.464 1.00 26.79 C
ATOM 8586 O GLU C 255 -17.672 10.622 24.285 1.00 27.49 O
ATOM 8587 CB GLU C 255 -20.587 11.301 23.237 1.00 25.81 C
ATOM 8588 CG GLU C 255 -20.841 10.112 24.098 1.00 35.28 C
ATOM 8589 CD GLU C 255 -21.700 10.421 25.325 1.00 40.24 C
ATOM 8590 OE1 GLU C 255 -22.870 10.860 25.140 1.00 41.30 O
ATOM 8591 OE2 GLU C 255 -21.207 10.209 26.469 1.00 40.78 O
ATOM 8592 N ASN C 256 -17.385 11.797 22.382 1.00 25.60 N
ATOM 8593 CA ASN C 256 -16.123 11.128 22.099 1.00 25.48 C
ATOM 8594 C ASN C 256 -14.939 11.708 22.813 1.00 25.78 C
ATOM 8595 O ASN C 256 -13.795 11.357 22.521 1.00 27.18 O
ATOM 8596 CB ASN C 256 -15.854 11.060 20.606 1.00 26.60 C
ATOM 8597 CG ASN C 256 -15.497 9.650 20.150 1.00 29.81 C
ATOM 8598 OD1 ASN C 256 -15.892 8.658 20.779 1.00 31.76 O
ATOM 8599 ND2 ASN C 256 -14.769 9.550 19.044 1.00 33.13 N
ATOM 8600 N PHE C 257 -15.216 12.605 23.750 1.00 25.51 N
ATOM 8601 CA PHE C 257 -14.177 13.193 24.569 1.00 23.77 C
ATOM 8602 C PHE C 257 -14.264 12.513 25.927 1.00 25.03 C
ATOM 8603 O PHE C 257 -13.685 12.959 26.913 1.00 25.83 O
ATOM 8604 CB PHE C 257 -14.399 14.678 24.720 1.00 23.25 C
ATOM 8605 CG PHE C 257 -13.888 15.482 23.569 1.00 22.60 C
ATOM 8606 CD1 PHE C 257 -14.727 15.849 22.532 1.00 19.56 C
ATOM 8607 CD2 PHE C 257 -12.554 15.904 23.541 1.00 21.18 C
ATOM 8608 CE1 PHE C 257 -14.234 16.644 21.473 1.00 21.10 C
ATOM 8609 CE2 PHE C 257 -12.063 16.687 22.496 1.00 20.47 C
ATOM 8610 CZ PHE C 257 -12.896 17.061 21.460 1.00 15.02 C
ATOM 8611 N THR C 258 -15.009 11.419 25.969 1.00 25.82 N
ATOM 8612 CA THR C 258 -15.160 10.664 27.191 1.00 27.42 C
ATOM 8613 C THR C 258 -14.725 9.226 26.939 1.00 28.28 C
ATOM 8614 O THR C 258 -15.315 8.537 26.103 1.00 30.12 O
ATOM 8615 CB THR C 258 -16.616 10.639 27.650 1.00 28.08 C
ATOM 8616 OG1 THR C 258 -17.050 11.972 27.910 1.00 29.53 O
ATOM 8617 CG2 THR C 258 -16.762 9.803 28.903 1.00 23.01 C
ATOM 8618 N PRO C 259 -13.691 8.754 27.654 1.00 26.69 N
ATOM 8619 CA PRO C 259 -13.209 7.384 27.484 1.00 25.79 C
ATOM 8620 C PRO C 259 -14.341 6.365 27.451 1.00 26.19 C
ATOM 8621 O PRO C 259 -15.239 6.389 28.281 1.00 26.02 O
ATOM 8622 CB PRO C 259 -12.304 7.189 28.700 1.00 23.10 C
ATOM 8623 CG PRO C 259 -11.694 8.496 28.854 1.00 23.52 C
ATOM 8624 CD PRO C 259 -12.862 9.471 28.638 1.00 25.62 C
ATOM 8625 N ALA C 260 -14.276 5.470 26.479 1.00 28.23 N
ATOM 8626 CA ALA C 260 -15.254 4.409 26.328 1.00 28.72 C
ATOM 8627 C ALA C 260 -15.548 3.766 27.668 1.00 29.58 C
ATOM 8628 O ALA C 260 -14.627 3.488 28.423 1.00 29.37 O
ATOM 8629 CB ALA C 260 -14.714 3.358 25.383 1.00 26.45 C
ATOM 8630 N ASN C 261 -16.832 3.542 27.944 1.00 30.63 N
ATOM 8631 CA ASN C 261 -17.301 2.895 29.165 1.00 31.99 C
ATOM 8632 C ASN C 261 -18.232 1.767 28.737 1.00 34.40 C
ATOM 8633 O ASN C 261 -19.357 2.007 28.290 1.00 34.58 O
ATOM 8634 CB ASN C 261 -18.094 3.871 30.018 1.00 33.32 C
ATOM 8635 CG ASN C 261 -18.575 3.251 31.314 1.00 34.23 C
ATOM 8636 OD1 ASN C 261 -18.840 2.047 31.389 1.00 34.10 O
ATOM 8637 ND2 ASN C 261 -18.712 4.076 32.339 1.00 34.03 N
ATOM 8638 N PRO C 262 -17.784 0.516 28.874 1.00 37.65 N
ATOM 8639 CA PRO C 262 -18.576 -0.663 28.489 1.00 39.04 C
ATOM 8640 C PRO C 262 -19.932 -0.776 29.159 1.00 38.43 C
ATOM 8641 O PRO C 262 -20.838 -1.370 28.604 1.00 38.52 O
ATOM 8642 CB PRO C 262 -17.674 -1.836 28.874 1.00 39.38 C
ATOM 8643 CG PRO C 262 -16.294 -1.261 28.763 1.00 39.97 C
ATOM 8644 CD PRO C 262 -16.463 0.112 29.384 1.00 38.89 C
ATOM 8645 N LEU C 263 -20.065 -0.193 30.343 1.00 38.81 N
ATOM 8646 CA LEU C 263 -21.302 -0.288 31.107 1.00 40.89 C
ATOM 8647 C LEU C 263 -22.315 0.828 30.935 1.00 43.44 C
ATOM 8648 O LEU C 263 -23.473 0.666 31.296 1.00 47.31 O
ATOM 8649 CB LEU C 263 -20.963 -0.424 32.586 1.00 40.51 C
ATOM 8650 CG LEU C 263 -20.067 -1.625 32.901 1.00 38.55 C
ATOM 8651 CD1 LEU C 263 -19.464 -1.504 34.280 1.00 35.84 C
ATOM 8652 CD2 LEU C 263 -20.890 -2.880 32.755 1.00 38.04 C
ATOM 8653 N VAL C 264 -21.895 1.959 30.392 1.00 43.83 N
ATOM 8654 CA VAL C 264 -22.814 3.062 30.183 1.00 43.88 C
ATOM 8655 C VAL C 264 -22.914 3.422 28.709 1.00 45.55 C
ATOM 8656 O VAL C 264 -21.913 3.771 28.093 1.00 46.64 O
ATOM 8657 CB VAL C 264 -22.349 4.297 30.949 1.00 42.56 C
ATOM 8658 CG1 VAL C 264 -23.338 5.413 30.776 1.00 38.78 C
ATOM 8659 CG2 VAL C 264 -22.161 3.944 32.401 1.00 40.99 C
ATOM 8660 N THR C 265 -24.112 3.322 28.140 1.00 47.12 N
ATOM 8661 CA THR C 265 -24.305 3.682 26.738 1.00 47.79 C
ATOM 8662 C THR C 265 -24.825 5.109 26.671 1.00 46.59 C
ATOM 8663 O THR C 265 -25.712 5.492 27.418 1.00 46.08 O
ATOM 8664 CB THR C 265 -25.323 2.769 26.042 1.00 49.61 C
ATOM 8665 OG1 THR C 265 -24.842 1.420 26.066 1.00 51.84 O
ATOM 8666 CG2 THR C 265 -25.520 3.202 24.591 1.00 50.15 C
ATOM 8667 N PRO C 266 -24.268 5.923 25.777 1.00 46.57 N
ATOM 8668 CA PRO C 266 -24.746 7.304 25.683 1.00 46.68 C
ATOM 8669 C PRO C 266 -26.243 7.382 25.381 1.00 46.62 C
ATOM 8670 O PRO C 266 -26.776 6.585 24.625 1.00 45.59 O
ATOM 8671 CB PRO C 266 -23.888 7.887 24.561 1.00 45.83 C
ATOM 8672 CG PRO C 266 -22.603 7.136 24.705 1.00 45.89 C
ATOM 8673 CD PRO C 266 -23.081 5.712 24.932 1.00 46.15 C
ATOM 8674 N PRO C 267 -26.932 8.363 25.968 1.00 48.41 N
ATOM 8675 CA PRO C 267 -28.365 8.568 25.788 1.00 49.92 C
ATOM 8676 C PRO C 267 -28.742 8.695 24.332 1.00 52.25 C
ATOM 8677 O PRO C 267 -29.725 8.108 23.888 1.00 54.48 O
ATOM 8678 CB PRO C 267 -28.625 9.855 26.549 1.00 49.63 C
ATOM 8679 CG PRO C 267 -27.572 9.855 27.587 1.00 50.03 C
ATOM 8680 CD PRO C 267 -26.371 9.433 26.805 1.00 49.78 C
ATOM 8681 N HIS C 268 -27.980 9.473 23.581 1.00 54.66 N
ATOM 8682 CA HIS C 268 -28.293 9.626 22.167 1.00 57.79 C
ATOM 8683 C HIS C 268 -27.112 9.301 21.270 1.00 57.99 C
ATOM 8684 O HIS C 268 -26.263 10.144 20.949 1.00 60.15 O
ATOM 8685 CB HIS C 268 -28.839 11.024 21.886 1.00 61.71 C
ATOM 8686 CG HIS C 268 -30.173 11.278 22.520 1.00 66.83 C
ATOM 8687 ND1 HIS C 268 -30.311 11.857 23.768 1.00 67.50 N
ATOM 8688 CD2 HIS C 268 -31.426 10.961 22.109 1.00 67.88 C
ATOM 8689 CE1 HIS C 268 -31.591 11.882 24.098 1.00 69.32 C
ATOM 8690 NE2 HIS C 268 -32.289 11.345 23.109 1.00 70.86 N
ATOM 8691 N ILE C 269 -27.068 8.029 20.903 1.00 55.66 N
ATOM 8692 CA ILE C 269 -26.044 7.486 20.049 1.00 53.07 C
ATOM 8693 C ILE C 269 -26.362 7.999 18.657 1.00 52.23 C
ATOM 8694 O ILE C 269 -27.394 7.653 18.083 1.00 54.45 O
ATOM 8695 CB ILE C 269 -26.105 5.945 20.115 1.00 52.38 C
ATOM 8696 CG1 ILE C 269 -25.116 5.453 21.158 1.00 53.67 C
ATOM 8697 CG2 ILE C 269 -25.870 5.325 18.763 1.00 52.47 C
ATOM 8698 CD1 ILE C 269 -25.110 3.956 21.346 1.00 56.03 C
ATOM 8699 N LYS C 270 -25.497 8.846 18.121 1.00 48.99 N
ATOM 8700 CA LYS C 270 -25.730 9.384 16.798 1.00 47.02 C
ATOM 8701 C LYS C 270 -24.446 9.293 15.982 1.00 44.33 C
ATOM 8702 O LYS C 270 -23.388 9.734 16.429 1.00 46.21 O
ATOM 8703 CB LYS C 270 -26.227 10.834 16.911 1.00 48.91 C
ATOM 8704 CG LYS C 270 -25.534 11.822 15.987 1.00 51.88 C
ATOM 8705 CD LYS C 270 -26.166 13.203 16.008 1.00 54.40 C
ATOM 8706 CE LYS C 270 -25.390 14.132 15.070 1.00 59.40 C
ATOM 8707 NZ LYS C 270 -26.079 15.435 14.756 1.00 63.24 N
ATOM 8708 N PRO C 271 -24.523 8.706 14.775 1.00 40.55 N
ATOM 8709 CA PRO C 271 -23.370 8.546 13.884 1.00 36.91 C
ATOM 8710 C PRO C 271 -22.880 9.824 13.235 1.00 35.30 C
ATOM 8711 O PRO C 271 -23.550 10.855 13.269 1.00 35.42 O
ATOM 8712 CB PRO C 271 -23.870 7.542 12.850 1.00 35.93 C
ATOM 8713 CG PRO C 271 -25.310 7.842 12.767 1.00 37.71 C
ATOM 8714 CD PRO C 271 -25.703 8.023 14.216 1.00 39.59 C
ATOM 8715 N GLU C 272 -21.691 9.739 12.654 1.00 32.87 N
ATOM 8716 CA GLU C 272 -21.096 10.851 11.959 1.00 30.39 C
ATOM 8717 C GLU C 272 -22.068 11.282 10.855 1.00 30.86 C
ATOM 8718 O GLU C 272 -22.834 10.466 10.324 1.00 29.53 O
ATOM 8719 CB GLU C 272 -19.753 10.413 11.403 1.00 31.34 C
ATOM 8720 CG GLU C 272 -18.700 10.198 12.499 1.00 35.50 C
ATOM 8721 CD GLU C 272 -18.338 11.483 13.244 1.00 37.71 C
ATOM 8722 OE1 GLU C 272 -17.626 12.329 12.663 1.00 38.10 O
ATOM 8723 OE2 GLU C 272 -18.778 11.653 14.408 1.00 38.77 O
ATOM 8724 N TRP C 273 -22.049 12.568 10.511 1.00 30.26 N
ATOM 8725 CA TRP C 273 -22.979 13.085 9.518 1.00 27.18 C
ATOM 8726 C TRP C 273 -23.074 12.312 8.233 1.00 27.68 C
ATOM 8727 O TRP C 273 -24.161 12.195 7.681 1.00 29.64 O
ATOM 8728 CB TRP C 273 -22.671 14.544 9.189 1.00 25.76 C
ATOM 8729 CG TRP C 273 -21.456 14.738 8.346 1.00 25.87 C
ATOM 8730 CD1 TRP C 273 -20.168 14.931 8.777 1.00 24.64 C
ATOM 8731 CD2 TRP C 273 -21.400 14.694 6.919 1.00 23.74 C
ATOM 8732 NE1 TRP C 273 -19.318 15.006 7.704 1.00 23.68 N
ATOM 8733 CE2 TRP C 273 -20.046 14.861 6.551 1.00 22.93 C
ATOM 8734 CE3 TRP C 273 -22.361 14.525 5.919 1.00 21.51 C
ATOM 8735 CZ2 TRP C 273 -19.630 14.862 5.225 1.00 23.24 C
ATOM 8736 CZ3 TRP C 273 -21.948 14.525 4.596 1.00 24.97 C
ATOM 8737 CH2 TRP C 273 -20.590 14.692 4.260 1.00 25.79 C
ATOM 8738 N TYR C 274 -21.966 11.769 7.745 1.00 28.39 N
ATOM 8739 CA TYR C 274 -22.019 11.067 6.461 1.00 30.54 C
ATOM 8740 C TYR C 274 -22.652 9.687 6.496 1.00 32.58 C
ATOM 8741 O TYR C 274 -22.780 9.014 5.465 1.00 34.01 O
ATOM 8742 CB TYR C 274 -20.627 10.998 5.831 1.00 28.35 C
ATOM 8743 CG TYR C 274 -19.561 10.530 6.781 1.00 27.77 C
ATOM 8744 CD1 TYR C 274 -19.400 9.180 7.060 1.00 26.51 C
ATOM 8745 CD2 TYR C 274 -18.701 11.436 7.393 1.00 26.71 C
ATOM 8746 CE1 TYR C 274 -18.416 8.743 7.913 1.00 25.68 C
ATOM 8747 CE2 TYR C 274 -17.706 11.004 8.256 1.00 26.62 C
ATOM 8748 CZ TYR C 274 -17.575 9.646 8.507 1.00 27.14 C
ATOM 8749 OH TYR C 274 -16.596 9.175 9.351 1.00 30.14 O
ATOM 8750 N PHE C 275 -23.071 9.259 7.675 1.00 32.73 N
ATOM 8751 CA PHE C 275 -23.706 7.962 7.772 1.00 32.60 C
ATOM 8752 C PHE C 275 -25.165 8.111 8.204 1.00 31.27 C
ATOM 8753 O PHE C 275 -25.910 7.139 8.206 1.00 32.76 O
ATOM 8754 CB PHE C 275 -22.938 7.063 8.755 1.00 33.60 C
ATOM 8755 CG PHE C 275 -23.531 5.686 8.908 1.00 34.36 C
ATOM 8756 CD1 PHE C 275 -23.564 4.802 7.842 1.00 37.41 C
ATOM 8757 CD2 PHE C 275 -24.092 5.287 10.108 1.00 36.67 C
ATOM 8758 CE1 PHE C 275 -24.154 3.536 7.977 1.00 37.08 C
ATOM 8759 CE2 PHE C 275 -24.687 4.021 10.248 1.00 35.69 C
ATOM 8760 CZ PHE C 275 -24.713 3.154 9.182 1.00 34.78 C
ATOM 8761 N LEU C 276 -25.572 9.329 8.553 1.00 29.55 N
ATOM 8762 CA LEU C 276 -26.939 9.594 9.012 1.00 28.57 C
ATOM 8763 C LEU C 276 -28.060 9.101 8.098 1.00 29.73 C
ATOM 8764 O LEU C 276 -28.929 8.373 8.549 1.00 30.19 O
ATOM 8765 CB LEU C 276 -27.116 11.084 9.284 1.00 26.20 C
ATOM 8766 CG LEU C 276 -26.357 11.570 10.527 1.00 27.20 C
ATOM 8767 CD1 LEU C 276 -26.346 13.087 10.602 1.00 24.46 C
ATOM 8768 CD2 LEU C 276 -27.010 10.981 11.778 1.00 26.16 C
ATOM 8769 N PHE C 277 -28.034 9.474 6.820 1.00 30.98 N
ATOM 8770 CA PHE C 277 -29.071 9.055 5.881 1.00 30.18 C
ATOM 8771 C PHE C 277 -29.246 7.540 5.840 1.00 31.61 C
ATOM 8772 O PHE C 277 -30.378 7.041 5.739 1.00 31.82 O
ATOM 8773 CB PHE C 277 -28.755 9.572 4.476 1.00 30.45 C
ATOM 8774 CG PHE C 277 -27.802 8.708 3.702 1.00 29.70 C
ATOM 8775 CD1 PHE C 277 -28.269 7.643 2.943 1.00 29.56 C
ATOM 8776 CD2 PHE C 277 -26.434 8.947 3.753 1.00 32.54 C
ATOM 8777 CE1 PHE C 277 -27.392 6.821 2.248 1.00 30.00 C
ATOM 8778 CE2 PHE C 277 -25.541 8.137 3.067 1.00 31.50 C
ATOM 8779 CZ PHE C 277 -26.025 7.064 2.309 1.00 32.20 C
ATOM 8780 N ALA C 278 -28.133 6.807 5.904 1.00 30.57 N
ATOM 8781 CA ALA C 278 -28.198 5.347 5.878 1.00 30.59 C
ATOM 8782 C ALA C 278 -28.755 4.858 7.209 1.00 31.87 C
ATOM 8783 O ALA C 278 -29.587 3.959 7.251 1.00 33.84 O
ATOM 8784 CB ALA C 278 -26.826 4.762 5.642 1.00 28.09 C
ATOM 8785 N TYR C 279 -28.305 5.462 8.299 1.00 31.70 N
ATOM 8786 CA TYR C 279 -28.776 5.073 9.611 1.00 31.77 C
ATOM 8787 C TYR C 279 -30.288 5.248 9.616 1.00 33.25 C
ATOM 8788 O TYR C 279 -31.018 4.360 10.070 1.00 35.64 O
ATOM 8789 CB TYR C 279 -28.122 5.946 10.677 1.00 29.64 C
ATOM 8790 CG TYR C 279 -28.301 5.457 12.093 1.00 30.51 C
ATOM 8791 CD1 TYR C 279 -27.924 4.163 12.465 1.00 31.56 C
ATOM 8792 CD2 TYR C 279 -28.791 6.314 13.082 1.00 32.23 C
ATOM 8793 CE1 TYR C 279 -28.024 3.742 13.795 1.00 33.07 C
ATOM 8794 CE2 TYR C 279 -28.902 5.910 14.401 1.00 32.81 C
ATOM 8795 CZ TYR C 279 -28.519 4.632 14.756 1.00 35.03 C
ATOM 8796 OH TYR C 279 -28.641 4.273 16.078 1.00 40.33 O
ATOM 8797 N ALA C 280 -30.749 6.380 9.088 1.00 31.97 N
ATOM 8798 CA ALA C 280 -32.174 6.688 9.021 1.00 31.79 C
ATOM 8799 C ALA C 280 -32.923 5.541 8.372 1.00 32.52 C
ATOM 8800 O ALA C 280 -33.971 5.093 8.861 1.00 33.67 O
ATOM 8801 CB ALA C 280 -32.399 7.957 8.226 1.00 28.90 C
ATOM 8802 N ILE C 281 -32.377 5.061 7.267 1.00 32.08 N
ATOM 8803 CA ILE C 281 -33.002 3.969 6.558 1.00 32.95 C
ATOM 8804 C ILE C 281 -33.009 2.698 7.421 1.00 35.78 C
ATOM 8805 O ILE C 281 -34.026 2.000 7.507 1.00 37.22 O
ATOM 8806 CB ILE C 281 -32.299 3.740 5.200 1.00 29.61 C
ATOM 8807 CG1 ILE C 281 -32.651 4.901 4.254 1.00 27.72 C
ATOM 8808 CG2 ILE C 281 -32.739 2.420 4.586 1.00 30.75 C
ATOM 8809 CD1 ILE C 281 -31.875 4.937 2.934 1.00 22.15 C
ATOM 8810 N LEU C 282 -31.894 2.410 8.084 1.00 36.54 N
ATOM 8811 CA LEU C 282 -31.812 1.224 8.924 1.00 36.83 C
ATOM 8812 C LEU C 282 -32.927 1.182 9.949 1.00 39.04 C
ATOM 8813 O LEU C 282 -33.482 0.121 10.229 1.00 40.07 O
ATOM 8814 CB LEU C 282 -30.484 1.192 9.663 1.00 37.26 C
ATOM 8815 CG LEU C 282 -30.410 0.190 10.820 1.00 37.84 C
ATOM 8816 CD1 LEU C 282 -30.384 -1.237 10.287 1.00 38.05 C
ATOM 8817 CD2 LEU C 282 -29.172 0.463 11.646 1.00 37.17 C
ATOM 8818 N ARG C 283 -33.251 2.343 10.510 1.00 40.80 N
ATOM 8819 CA ARG C 283 -34.276 2.429 11.538 1.00 42.09 C
ATOM 8820 C ARG C 283 -35.704 2.429 11.025 1.00 43.23 C
ATOM 8821 O ARG C 283 -36.634 2.156 11.784 1.00 44.05 O
ATOM 8822 CB ARG C 283 -34.046 3.676 12.396 1.00 42.42 C
ATOM 8823 CG ARG C 283 -32.665 3.731 13.017 1.00 44.15 C
ATOM 8824 CD ARG C 283 -32.581 4.736 14.149 1.00 44.98 C
ATOM 8825 NE ARG C 283 -32.777 6.114 13.709 1.00 49.25 N
ATOM 8826 CZ ARG C 283 -32.636 7.175 14.505 1.00 50.48 C
ATOM 8827 NH1 ARG C 283 -32.306 7.011 15.775 1.00 51.63 N
ATOM 8828 NH2 ARG C 283 -32.806 8.404 14.033 1.00 51.59 N
ATOM 8829 N SER C 284 -35.885 2.731 9.746 1.00 44.52 N
ATOM 8830 CA SER C 284 -37.235 2.783 9.179 1.00 46.49 C
ATOM 8831 C SER C 284 -37.955 1.453 9.326 1.00 47.33 C
ATOM 8832 O SER C 284 -39.158 1.411 9.558 1.00 46.33 O
ATOM 8833 CB SER C 284 -37.192 3.187 7.698 1.00 45.18 C
ATOM 8834 OG SER C 284 -36.477 2.248 6.918 1.00 41.72 O
ATOM 8835 N ILE C 285 -37.206 0.369 9.184 1.00 49.67 N
ATOM 8836 CA ILE C 285 -37.766 -0.966 9.313 1.00 51.57 C
ATOM 8837 C ILE C 285 -37.559 -1.448 10.744 1.00 54.24 C
ATOM 8838 O ILE C 285 -36.439 -1.794 11.142 1.00 54.90 O
ATOM 8839 CB ILE C 285 -37.088 -1.942 8.357 1.00 50.81 C
ATOM 8840 CG1 ILE C 285 -37.243 -1.430 6.930 1.00 50.77 C
ATOM 8841 CG2 ILE C 285 -37.695 -3.327 8.502 1.00 47.91 C
ATOM 8842 CD1 ILE C 285 -36.598 -2.318 5.915 1.00 53.03 C
ATOM 8843 N PRO C 286 -38.643 -1.470 11.539 1.00 56.12 N
ATOM 8844 CA PRO C 286 -38.656 -1.898 12.943 1.00 56.95 C
ATOM 8845 C PRO C 286 -38.324 -3.390 13.176 1.00 57.23 C
ATOM 8846 O PRO C 286 -38.598 -3.933 14.250 1.00 58.94 O
ATOM 8847 CB PRO C 286 -40.075 -1.544 13.382 1.00 57.01 C
ATOM 8848 CG PRO C 286 -40.870 -1.816 12.122 1.00 56.79 C
ATOM 8849 CD PRO C 286 -40.010 -1.147 11.081 1.00 56.69 C
ATOM 8850 N ASN C 287 -37.746 -4.043 12.169 1.00 56.36 N
ATOM 8851 CA ASN C 287 -37.366 -5.454 12.251 1.00 54.38 C
ATOM 8852 C ASN C 287 -35.863 -5.562 12.043 1.00 52.18 C
ATOM 8853 O ASN C 287 -35.355 -5.140 11.013 1.00 52.25 O
ATOM 8854 CB ASN C 287 -38.106 -6.258 11.174 1.00 55.53 C
ATOM 8855 CG ASN C 287 -37.567 -7.672 11.025 1.00 56.30 C
ATOM 8856 OD1 ASN C 287 -36.495 -7.889 10.459 1.00 56.64 O
ATOM 8857 ND2 ASN C 287 -38.309 -8.640 11.543 1.00 58.14 N
ATOM 8858 N LYS C 288 -35.156 -6.139 13.009 1.00 50.32 N
ATOM 8859 CA LYS C 288 -33.705 -6.261 12.922 1.00 48.91 C
ATOM 8860 C LYS C 288 -33.167 -6.626 11.538 1.00 48.63 C
ATOM 8861 O LYS C 288 -32.523 -5.796 10.885 1.00 49.69 O
ATOM 8862 CB LYS C 288 -33.197 -7.264 13.949 1.00 48.62 C
ATOM 8863 CG LYS C 288 -31.691 -7.370 13.983 1.00 49.46 C
ATOM 8864 CD LYS C 288 -31.219 -8.206 15.160 1.00 51.04 C
ATOM 8865 CE LYS C 288 -29.711 -8.384 15.135 1.00 51.24 C
ATOM 8866 NZ LYS C 288 -29.257 -9.179 16.302 1.00 52.51 N
ATOM 8867 N LEU C 289 -33.425 -7.848 11.078 1.00 46.88 N
ATOM 8868 CA LEU C 289 -32.930 -8.260 9.765 1.00 45.15 C
ATOM 8869 C LEU C 289 -33.450 -7.394 8.630 1.00 44.00 C
ATOM 8870 O LEU C 289 -32.700 -7.066 7.716 1.00 45.32 O
ATOM 8871 CB LEU C 289 -33.279 -9.718 9.474 1.00 44.83 C
ATOM 8872 CG LEU C 289 -32.951 -10.204 8.055 1.00 44.18 C
ATOM 8873 CD1 LEU C 289 -31.460 -10.147 7.808 1.00 44.47 C
ATOM 8874 CD2 LEU C 289 -33.453 -11.619 7.881 1.00 44.25 C
ATOM 8875 N GLY C 290 -34.728 -7.029 8.682 1.00 42.74 N
ATOM 8876 CA GLY C 290 -35.298 -6.192 7.636 1.00 41.26 C
ATOM 8877 C GLY C 290 -34.590 -4.845 7.525 1.00 41.64 C
ATOM 8878 O GLY C 290 -34.312 -4.350 6.429 1.00 40.10 O
ATOM 8879 N GLY C 291 -34.287 -4.254 8.676 1.00 40.91 N
ATOM 8880 CA GLY C 291 -33.615 -2.977 8.701 1.00 38.03 C
ATOM 8881 C GLY C 291 -32.213 -3.112 8.156 1.00 38.37 C
ATOM 8882 O GLY C 291 -31.736 -2.205 7.468 1.00 40.01 O
ATOM 8883 N VAL C 292 -31.543 -4.226 8.452 1.00 36.42 N
ATOM 8884 CA VAL C 292 -30.184 -4.414 7.953 1.00 35.36 C
ATOM 8885 C VAL C 292 -30.182 -4.507 6.432 1.00 36.01 C
ATOM 8886 O VAL C 292 -29.340 -3.903 5.768 1.00 34.21 O
ATOM 8887 CB VAL C 292 -29.523 -5.676 8.559 1.00 34.50 C
ATOM 8888 CG1 VAL C 292 -28.337 -6.101 7.724 1.00 34.06 C
ATOM 8889 CG2 VAL C 292 -29.045 -5.378 9.977 1.00 33.56 C
ATOM 8890 N LEU C 293 -31.131 -5.258 5.882 1.00 38.25 N
ATOM 8891 CA LEU C 293 -31.234 -5.412 4.431 1.00 39.54 C
ATOM 8892 C LEU C 293 -31.518 -4.061 3.782 1.00 39.30 C
ATOM 8893 O LEU C 293 -30.940 -3.736 2.750 1.00 40.24 O
ATOM 8894 CB LEU C 293 -32.354 -6.386 4.071 1.00 40.32 C
ATOM 8895 CG LEU C 293 -32.189 -7.841 4.518 1.00 41.93 C
ATOM 8896 CD1 LEU C 293 -33.496 -8.571 4.283 1.00 39.66 C
ATOM 8897 CD2 LEU C 293 -31.047 -8.500 3.772 1.00 40.45 C
ATOM 8898 N ALA C 294 -32.406 -3.272 4.382 1.00 37.85 N
ATOM 8899 CA ALA C 294 -32.719 -1.961 3.826 1.00 36.26 C
ATOM 8900 C ALA C 294 -31.427 -1.135 3.780 1.00 36.71 C
ATOM 8901 O ALA C 294 -31.150 -0.428 2.809 1.00 35.16 O
ATOM 8902 CB ALA C 294 -33.770 -1.269 4.673 1.00 32.87 C
ATOM 8903 N LEU C 295 -30.629 -1.243 4.833 1.00 36.79 N
ATOM 8904 CA LEU C 295 -29.375 -0.514 4.896 1.00 37.33 C
ATOM 8905 C LEU C 295 -28.433 -0.972 3.799 1.00 37.18 C
ATOM 8906 O LEU C 295 -27.874 -0.163 3.077 1.00 39.12 O
ATOM 8907 CB LEU C 295 -28.710 -0.712 6.257 1.00 36.76 C
ATOM 8908 CG LEU C 295 -27.347 -0.046 6.432 1.00 37.30 C
ATOM 8909 CD1 LEU C 295 -27.401 1.403 5.947 1.00 36.60 C
ATOM 8910 CD2 LEU C 295 -26.938 -0.126 7.899 1.00 36.76 C
ATOM 8911 N ALA C 296 -28.252 -2.278 3.677 1.00 37.40 N
ATOM 8912 CA ALA C 296 -27.372 -2.826 2.652 1.00 36.57 C
ATOM 8913 C ALA C 296 -27.829 -2.361 1.285 1.00 35.78 C
ATOM 8914 O ALA C 296 -27.041 -1.863 0.492 1.00 35.37 O
ATOM 8915 CB ALA C 296 -27.383 -4.356 2.712 1.00 36.29 C
ATOM 8916 N ALA C 297 -29.118 -2.533 1.019 1.00 36.79 N
ATOM 8917 CA ALA C 297 -29.718 -2.150 -0.258 1.00 36.61 C
ATOM 8918 C ALA C 297 -29.584 -0.653 -0.543 1.00 36.66 C
ATOM 8919 O ALA C 297 -29.463 -0.241 -1.703 1.00 35.66 O
ATOM 8920 CB ALA C 297 -31.194 -2.550 -0.276 1.00 33.43 C
ATOM 8921 N SER C 298 -29.590 0.158 0.510 1.00 35.68 N
ATOM 8922 CA SER C 298 -29.494 1.593 0.326 1.00 35.87 C
ATOM 8923 C SER C 298 -28.184 1.989 -0.323 1.00 36.21 C
ATOM 8924 O SER C 298 -28.079 3.079 -0.898 1.00 39.28 O
ATOM 8925 CB SER C 298 -29.618 2.324 1.653 1.00 36.11 C
ATOM 8926 OG SER C 298 -28.401 2.240 2.364 1.00 39.43 O
ATOM 8927 N VAL C 299 -27.179 1.128 -0.238 1.00 34.20 N
ATOM 8928 CA VAL C 299 -25.894 1.461 -0.841 1.00 33.15 C
ATOM 8929 C VAL C 299 -25.663 0.626 -2.073 1.00 34.25 C
ATOM 8930 O VAL C 299 -25.210 1.142 -3.098 1.00 36.09 O
ATOM 8931 CB VAL C 299 -24.703 1.271 0.166 1.00 32.31 C
ATOM 8932 CG1 VAL C 299 -23.363 1.381 -0.555 1.00 27.33 C
ATOM 8933 CG2 VAL C 299 -24.774 2.343 1.263 1.00 28.71 C
ATOM 8934 N LEU C 300 -25.976 -0.663 -1.977 1.00 34.32 N
ATOM 8935 CA LEU C 300 -25.807 -1.572 -3.105 1.00 33.35 C
ATOM 8936 C LEU C 300 -26.767 -1.233 -4.251 1.00 32.18 C
ATOM 8937 O LEU C 300 -26.618 -1.709 -5.370 1.00 32.87 O
ATOM 8938 CB LEU C 300 -26.012 -3.013 -2.642 1.00 34.83 C
ATOM 8939 CG LEU C 300 -25.014 -3.474 -1.568 1.00 36.44 C
ATOM 8940 CD1 LEU C 300 -25.360 -4.890 -1.115 1.00 33.75 C
ATOM 8941 CD2 LEU C 300 -23.586 -3.404 -2.126 1.00 36.39 C
ATOM 8942 N ILE C 301 -27.753 -0.397 -3.975 1.00 31.75 N
ATOM 8943 CA ILE C 301 -28.692 0.010 -5.011 1.00 32.36 C
ATOM 8944 C ILE C 301 -27.868 0.664 -6.142 1.00 33.02 C
ATOM 8945 O ILE C 301 -28.274 0.662 -7.309 1.00 33.36 O
ATOM 8946 CB ILE C 301 -29.728 1.034 -4.427 1.00 33.30 C
ATOM 8947 CG1 ILE C 301 -30.769 1.419 -5.473 1.00 30.45 C
ATOM 8948 CG2 ILE C 301 -29.007 2.288 -3.920 1.00 32.10 C
ATOM 8949 CD1 ILE C 301 -31.707 0.330 -5.804 1.00 33.75 C
ATOM 8950 N LEU C 302 -26.703 1.212 -5.787 1.00 30.98 N
ATOM 8951 CA LEU C 302 -25.832 1.869 -6.760 1.00 30.47 C
ATOM 8952 C LEU C 302 -25.345 0.952 -7.887 1.00 29.83 C
ATOM 8953 O LEU C 302 -25.040 1.419 -8.978 1.00 29.19 O
ATOM 8954 CB LEU C 302 -24.621 2.505 -6.058 1.00 29.47 C
ATOM 8955 CG LEU C 302 -24.814 3.710 -5.121 1.00 28.17 C
ATOM 8956 CD1 LEU C 302 -23.472 4.175 -4.619 1.00 26.41 C
ATOM 8957 CD2 LEU C 302 -25.492 4.861 -5.833 1.00 28.80 C
ATOM 8958 N PHE C 303 -25.257 -0.347 -7.625 1.00 29.53 N
ATOM 8959 CA PHE C 303 -24.816 -1.286 -8.652 1.00 29.80 C
ATOM 8960 C PHE C 303 -25.934 -1.461 -9.695 1.00 31.73 C
ATOM 8961 O PHE C 303 -25.687 -1.889 -10.827 1.00 31.32 O
ATOM 8962 CB PHE C 303 -24.488 -2.652 -8.033 1.00 28.93 C
ATOM 8963 CG PHE C 303 -23.110 -2.749 -7.423 1.00 27.81 C
ATOM 8964 CD1 PHE C 303 -22.952 -3.073 -6.075 1.00 25.10 C
ATOM 8965 CD2 PHE C 303 -21.971 -2.513 -8.193 1.00 25.12 C
ATOM 8966 CE1 PHE C 303 -21.677 -3.155 -5.501 1.00 24.55 C
ATOM 8967 CE2 PHE C 303 -20.690 -2.595 -7.626 1.00 22.15 C
ATOM 8968 CZ PHE C 303 -20.543 -2.913 -6.284 1.00 23.20 C
ATOM 8969 N LEU C 304 -27.161 -1.128 -9.308 1.00 32.13 N
ATOM 8970 CA LEU C 304 -28.299 -1.277 -10.196 1.00 32.54 C
ATOM 8971 C LEU C 304 -28.563 -0.119 -11.140 1.00 34.16 C
ATOM 8972 O LEU C 304 -29.211 -0.312 -12.163 1.00 36.86 O
ATOM 8973 CB LEU C 304 -29.569 -1.516 -9.383 1.00 34.19 C
ATOM 8974 CG LEU C 304 -29.876 -2.929 -8.889 1.00 35.43 C
ATOM 8975 CD1 LEU C 304 -31.213 -2.973 -8.176 1.00 34.58 C
ATOM 8976 CD2 LEU C 304 -29.931 -3.848 -10.083 1.00 36.49 C
ATOM 8977 N ILE C 305 -28.076 1.074 -10.803 1.00 33.80 N
ATOM 8978 CA ILE C 305 -28.313 2.273 -11.609 1.00 30.76 C
ATOM 8979 C ILE C 305 -28.116 2.123 -13.108 1.00 31.89 C
ATOM 8980 O ILE C 305 -28.973 2.554 -13.881 1.00 31.85 O
ATOM 8981 CB ILE C 305 -27.441 3.469 -11.129 1.00 30.14 C
ATOM 8982 CG1 ILE C 305 -27.723 3.757 -9.656 1.00 30.53 C
ATOM 8983 CG2 ILE C 305 -27.739 4.722 -11.960 1.00 27.76 C
ATOM 8984 CD1 ILE C 305 -29.178 4.011 -9.361 1.00 33.12 C
ATOM 8985 N PRO C 306 -26.997 1.519 -13.547 1.00 32.76 N
ATOM 8986 CA PRO C 306 -26.775 1.371 -14.988 1.00 33.84 C
ATOM 8987 C PRO C 306 -27.869 0.616 -15.731 1.00 36.09 C
ATOM 8988 O PRO C 306 -28.041 0.801 -16.930 1.00 37.70 O
ATOM 8989 CB PRO C 306 -25.431 0.657 -15.069 1.00 33.43 C
ATOM 8990 CG PRO C 306 -24.739 1.080 -13.810 1.00 34.39 C
ATOM 8991 CD PRO C 306 -25.846 1.002 -12.787 1.00 33.75 C
ATOM 8992 N PHE C 307 -28.619 -0.221 -15.025 1.00 37.99 N
ATOM 8993 CA PHE C 307 -29.687 -0.988 -15.657 1.00 39.69 C
ATOM 8994 C PHE C 307 -31.056 -0.321 -15.574 1.00 39.92 C
ATOM 8995 O PHE C 307 -32.050 -0.853 -16.070 1.00 41.76 O
ATOM 8996 CB PHE C 307 -29.752 -2.368 -15.018 1.00 42.97 C
ATOM 8997 CG PHE C 307 -28.426 -3.068 -14.988 1.00 48.59 C
ATOM 8998 CD1 PHE C 307 -27.872 -3.584 -16.158 1.00 50.08 C
ATOM 8999 CD2 PHE C 307 -27.702 -3.176 -13.797 1.00 49.61 C
ATOM 9000 CE1 PHE C 307 -26.619 -4.196 -16.145 1.00 51.55 C
ATOM 9001 CE2 PHE C 307 -26.447 -3.786 -13.774 1.00 49.86 C
ATOM 9002 CZ PHE C 307 -25.905 -4.296 -14.949 1.00 51.42 C
ATOM 9003 N LEU C 308 -31.126 0.845 -14.952 1.00 38.11 N
ATOM 9004 CA LEU C 308 -32.402 1.523 -14.837 1.00 37.71 C
ATOM 9005 C LEU C 308 -32.408 2.746 -15.730 1.00 37.99 C
ATOM 9006 O LEU C 308 -33.198 3.673 -15.532 1.00 40.16 O
ATOM 9007 CB LEU C 308 -32.642 1.913 -13.384 1.00 36.67 C
ATOM 9008 CG LEU C 308 -32.609 0.707 -12.444 1.00 38.30 C
ATOM 9009 CD1 LEU C 308 -32.829 1.158 -11.017 1.00 39.21 C
ATOM 9010 CD2 LEU C 308 -33.682 -0.292 -12.852 1.00 38.31 C
ATOM 9011 N HIS C 309 -31.513 2.744 -16.713 1.00 36.97 N
ATOM 9012 CA HIS C 309 -31.396 3.857 -17.636 1.00 36.44 C
ATOM 9013 C HIS C 309 -32.226 3.591 -18.871 1.00 36.91 C
ATOM 9014 O HIS C 309 -31.886 2.729 -19.670 1.00 39.05 O
ATOM 9015 CB HIS C 309 -29.939 4.067 -18.042 1.00 35.72 C
ATOM 9016 CG HIS C 309 -29.712 5.332 -18.809 1.00 36.52 C
ATOM 9017 ND1 HIS C 309 -29.513 6.550 -18.192 1.00 36.09 N
ATOM 9018 CD2 HIS C 309 -29.717 5.582 -20.141 1.00 36.00 C
ATOM 9019 CE1 HIS C 309 -29.408 7.495 -19.111 1.00 37.73 C
ATOM 9020 NE2 HIS C 309 -29.529 6.935 -20.302 1.00 38.56 N
ATOM 9021 N LYS C 310 -33.307 4.343 -19.040 1.00 36.65 N
ATOM 9022 CA LYS C 310 -34.176 4.152 -20.185 1.00 34.82 C
ATOM 9023 C LYS C 310 -34.075 5.304 -21.163 1.00 33.27 C
ATOM 9024 O LYS C 310 -34.481 5.190 -22.312 1.00 33.17 O
ATOM 9025 CB LYS C 310 -35.624 4.006 -19.714 1.00 36.46 C
ATOM 9026 CG LYS C 310 -35.818 2.915 -18.701 1.00 38.63 C
ATOM 9027 CD LYS C 310 -35.361 1.585 -19.260 1.00 42.00 C
ATOM 9028 CE LYS C 310 -35.474 0.474 -18.211 1.00 44.25 C
ATOM 9029 NZ LYS C 310 -34.890 -0.814 -18.691 1.00 46.11 N
ATOM 9030 N SER C 311 -33.534 6.422 -20.706 1.00 34.20 N
ATOM 9031 CA SER C 311 -33.427 7.596 -21.557 1.00 33.24 C
ATOM 9032 C SER C 311 -32.610 7.358 -22.827 1.00 31.11 C
ATOM 9033 O SER C 311 -31.632 6.626 -22.808 1.00 32.62 O
ATOM 9034 CB SER C 311 -32.823 8.740 -20.766 1.00 33.10 C
ATOM 9035 OG SER C 311 -32.780 9.896 -21.581 1.00 40.02 O
ATOM 9036 N LYS C 312 -33.015 7.966 -23.933 1.00 29.37 N
ATOM 9037 CA LYS C 312 -32.285 7.814 -25.189 1.00 29.18 C
ATOM 9038 C LYS C 312 -31.111 8.786 -25.186 1.00 27.72 C
ATOM 9039 O LYS C 312 -30.261 8.759 -26.078 1.00 27.53 O
ATOM 9040 CB LYS C 312 -33.192 8.106 -26.390 1.00 30.15 C
ATOM 9041 CG LYS C 312 -34.208 7.025 -26.687 1.00 35.57 C
ATOM 9042 CD LYS C 312 -33.516 5.794 -27.209 1.00 43.37 C
ATOM 9043 CE LYS C 312 -34.486 4.670 -27.588 1.00 47.58 C
ATOM 9044 NZ LYS C 312 -34.941 3.859 -26.427 1.00 49.16 N
ATOM 9045 N GLN C 313 -31.092 9.642 -24.172 1.00 25.77 N
ATOM 9046 CA GLN C 313 -30.062 10.648 -23.978 1.00 26.85 C
ATOM 9047 C GLN C 313 -29.230 10.290 -22.735 1.00 28.18 C
ATOM 9048 O GLN C 313 -29.751 9.786 -21.738 1.00 31.79 O
ATOM 9049 CB GLN C 313 -30.723 12.024 -23.830 1.00 26.55 C
ATOM 9050 CG GLN C 313 -31.445 12.459 -25.090 1.00 28.29 C
ATOM 9051 CD GLN C 313 -32.201 13.762 -24.937 1.00 32.00 C
ATOM 9052 OE1 GLN C 313 -33.036 13.918 -24.038 1.00 35.13 O
ATOM 9053 NE2 GLN C 313 -31.929 14.707 -25.831 1.00 33.73 N
ATOM 9054 N ARG C 314 -27.934 10.545 -22.778 1.00 26.64 N
ATOM 9055 CA ARG C 314 -27.099 10.177 -21.650 1.00 24.60 C
ATOM 9056 C ARG C 314 -27.264 10.998 -20.380 1.00 22.93 C
ATOM 9057 O ARG C 314 -27.373 10.439 -19.297 1.00 23.32 O
ATOM 9058 CB ARG C 314 -25.626 10.182 -22.069 1.00 27.24 C
ATOM 9059 CG ARG C 314 -24.700 9.741 -20.961 1.00 27.15 C
ATOM 9060 CD ARG C 314 -23.330 9.412 -21.467 1.00 28.58 C
ATOM 9061 NE ARG C 314 -22.562 8.758 -20.415 1.00 29.44 N
ATOM 9062 CZ ARG C 314 -21.344 8.252 -20.573 1.00 29.64 C
ATOM 9063 NH1 ARG C 314 -20.739 8.320 -21.752 1.00 28.24 N
ATOM 9064 NH2 ARG C 314 -20.726 7.686 -19.543 1.00 30.92 N
ATOM 9065 N THR C 315 -27.257 12.319 -20.486 1.00 21.94 N
ATOM 9066 CA THR C 315 -27.386 13.121 -19.277 1.00 23.30 C
ATOM 9067 C THR C 315 -28.797 13.616 -19.009 1.00 23.65 C
ATOM 9068 O THR C 315 -29.738 13.286 -19.721 1.00 24.39 O
ATOM 9069 CB THR C 315 -26.434 14.334 -19.283 1.00 22.37 C
ATOM 9070 OG1 THR C 315 -26.848 15.273 -20.274 1.00 21.71 O
ATOM 9071 CG2 THR C 315 -25.015 13.890 -19.565 1.00 20.36 C
ATOM 9072 N MET C 316 -28.941 14.390 -17.948 1.00 23.93 N
ATOM 9073 CA MET C 316 -30.241 14.917 -17.591 1.00 26.46 C
ATOM 9074 C MET C 316 -30.338 16.371 -18.021 1.00 27.75 C
ATOM 9075 O MET C 316 -31.336 17.044 -17.776 1.00 27.97 O
ATOM 9076 CB MET C 316 -30.445 14.788 -16.080 1.00 25.02 C
ATOM 9077 CG MET C 316 -30.803 13.385 -15.630 1.00 21.85 C
ATOM 9078 SD MET C 316 -30.912 13.321 -13.865 1.00 26.10 S
ATOM 9079 CE MET C 316 -31.179 11.630 -13.543 1.00 24.97 C
ATOM 9080 N THR C 317 -29.300 16.842 -18.697 1.00 30.02 N
ATOM 9081 CA THR C 317 -29.256 18.232 -19.125 1.00 32.20 C
ATOM 9082 C THR C 317 -30.474 18.694 -19.911 1.00 31.99 C
ATOM 9083 O THR C 317 -30.955 19.797 -19.692 1.00 34.21 O
ATOM 9084 CB THR C 317 -28.004 18.521 -19.954 1.00 30.73 C
ATOM 9085 OG1 THR C 317 -26.868 17.992 -19.273 1.00 32.68 O
ATOM 9086 CG2 THR C 317 -27.811 20.002 -20.110 1.00 30.36 C
ATOM 9087 N PHE C 318 -30.978 17.848 -20.800 1.00 31.66 N
ATOM 9088 CA PHE C 318 -32.126 18.204 -21.628 1.00 29.36 C
ATOM 9089 C PHE C 318 -33.384 17.478 -21.210 1.00 28.94 C
ATOM 9090 O PHE C 318 -34.312 17.375 -22.004 1.00 29.73 O
ATOM 9091 CB PHE C 318 -31.832 17.876 -23.094 1.00 27.55 C
ATOM 9092 CG PHE C 318 -30.561 18.495 -23.611 1.00 28.51 C
ATOM 9093 CD1 PHE C 318 -29.597 17.712 -24.245 1.00 25.69 C
ATOM 9094 CD2 PHE C 318 -30.329 19.869 -23.469 1.00 28.82 C
ATOM 9095 CE1 PHE C 318 -28.429 18.276 -24.732 1.00 24.71 C
ATOM 9096 CE2 PHE C 318 -29.148 20.459 -23.960 1.00 27.76 C
ATOM 9097 CZ PHE C 318 -28.200 19.659 -24.591 1.00 28.50 C
ATOM 9098 N ARG C 319 -33.414 16.996 -19.969 1.00 28.85 N
ATOM 9099 CA ARG C 319 -34.553 16.244 -19.440 1.00 31.30 C
ATOM 9100 C ARG C 319 -35.101 16.890 -18.175 1.00 33.48 C
ATOM 9101 O ARG C 319 -34.825 16.449 -17.051 1.00 33.43 O
ATOM 9102 CB ARG C 319 -34.128 14.808 -19.109 1.00 33.13 C
ATOM 9103 CG ARG C 319 -33.748 13.948 -20.300 1.00 31.32 C
ATOM 9104 CD ARG C 319 -33.730 12.488 -19.879 1.00 31.39 C
ATOM 9105 NE ARG C 319 -32.401 12.056 -19.472 1.00 32.30 N
ATOM 9106 CZ ARG C 319 -32.167 11.260 -18.442 1.00 31.97 C
ATOM 9107 NH1 ARG C 319 -33.175 10.809 -17.705 1.00 29.51 N
ATOM 9108 NH2 ARG C 319 -30.919 10.918 -18.152 1.00 36.01 N
ATOM 9109 N PRO C 320 -35.903 17.944 -18.338 1.00 35.04 N
ATOM 9110 CA PRO C 320 -36.494 18.663 -17.204 1.00 34.34 C
ATOM 9111 C PRO C 320 -37.260 17.795 -16.192 1.00 35.20 C
ATOM 9112 O PRO C 320 -37.155 18.032 -14.986 1.00 36.20 O
ATOM 9113 CB PRO C 320 -37.377 19.701 -17.891 1.00 33.34 C
ATOM 9114 CG PRO C 320 -37.793 18.999 -19.133 1.00 35.80 C
ATOM 9115 CD PRO C 320 -36.495 18.392 -19.607 1.00 35.57 C
ATOM 9116 N LEU C 321 -38.036 16.810 -16.647 1.00 33.43 N
ATOM 9117 CA LEU C 321 -38.748 15.978 -15.686 1.00 33.54 C
ATOM 9118 C LEU C 321 -37.769 15.199 -14.796 1.00 33.32 C
ATOM 9119 O LEU C 321 -37.952 15.127 -13.591 1.00 34.08 O
ATOM 9120 CB LEU C 321 -39.702 15.007 -16.391 1.00 37.04 C
ATOM 9121 CG LEU C 321 -40.820 15.586 -17.279 1.00 38.24 C
ATOM 9122 CD1 LEU C 321 -41.812 14.492 -17.523 1.00 37.86 C
ATOM 9123 CD2 LEU C 321 -41.522 16.758 -16.633 1.00 36.62 C
ATOM 9124 N SER C 322 -36.718 14.628 -15.379 1.00 33.60 N
ATOM 9125 CA SER C 322 -35.718 13.890 -14.597 1.00 32.00 C
ATOM 9126 C SER C 322 -34.987 14.819 -13.644 1.00 30.77 C
ATOM 9127 O SER C 322 -34.658 14.440 -12.525 1.00 31.06 O
ATOM 9128 CB SER C 322 -34.693 13.214 -15.509 1.00 31.81 C
ATOM 9129 OG SER C 322 -35.328 12.337 -16.412 1.00 34.96 O
ATOM 9130 N GLN C 323 -34.706 16.034 -14.089 1.00 29.88 N
ATOM 9131 CA GLN C 323 -34.031 16.975 -13.215 1.00 30.93 C
ATOM 9132 C GLN C 323 -34.835 17.211 -11.935 1.00 30.72 C
ATOM 9133 O GLN C 323 -34.273 17.346 -10.851 1.00 31.91 O
ATOM 9134 CB GLN C 323 -33.810 18.302 -13.925 1.00 30.18 C
ATOM 9135 CG GLN C 323 -32.801 18.238 -15.031 1.00 34.43 C
ATOM 9136 CD GLN C 323 -32.816 19.496 -15.880 1.00 37.14 C
ATOM 9137 OE1 GLN C 323 -32.848 20.610 -15.354 1.00 39.74 O
ATOM 9138 NE2 GLN C 323 -32.781 19.327 -17.198 1.00 38.03 N
ATOM 9139 N THR C 324 -36.151 17.256 -12.039 1.00 30.95 N
ATOM 9140 CA THR C 324 -36.945 17.497 -10.844 1.00 32.37 C
ATOM 9141 C THR C 324 -36.802 16.282 -9.967 1.00 30.90 C
ATOM 9142 O THR C 324 -36.482 16.363 -8.773 1.00 30.50 O
ATOM 9143 CB THR C 324 -38.419 17.679 -11.177 1.00 34.13 C
ATOM 9144 OG1 THR C 324 -38.546 18.569 -12.289 1.00 36.48 O
ATOM 9145 CG2 THR C 324 -39.135 18.274 -10.001 1.00 35.22 C
ATOM 9146 N LEU C 325 -37.055 15.146 -10.587 1.00 29.48 N
ATOM 9147 CA LEU C 325 -36.935 13.880 -9.918 1.00 28.87 C
ATOM 9148 C LEU C 325 -35.548 13.810 -9.257 1.00 27.48 C
ATOM 9149 O LEU C 325 -35.414 13.331 -8.147 1.00 28.50 O
ATOM 9150 CB LEU C 325 -37.114 12.775 -10.950 1.00 29.85 C
ATOM 9151 CG LEU C 325 -37.737 11.492 -10.423 1.00 33.69 C
ATOM 9152 CD1 LEU C 325 -38.932 11.847 -9.570 1.00 33.31 C
ATOM 9153 CD2 LEU C 325 -38.122 10.580 -11.590 1.00 32.13 C
ATOM 9154 N PHE C 326 -34.522 14.324 -9.922 1.00 27.23 N
ATOM 9155 CA PHE C 326 -33.168 14.292 -9.366 1.00 28.38 C
ATOM 9156 C PHE C 326 -33.015 15.090 -8.067 1.00 29.77 C
ATOM 9157 O PHE C 326 -32.438 14.608 -7.077 1.00 30.11 O
ATOM 9158 CB PHE C 326 -32.155 14.826 -10.383 1.00 26.32 C
ATOM 9159 CG PHE C 326 -30.752 14.898 -9.849 1.00 23.19 C
ATOM 9160 CD1 PHE C 326 -29.922 13.778 -9.879 1.00 20.34 C
ATOM 9161 CD2 PHE C 326 -30.268 16.082 -9.285 1.00 22.13 C
ATOM 9162 CE1 PHE C 326 -28.629 13.832 -9.357 1.00 17.75 C
ATOM 9163 CE2 PHE C 326 -28.968 16.152 -8.754 1.00 19.60 C
ATOM 9164 CZ PHE C 326 -28.152 15.027 -8.792 1.00 17.72 C
ATOM 9165 N TRP C 327 -33.506 16.325 -8.075 1.00 30.79 N
ATOM 9166 CA TRP C 327 -33.405 17.163 -6.882 1.00 29.69 C
ATOM 9167 C TRP C 327 -34.334 16.675 -5.798 1.00 29.89 C
ATOM 9168 O TRP C 327 -34.096 16.942 -4.623 1.00 30.25 O
ATOM 9169 CB TRP C 327 -33.674 18.623 -7.222 1.00 26.58 C
ATOM 9170 CG TRP C 327 -32.652 19.122 -8.155 1.00 25.31 C
ATOM 9171 CD1 TRP C 327 -32.803 19.387 -9.491 1.00 22.52 C
ATOM 9172 CD2 TRP C 327 -31.274 19.322 -7.856 1.00 24.88 C
ATOM 9173 NE1 TRP C 327 -31.592 19.739 -10.041 1.00 23.35 N
ATOM 9174 CE2 TRP C 327 -30.636 19.704 -9.058 1.00 24.40 C
ATOM 9175 CE3 TRP C 327 -30.510 19.208 -6.685 1.00 27.27 C
ATOM 9176 CZ2 TRP C 327 -29.268 19.969 -9.124 1.00 24.57 C
ATOM 9177 CZ3 TRP C 327 -29.144 19.473 -6.749 1.00 28.26 C
ATOM 9178 CH2 TRP C 327 -28.538 19.848 -7.964 1.00 27.26 C
ATOM 9179 N LEU C 328 -35.393 15.969 -6.183 1.00 29.00 N
ATOM 9180 CA LEU C 328 -36.265 15.442 -5.165 1.00 31.34 C
ATOM 9181 C LEU C 328 -35.407 14.450 -4.411 1.00 32.61 C
ATOM 9182 O LEU C 328 -35.351 14.469 -3.173 1.00 34.17 O
ATOM 9183 CB LEU C 328 -37.463 14.711 -5.759 1.00 33.73 C
ATOM 9184 CG LEU C 328 -38.643 15.582 -6.199 1.00 37.46 C
ATOM 9185 CD1 LEU C 328 -39.763 14.673 -6.697 1.00 36.90 C
ATOM 9186 CD2 LEU C 328 -39.107 16.453 -5.038 1.00 33.80 C
ATOM 9187 N LEU C 329 -34.719 13.591 -5.162 1.00 31.50 N
ATOM 9188 CA LEU C 329 -33.872 12.588 -4.542 1.00 29.21 C
ATOM 9189 C LEU C 329 -32.837 13.247 -3.631 1.00 28.49 C
ATOM 9190 O LEU C 329 -32.626 12.810 -2.497 1.00 27.46 O
ATOM 9191 CB LEU C 329 -33.182 11.737 -5.613 1.00 29.73 C
ATOM 9192 CG LEU C 329 -32.302 10.571 -5.124 1.00 28.10 C
ATOM 9193 CD1 LEU C 329 -33.104 9.641 -4.249 1.00 25.98 C
ATOM 9194 CD2 LEU C 329 -31.765 9.814 -6.295 1.00 27.05 C
ATOM 9195 N VAL C 330 -32.196 14.306 -4.112 1.00 26.56 N
ATOM 9196 CA VAL C 330 -31.206 14.961 -3.276 1.00 26.21 C
ATOM 9197 C VAL C 330 -31.838 15.442 -1.984 1.00 26.40 C
ATOM 9198 O VAL C 330 -31.300 15.205 -0.918 1.00 27.25 O
ATOM 9199 CB VAL C 330 -30.563 16.168 -3.964 1.00 26.59 C
ATOM 9200 CG1 VAL C 330 -29.612 16.843 -2.995 1.00 21.99 C
ATOM 9201 CG2 VAL C 330 -29.841 15.731 -5.222 1.00 23.04 C
ATOM 9202 N ALA C 331 -32.979 16.118 -2.082 1.00 27.89 N
ATOM 9203 CA ALA C 331 -33.686 16.626 -0.896 1.00 28.97 C
ATOM 9204 C ALA C 331 -34.141 15.465 0.002 1.00 30.21 C
ATOM 9205 O ALA C 331 -34.179 15.571 1.232 1.00 29.60 O
ATOM 9206 CB ALA C 331 -34.882 17.446 -1.318 1.00 26.52 C
ATOM 9207 N ASN C 332 -34.484 14.352 -0.628 1.00 30.32 N
ATOM 9208 CA ASN C 332 -34.903 13.185 0.102 1.00 30.88 C
ATOM 9209 C ASN C 332 -33.724 12.745 0.974 1.00 31.25 C
ATOM 9210 O ASN C 332 -33.892 12.284 2.114 1.00 32.84 O
ATOM 9211 CB ASN C 332 -35.266 12.083 -0.885 1.00 34.40 C
ATOM 9212 CG ASN C 332 -36.108 10.993 -0.255 1.00 37.89 C
ATOM 9213 OD1 ASN C 332 -35.742 10.404 0.763 1.00 40.97 O
ATOM 9214 ND2 ASN C 332 -37.245 10.716 -0.863 1.00 42.73 N
ATOM 9215 N LEU C 333 -32.520 12.880 0.434 1.00 29.29 N
ATOM 9216 CA LEU C 333 -31.344 12.494 1.187 1.00 27.89 C
ATOM 9217 C LEU C 333 -31.139 13.435 2.369 1.00 27.73 C
ATOM 9218 O LEU C 333 -30.758 12.988 3.451 1.00 27.24 O
ATOM 9219 CB LEU C 333 -30.117 12.441 0.259 1.00 27.01 C
ATOM 9220 CG LEU C 333 -30.130 11.180 -0.638 1.00 26.76 C
ATOM 9221 CD1 LEU C 333 -29.057 11.231 -1.671 1.00 24.40 C
ATOM 9222 CD2 LEU C 333 -29.960 9.946 0.208 1.00 24.97 C
ATOM 9223 N LEU C 334 -31.387 14.731 2.172 1.00 28.09 N
ATOM 9224 CA LEU C 334 -31.269 15.698 3.263 1.00 27.90 C
ATOM 9225 C LEU C 334 -32.228 15.312 4.371 1.00 26.33 C
ATOM 9226 O LEU C 334 -31.867 15.271 5.547 1.00 25.31 O
ATOM 9227 CB LEU C 334 -31.643 17.101 2.805 1.00 32.78 C
ATOM 9228 CG LEU C 334 -30.513 17.972 2.260 1.00 38.98 C
ATOM 9229 CD1 LEU C 334 -30.892 19.435 2.476 1.00 36.46 C
ATOM 9230 CD2 LEU C 334 -29.194 17.653 2.996 1.00 41.52 C
ATOM 9231 N ILE C 335 -33.468 15.035 3.987 1.00 24.44 N
ATOM 9232 CA ILE C 335 -34.476 14.657 4.947 1.00 22.01 C
ATOM 9233 C ILE C 335 -33.989 13.455 5.721 1.00 22.92 C
ATOM 9234 O ILE C 335 -34.057 13.451 6.952 1.00 24.79 O
ATOM 9235 CB ILE C 335 -35.813 14.360 4.245 1.00 21.60 C
ATOM 9236 CG1 ILE C 335 -36.423 15.667 3.758 1.00 26.25 C
ATOM 9237 CG2 ILE C 335 -36.796 13.730 5.185 1.00 21.09 C
ATOM 9238 CD1 ILE C 335 -37.700 15.495 2.961 1.00 27.45 C
ATOM 9239 N LEU C 336 -33.481 12.438 5.025 1.00 22.87 N
ATOM 9240 CA LEU C 336 -33.005 11.252 5.726 1.00 23.27 C
ATOM 9241 C LEU C 336 -31.869 11.632 6.671 1.00 24.70 C
ATOM 9242 O LEU C 336 -31.855 11.229 7.838 1.00 27.19 O
ATOM 9243 CB LEU C 336 -32.566 10.172 4.735 1.00 24.76 C
ATOM 9244 CG LEU C 336 -33.750 9.501 4.016 1.00 27.52 C
ATOM 9245 CD1 LEU C 336 -33.279 8.574 2.921 1.00 27.73 C
ATOM 9246 CD2 LEU C 336 -34.558 8.699 5.021 1.00 29.06 C
ATOM 9247 N THR C 337 -30.932 12.435 6.186 1.00 23.48 N
ATOM 9248 CA THR C 337 -29.816 12.873 7.013 1.00 24.55 C
ATOM 9249 C THR C 337 -30.343 13.504 8.296 1.00 26.17 C
ATOM 9250 O THR C 337 -29.923 13.144 9.395 1.00 26.28 O
ATOM 9251 CB THR C 337 -28.946 13.895 6.256 1.00 24.99 C
ATOM 9252 OG1 THR C 337 -28.408 13.266 5.075 1.00 25.96 O
ATOM 9253 CG2 THR C 337 -27.825 14.438 7.157 1.00 17.73 C
ATOM 9254 N TRP C 338 -31.256 14.456 8.149 1.00 27.32 N
ATOM 9255 CA TRP C 338 -31.858 15.104 9.299 1.00 30.20 C
ATOM 9256 C TRP C 338 -32.569 14.081 10.202 1.00 31.13 C
ATOM 9257 O TRP C 338 -32.398 14.093 11.432 1.00 30.35 O
ATOM 9258 CB TRP C 338 -32.871 16.134 8.832 1.00 32.78 C
ATOM 9259 CG TRP C 338 -33.840 16.513 9.892 1.00 35.08 C
ATOM 9260 CD1 TRP C 338 -33.552 17.061 11.104 1.00 36.13 C
ATOM 9261 CD2 TRP C 338 -35.259 16.422 9.817 1.00 36.72 C
ATOM 9262 NE1 TRP C 338 -34.711 17.326 11.796 1.00 37.51 N
ATOM 9263 CE2 TRP C 338 -35.777 16.947 11.027 1.00 38.31 C
ATOM 9264 CE3 TRP C 338 -36.151 15.953 8.843 1.00 37.82 C
ATOM 9265 CZ2 TRP C 338 -37.150 17.019 11.290 1.00 37.86 C
ATOM 9266 CZ3 TRP C 338 -37.519 16.026 9.098 1.00 40.33 C
ATOM 9267 CH2 TRP C 338 -38.005 16.560 10.318 1.00 41.71 C
ATOM 9268 N ILE C 339 -33.363 13.201 9.593 1.00 29.84 N
ATOM 9269 CA ILE C 339 -34.082 12.193 10.362 1.00 30.28 C
ATOM 9270 C ILE C 339 -33.134 11.278 11.122 1.00 30.27 C
ATOM 9271 O ILE C 339 -33.405 10.882 12.252 1.00 30.96 O
ATOM 9272 CB ILE C 339 -34.995 11.335 9.460 1.00 29.52 C
ATOM 9273 CG1 ILE C 339 -36.244 12.138 9.061 1.00 31.52 C
ATOM 9274 CG2 ILE C 339 -35.410 10.076 10.185 1.00 27.35 C
ATOM 9275 CD1 ILE C 339 -37.124 12.575 10.254 1.00 28.84 C
ATOM 9276 N GLY C 340 -32.015 10.943 10.505 1.00 30.10 N
ATOM 9277 CA GLY C 340 -31.062 10.081 11.171 1.00 30.14 C
ATOM 9278 C GLY C 340 -30.423 10.681 12.406 1.00 31.31 C
ATOM 9279 O GLY C 340 -29.811 9.956 13.166 1.00 31.20 O
ATOM 9280 N SER C 341 -30.564 11.992 12.608 1.00 34.70 N
ATOM 9281 CA SER C 341 -29.978 12.685 13.768 1.00 36.09 C
ATOM 9282 C SER C 341 -30.988 12.921 14.890 1.00 36.87 C
ATOM 9283 O SER C 341 -30.643 13.455 15.938 1.00 37.66 O
ATOM 9284 CB SER C 341 -29.415 14.047 13.355 1.00 35.30 C
ATOM 9285 OG SER C 341 -30.469 14.942 13.023 1.00 33.83 O
ATOM 9286 N GLN C 342 -32.235 12.543 14.657 1.00 37.40 N
ATOM 9287 CA GLN C 342 -33.275 12.716 15.648 1.00 38.21 C
ATOM 9288 C GLN C 342 -33.604 11.402 16.315 1.00 40.01 C
ATOM 9289 O GLN C 342 -33.243 10.337 15.820 1.00 41.11 O
ATOM 9290 CB GLN C 342 -34.528 13.256 14.980 1.00 39.39 C
ATOM 9291 CG GLN C 342 -34.325 14.607 14.410 1.00 39.40 C
ATOM 9292 CD GLN C 342 -33.638 15.488 15.394 1.00 40.61 C
ATOM 9293 OE1 GLN C 342 -32.671 16.158 15.060 1.00 42.25 O
ATOM 9294 NE2 GLN C 342 -34.122 15.485 16.633 1.00 41.41 N
ATOM 9295 N PRO C 343 -34.304 11.457 17.454 1.00 41.58 N
ATOM 9296 CA PRO C 343 -34.690 10.249 18.193 1.00 42.34 C
ATOM 9297 C PRO C 343 -35.861 9.550 17.520 1.00 42.96 C
ATOM 9298 O PRO C 343 -36.638 10.189 16.813 1.00 42.36 O
ATOM 9299 CB PRO C 343 -35.061 10.793 19.568 1.00 42.11 C
ATOM 9300 CG PRO C 343 -35.617 12.162 19.238 1.00 41.47 C
ATOM 9301 CD PRO C 343 -34.639 12.677 18.213 1.00 41.12 C
ATOM 9302 N VAL C 344 -35.971 8.240 17.730 1.00 45.66 N
ATOM 9303 CA VAL C 344 -37.062 7.450 17.154 1.00 48.36 C
ATOM 9304 C VAL C 344 -38.377 7.784 17.864 1.00 49.62 C
ATOM 9305 O VAL C 344 -38.755 7.142 18.842 1.00 49.43 O
ATOM 9306 CB VAL C 344 -36.807 5.908 17.279 1.00 48.91 C
ATOM 9307 CG1 VAL C 344 -35.654 5.486 16.375 1.00 46.79 C
ATOM 9308 CG2 VAL C 344 -36.516 5.533 18.749 1.00 49.76 C
ATOM 9309 N GLU C 345 -39.069 8.795 17.363 1.00 50.86 N
ATOM 9310 CA GLU C 345 -40.325 9.209 17.955 1.00 51.95 C
ATOM 9311 C GLU C 345 -41.139 9.999 16.949 1.00 51.38 C
ATOM 9312 O GLU C 345 -40.574 10.587 16.020 1.00 53.09 O
ATOM 9313 CB GLU C 345 -40.048 10.079 19.170 1.00 55.21 C
ATOM 9314 CG GLU C 345 -39.401 9.333 20.314 1.00 61.74 C
ATOM 9315 CD GLU C 345 -38.839 10.263 21.369 1.00 66.66 C
ATOM 9316 OE1 GLU C 345 -39.586 11.160 21.831 1.00 68.56 O
ATOM 9317 OE2 GLU C 345 -37.652 10.091 21.735 1.00 68.40 O
ATOM 9318 N HIS C 346 -42.460 10.002 17.125 1.00 47.87 N
ATOM 9319 CA HIS C 346 -43.341 10.763 16.246 1.00 46.30 C
ATOM 9320 C HIS C 346 -42.869 12.218 16.324 1.00 45.19 C
ATOM 9321 O HIS C 346 -42.499 12.696 17.400 1.00 45.70 O
ATOM 9322 CB HIS C 346 -44.785 10.657 16.743 1.00 46.59 C
ATOM 9323 CG HIS C 346 -45.762 11.491 15.969 1.00 48.98 C
ATOM 9324 ND1 HIS C 346 -46.263 11.111 14.741 1.00 49.74 N
ATOM 9325 CD2 HIS C 346 -46.325 12.693 16.246 1.00 48.82 C
ATOM 9326 CE1 HIS C 346 -47.090 12.041 14.296 1.00 48.65 C
ATOM 9327 NE2 HIS C 346 -47.146 13.011 15.189 1.00 49.50 N
ATOM 9328 N PRO C 347 -42.878 12.947 15.198 1.00 43.43 N
ATOM 9329 CA PRO C 347 -43.286 12.562 13.842 1.00 42.12 C
ATOM 9330 C PRO C 347 -42.131 11.968 13.023 1.00 41.68 C
ATOM 9331 O PRO C 347 -42.327 11.482 11.906 1.00 43.57 O
ATOM 9332 CB PRO C 347 -43.768 13.880 13.265 1.00 42.01 C
ATOM 9333 CG PRO C 347 -42.699 14.825 13.806 1.00 42.89 C
ATOM 9334 CD PRO C 347 -42.579 14.394 15.263 1.00 42.04 C
ATOM 9335 N PHE C 348 -40.927 12.017 13.582 1.00 38.40 N
ATOM 9336 CA PHE C 348 -39.746 11.498 12.915 1.00 35.47 C
ATOM 9337 C PHE C 348 -39.944 10.103 12.336 1.00 36.91 C
ATOM 9338 O PHE C 348 -39.707 9.882 11.147 1.00 37.38 O
ATOM 9339 CB PHE C 348 -38.580 11.498 13.890 1.00 32.00 C
ATOM 9340 CG PHE C 348 -38.269 12.846 14.437 1.00 28.30 C
ATOM 9341 CD1 PHE C 348 -37.872 13.002 15.754 1.00 29.21 C
ATOM 9342 CD2 PHE C 348 -38.391 13.969 13.643 1.00 27.95 C
ATOM 9343 CE1 PHE C 348 -37.603 14.273 16.277 1.00 26.84 C
ATOM 9344 CE2 PHE C 348 -38.127 15.228 14.153 1.00 28.11 C
ATOM 9345 CZ PHE C 348 -37.731 15.377 15.478 1.00 26.21 C
ATOM 9346 N ILE C 349 -40.383 9.166 13.170 1.00 37.48 N
ATOM 9347 CA ILE C 349 -40.603 7.794 12.720 1.00 38.60 C
ATOM 9348 C ILE C 349 -41.355 7.702 11.390 1.00 39.40 C
ATOM 9349 O ILE C 349 -40.910 7.026 10.459 1.00 40.05 O
ATOM 9350 CB ILE C 349 -41.381 6.969 13.783 1.00 38.05 C
ATOM 9351 CG1 ILE C 349 -40.536 6.846 15.051 1.00 37.71 C
ATOM 9352 CG2 ILE C 349 -41.721 5.583 13.239 1.00 36.10 C
ATOM 9353 CD1 ILE C 349 -41.184 6.049 16.152 1.00 37.08 C
ATOM 9354 N ILE C 350 -42.494 8.374 11.290 1.00 39.66 N
ATOM 9355 CA ILE C 350 -43.251 8.301 10.052 1.00 39.51 C
ATOM 9356 C ILE C 350 -42.538 9.054 8.933 1.00 38.59 C
ATOM 9357 O ILE C 350 -42.399 8.527 7.830 1.00 38.42 O
ATOM 9358 CB ILE C 350 -44.688 8.839 10.226 1.00 39.49 C
ATOM 9359 CG1 ILE C 350 -45.494 8.551 8.967 1.00 40.85 C
ATOM 9360 CG2 ILE C 350 -44.669 10.322 10.488 1.00 40.30 C
ATOM 9361 CD1 ILE C 350 -45.541 7.076 8.613 1.00 44.11 C
ATOM 9362 N ILE C 351 -42.077 10.270 9.216 1.00 37.55 N
ATOM 9363 CA ILE C 351 -41.369 11.051 8.204 1.00 38.35 C
ATOM 9364 C ILE C 351 -40.226 10.198 7.665 1.00 38.78 C
ATOM 9365 O ILE C 351 -39.995 10.146 6.452 1.00 39.47 O
ATOM 9366 CB ILE C 351 -40.744 12.351 8.780 1.00 38.22 C
ATOM 9367 CG1 ILE C 351 -41.822 13.235 9.401 1.00 35.98 C
ATOM 9368 CG2 ILE C 351 -40.031 13.116 7.675 1.00 35.75 C
ATOM 9369 CD1 ILE C 351 -41.284 14.514 9.970 1.00 36.41 C
ATOM 9370 N GLY C 352 -39.525 9.534 8.584 1.00 37.40 N
ATOM 9371 CA GLY C 352 -38.415 8.673 8.220 1.00 36.76 C
ATOM 9372 C GLY C 352 -38.795 7.592 7.227 1.00 37.04 C
ATOM 9373 O GLY C 352 -38.171 7.472 6.174 1.00 38.15 O
ATOM 9374 N GLN C 353 -39.819 6.809 7.552 1.00 37.96 N
ATOM 9375 CA GLN C 353 -40.282 5.724 6.678 1.00 37.56 C
ATOM 9376 C GLN C 353 -40.740 6.247 5.316 1.00 36.99 C
ATOM 9377 O GLN C 353 -40.608 5.567 4.304 1.00 35.15 O
ATOM 9378 CB GLN C 353 -41.409 4.968 7.369 1.00 37.91 C
ATOM 9379 CG GLN C 353 -40.967 4.365 8.685 1.00 38.82 C
ATOM 9380 CD GLN C 353 -42.125 3.907 9.521 1.00 38.99 C
ATOM 9381 OE1 GLN C 353 -43.098 4.637 9.699 1.00 43.83 O
ATOM 9382 NE2 GLN C 353 -42.029 2.700 10.052 1.00 37.76 N
ATOM 9383 N MET C 354 -41.280 7.458 5.298 1.00 36.38 N
ATOM 9384 CA MET C 354 -41.704 8.066 4.057 1.00 38.85 C
ATOM 9385 C MET C 354 -40.455 8.249 3.206 1.00 39.25 C
ATOM 9386 O MET C 354 -40.325 7.676 2.115 1.00 38.15 O
ATOM 9387 CB MET C 354 -42.309 9.444 4.322 1.00 46.05 C
ATOM 9388 CG MET C 354 -43.549 9.453 5.189 1.00 52.91 C
ATOM 9389 SD MET C 354 -44.943 8.728 4.323 1.00 62.62 S
ATOM 9390 CE MET C 354 -44.647 6.882 4.626 1.00 61.13 C
ATOM 9391 N ALA C 355 -39.528 9.057 3.724 1.00 37.93 N
ATOM 9392 CA ALA C 355 -38.283 9.341 3.025 1.00 36.31 C
ATOM 9393 C ALA C 355 -37.594 8.055 2.557 1.00 35.38 C
ATOM 9394 O ALA C 355 -37.134 7.968 1.416 1.00 35.29 O
ATOM 9395 CB ALA C 355 -37.361 10.173 3.921 1.00 34.47 C
ATOM 9396 N SER C 356 -37.533 7.053 3.425 1.00 34.33 N
ATOM 9397 CA SER C 356 -36.911 5.789 3.052 1.00 36.47 C
ATOM 9398 C SER C 356 -37.615 5.182 1.859 1.00 36.60 C
ATOM 9399 O SER C 356 -36.988 4.809 0.865 1.00 36.82 O
ATOM 9400 CB SER C 356 -36.979 4.805 4.200 1.00 35.96 C
ATOM 9401 OG SER C 356 -36.392 5.388 5.342 1.00 42.82 O
ATOM 9402 N LEU C 357 -38.931 5.083 1.971 1.00 36.28 N
ATOM 9403 CA LEU C 357 -39.741 4.513 0.922 1.00 35.37 C
ATOM 9404 C LEU C 357 -39.612 5.281 -0.395 1.00 34.32 C
ATOM 9405 O LEU C 357 -39.492 4.678 -1.460 1.00 32.91 O
ATOM 9406 CB LEU C 357 -41.192 4.475 1.380 1.00 38.54 C
ATOM 9407 CG LEU C 357 -42.165 3.872 0.379 1.00 40.82 C
ATOM 9408 CD1 LEU C 357 -41.717 2.457 0.034 1.00 40.76 C
ATOM 9409 CD2 LEU C 357 -43.556 3.881 0.972 1.00 40.63 C
ATOM 9410 N SER C 358 -39.624 6.606 -0.342 1.00 33.68 N
ATOM 9411 CA SER C 358 -39.495 7.368 -1.584 1.00 35.55 C
ATOM 9412 C SER C 358 -38.082 7.298 -2.162 1.00 36.21 C
ATOM 9413 O SER C 358 -37.906 7.392 -3.385 1.00 39.67 O
ATOM 9414 CB SER C 358 -39.902 8.830 -1.393 1.00 32.93 C
ATOM 9415 OG SER C 358 -39.503 9.282 -0.126 1.00 39.57 O
ATOM 9416 N TYR C 359 -37.077 7.139 -1.304 1.00 33.25 N
ATOM 9417 CA TYR C 359 -35.713 7.020 -1.792 1.00 31.46 C
ATOM 9418 C TYR C 359 -35.677 5.869 -2.796 1.00 31.31 C
ATOM 9419 O TYR C 359 -35.300 6.057 -3.953 1.00 31.42 O
ATOM 9420 CB TYR C 359 -34.768 6.717 -0.640 1.00 31.73 C
ATOM 9421 CG TYR C 359 -33.346 6.396 -1.045 1.00 30.43 C
ATOM 9422 CD1 TYR C 359 -32.481 7.390 -1.473 1.00 30.73 C
ATOM 9423 CD2 TYR C 359 -32.861 5.096 -0.960 1.00 31.55 C
ATOM 9424 CE1 TYR C 359 -31.161 7.104 -1.800 1.00 31.46 C
ATOM 9425 CE2 TYR C 359 -31.551 4.789 -1.285 1.00 32.67 C
ATOM 9426 CZ TYR C 359 -30.702 5.799 -1.700 1.00 34.65 C
ATOM 9427 OH TYR C 359 -29.385 5.501 -1.982 1.00 37.36 O
ATOM 9428 N PHE C 360 -36.099 4.684 -2.356 1.00 31.21 N
ATOM 9429 CA PHE C 360 -36.097 3.505 -3.219 1.00 32.49 C
ATOM 9430 C PHE C 360 -37.065 3.589 -4.390 1.00 33.67 C
ATOM 9431 O PHE C 360 -36.812 3.041 -5.473 1.00 31.03 O
ATOM 9432 CB PHE C 360 -36.399 2.252 -2.410 1.00 32.37 C
ATOM 9433 CG PHE C 360 -35.303 1.880 -1.466 1.00 34.83 C
ATOM 9434 CD1 PHE C 360 -35.360 2.256 -0.135 1.00 33.85 C
ATOM 9435 CD2 PHE C 360 -34.188 1.166 -1.917 1.00 35.31 C
ATOM 9436 CE1 PHE C 360 -34.317 1.922 0.739 1.00 35.29 C
ATOM 9437 CE2 PHE C 360 -33.144 0.831 -1.050 1.00 33.69 C
ATOM 9438 CZ PHE C 360 -33.210 1.209 0.277 1.00 33.71 C
ATOM 9439 N THR C 361 -38.176 4.279 -4.173 1.00 34.52 N
ATOM 9440 CA THR C 361 -39.168 4.435 -5.219 1.00 34.55 C
ATOM 9441 C THR C 361 -38.628 5.302 -6.349 1.00 34.51 C
ATOM 9442 O THR C 361 -38.857 5.007 -7.515 1.00 37.39 O
ATOM 9443 CB THR C 361 -40.423 5.070 -4.659 1.00 35.61 C
ATOM 9444 OG1 THR C 361 -40.860 4.298 -3.545 1.00 39.21 O
ATOM 9445 CG2 THR C 361 -41.520 5.100 -5.688 1.00 35.22 C
ATOM 9446 N ILE C 362 -37.920 6.375 -6.019 1.00 32.82 N
ATOM 9447 CA ILE C 362 -37.383 7.235 -7.063 1.00 31.88 C
ATOM 9448 C ILE C 362 -36.354 6.481 -7.904 1.00 32.95 C
ATOM 9449 O ILE C 362 -36.360 6.536 -9.132 1.00 32.04 O
ATOM 9450 CB ILE C 362 -36.700 8.476 -6.469 1.00 30.80 C
ATOM 9451 CG1 ILE C 362 -37.744 9.382 -5.829 1.00 29.40 C
ATOM 9452 CG2 ILE C 362 -35.930 9.220 -7.547 1.00 27.12 C
ATOM 9453 CD1 ILE C 362 -37.145 10.601 -5.212 1.00 30.78 C
ATOM 9454 N LEU C 363 -35.470 5.759 -7.234 1.00 33.31 N
ATOM 9455 CA LEU C 363 -34.438 5.037 -7.939 1.00 34.34 C
ATOM 9456 C LEU C 363 -34.910 3.808 -8.725 1.00 36.36 C
ATOM 9457 O LEU C 363 -34.468 3.592 -9.856 1.00 38.17 O
ATOM 9458 CB LEU C 363 -33.341 4.646 -6.953 1.00 33.31 C
ATOM 9459 CG LEU C 363 -32.539 5.805 -6.355 1.00 31.53 C
ATOM 9460 CD1 LEU C 363 -31.533 5.265 -5.387 1.00 30.98 C
ATOM 9461 CD2 LEU C 363 -31.834 6.579 -7.450 1.00 31.20 C
ATOM 9462 N LEU C 364 -35.809 3.013 -8.146 1.00 36.46 N
ATOM 9463 CA LEU C 364 -36.288 1.799 -8.809 1.00 35.42 C
ATOM 9464 C LEU C 364 -37.494 1.943 -9.734 1.00 35.97 C
ATOM 9465 O LEU C 364 -37.659 1.143 -10.667 1.00 35.88 O
ATOM 9466 CB LEU C 364 -36.579 0.711 -7.771 1.00 33.39 C
ATOM 9467 CG LEU C 364 -35.352 0.317 -6.940 1.00 32.94 C
ATOM 9468 CD1 LEU C 364 -35.749 -0.670 -5.851 1.00 32.09 C
ATOM 9469 CD2 LEU C 364 -34.288 -0.261 -7.846 1.00 29.52 C
ATOM 9470 N ILE C 365 -38.324 2.957 -9.514 1.00 34.65 N
ATOM 9471 CA ILE C 365 -39.495 3.116 -10.361 1.00 34.07 C
ATOM 9472 C ILE C 365 -39.577 4.428 -11.118 1.00 35.53 C
ATOM 9473 O ILE C 365 -39.646 4.449 -12.338 1.00 38.11 O
ATOM 9474 CB ILE C 365 -40.786 2.954 -9.541 1.00 32.03 C
ATOM 9475 CG1 ILE C 365 -40.804 1.574 -8.910 1.00 29.86 C
ATOM 9476 CG2 ILE C 365 -42.010 3.147 -10.419 1.00 27.01 C
ATOM 9477 CD1 ILE C 365 -41.688 1.507 -7.730 1.00 32.52 C
ATOM 9478 N LEU C 366 -39.572 5.537 -10.405 1.00 35.10 N
ATOM 9479 CA LEU C 366 -39.712 6.798 -11.093 1.00 34.80 C
ATOM 9480 C LEU C 366 -38.659 7.105 -12.140 1.00 34.61 C
ATOM 9481 O LEU C 366 -39.005 7.484 -13.248 1.00 37.62 O
ATOM 9482 CB LEU C 366 -39.833 7.936 -10.071 1.00 33.98 C
ATOM 9483 CG LEU C 366 -41.040 7.718 -9.130 1.00 32.99 C
ATOM 9484 CD1 LEU C 366 -41.318 8.979 -8.353 1.00 25.81 C
ATOM 9485 CD2 LEU C 366 -42.286 7.324 -9.956 1.00 30.21 C
ATOM 9486 N PHE C 367 -37.387 6.925 -11.832 1.00 34.37 N
ATOM 9487 CA PHE C 367 -36.368 7.245 -12.826 1.00 35.32 C
ATOM 9488 C PHE C 367 -36.482 6.483 -14.135 1.00 35.30 C
ATOM 9489 O PHE C 367 -36.424 7.083 -15.199 1.00 37.21 O
ATOM 9490 CB PHE C 367 -34.962 7.102 -12.233 1.00 36.34 C
ATOM 9491 CG PHE C 367 -34.387 8.406 -11.757 1.00 35.98 C
ATOM 9492 CD1 PHE C 367 -33.725 8.493 -10.545 1.00 37.80 C
ATOM 9493 CD2 PHE C 367 -34.527 9.556 -12.523 1.00 37.37 C
ATOM 9494 CE1 PHE C 367 -33.211 9.707 -10.101 1.00 38.87 C
ATOM 9495 CE2 PHE C 367 -34.019 10.772 -12.091 1.00 37.49 C
ATOM 9496 CZ PHE C 367 -33.360 10.850 -10.878 1.00 38.76 C
ATOM 9497 N PRO C 368 -36.614 5.156 -14.087 1.00 34.46 N
ATOM 9498 CA PRO C 368 -36.737 4.478 -15.375 1.00 34.67 C
ATOM 9499 C PRO C 368 -38.080 4.810 -16.038 1.00 35.27 C
ATOM 9500 O PRO C 368 -38.169 4.976 -17.258 1.00 39.03 O
ATOM 9501 CB PRO C 368 -36.614 3.002 -15.006 1.00 33.87 C
ATOM 9502 CG PRO C 368 -37.069 2.950 -13.585 1.00 34.60 C
ATOM 9503 CD PRO C 368 -36.432 4.186 -13.000 1.00 34.70 C
ATOM 9504 N THR C 369 -39.123 4.919 -15.234 1.00 33.38 N
ATOM 9505 CA THR C 369 -40.434 5.232 -15.761 1.00 33.51 C
ATOM 9506 C THR C 369 -40.442 6.585 -16.464 1.00 34.78 C
ATOM 9507 O THR C 369 -40.862 6.682 -17.621 1.00 34.59 O
ATOM 9508 CB THR C 369 -41.483 5.218 -14.637 1.00 32.63 C
ATOM 9509 OG1 THR C 369 -41.649 3.874 -14.194 1.00 33.83 O
ATOM 9510 CG2 THR C 369 -42.817 5.724 -15.123 1.00 31.01 C
ATOM 9511 N ILE C 370 -39.980 7.623 -15.767 1.00 33.98 N
ATOM 9512 CA ILE C 370 -39.941 8.966 -16.323 1.00 33.13 C
ATOM 9513 C ILE C 370 -39.026 9.014 -17.543 1.00 32.65 C
ATOM 9514 O ILE C 370 -39.305 9.731 -18.506 1.00 31.47 O
ATOM 9515 CB ILE C 370 -39.462 9.980 -15.249 1.00 34.20 C
ATOM 9516 CG1 ILE C 370 -40.484 10.020 -14.111 1.00 35.27 C
ATOM 9517 CG2 ILE C 370 -39.280 11.389 -15.845 1.00 35.84 C
ATOM 9518 CD1 ILE C 370 -41.879 10.417 -14.526 1.00 33.14 C
ATOM 9519 N GLY C 371 -37.948 8.236 -17.513 1.00 32.25 N
ATOM 9520 CA GLY C 371 -37.019 8.222 -18.632 1.00 34.95 C
ATOM 9521 C GLY C 371 -37.694 7.769 -19.910 1.00 36.41 C
ATOM 9522 O GLY C 371 -37.450 8.297 -21.005 1.00 37.02 O
ATOM 9523 N THR C 372 -38.546 6.762 -19.754 1.00 37.40 N
ATOM 9524 CA THR C 372 -39.316 6.194 -20.844 1.00 35.46 C
ATOM 9525 C THR C 372 -40.335 7.212 -21.305 1.00 34.27 C
ATOM 9526 O THR C 372 -40.514 7.418 -22.499 1.00 32.77 O
ATOM 9527 CB THR C 372 -40.054 4.940 -20.368 1.00 35.93 C
ATOM 9528 OG1 THR C 372 -39.096 3.905 -20.110 1.00 38.30 O
ATOM 9529 CG2 THR C 372 -41.068 4.483 -21.397 1.00 33.00 C
ATOM 9530 N LEU C 373 -40.993 7.845 -20.337 1.00 35.20 N
ATOM 9531 CA LEU C 373 -42.013 8.836 -20.607 1.00 35.55 C
ATOM 9532 C LEU C 373 -41.405 9.985 -21.383 1.00 36.32 C
ATOM 9533 O LEU C 373 -41.987 10.469 -22.347 1.00 37.11 O
ATOM 9534 CB LEU C 373 -42.632 9.314 -19.299 1.00 36.33 C
ATOM 9535 CG LEU C 373 -43.675 10.436 -19.418 1.00 40.73 C
ATOM 9536 CD1 LEU C 373 -44.698 10.108 -20.496 1.00 40.36 C
ATOM 9537 CD2 LEU C 373 -44.379 10.621 -18.075 1.00 39.69 C
ATOM 9538 N GLU C 374 -40.214 10.405 -20.985 1.00 37.78 N
ATOM 9539 CA GLU C 374 -39.529 11.482 -21.699 1.00 38.69 C
ATOM 9540 C GLU C 374 -39.174 11.062 -23.132 1.00 37.32 C
ATOM 9541 O GLU C 374 -39.242 11.866 -24.049 1.00 38.69 O
ATOM 9542 CB GLU C 374 -38.254 11.903 -20.955 1.00 40.64 C
ATOM 9543 CG GLU C 374 -38.490 12.910 -19.836 1.00 45.71 C
ATOM 9544 CD GLU C 374 -37.256 13.123 -18.953 1.00 49.93 C
ATOM 9545 OE1 GLU C 374 -37.096 14.259 -18.423 1.00 49.38 O
ATOM 9546 OE2 GLU C 374 -36.463 12.152 -18.790 1.00 48.58 O
ATOM 9547 N ASN C 375 -38.784 9.813 -23.340 1.00 36.25 N
ATOM 9548 CA ASN C 375 -38.449 9.392 -24.692 1.00 35.61 C
ATOM 9549 C ASN C 375 -39.632 9.621 -25.613 1.00 35.96 C
ATOM 9550 O ASN C 375 -39.464 10.074 -26.738 1.00 35.45 O
ATOM 9551 CB ASN C 375 -38.069 7.909 -24.740 1.00 35.50 C
ATOM 9552 CG ASN C 375 -36.657 7.642 -24.263 1.00 34.02 C
ATOM 9553 OD1 ASN C 375 -35.816 8.532 -24.275 1.00 34.49 O
ATOM 9554 ND2 ASN C 375 -36.382 6.402 -23.863 1.00 33.66 N
ATOM 9555 N LYS C 376 -40.833 9.316 -25.130 1.00 37.34 N
ATOM 9556 CA LYS C 376 -42.025 9.479 -25.941 1.00 38.52 C
ATOM 9557 C LYS C 376 -42.337 10.930 -26.232 1.00 38.54 C
ATOM 9558 O LYS C 376 -42.762 11.263 -27.336 1.00 40.97 O
ATOM 9559 CB LYS C 376 -43.216 8.787 -25.284 1.00 40.25 C
ATOM 9560 CG LYS C 376 -43.095 7.267 -25.307 1.00 45.79 C
ATOM 9561 CD LYS C 376 -44.356 6.590 -24.789 1.00 52.86 C
ATOM 9562 CE LYS C 376 -44.148 5.085 -24.508 1.00 56.41 C
ATOM 9563 NZ LYS C 376 -43.818 4.282 -25.729 1.00 59.18 N
ATOM 9564 N MET C 377 -42.120 11.806 -25.264 1.00 37.01 N
ATOM 9565 CA MET C 377 -42.372 13.215 -25.499 1.00 38.61 C
ATOM 9566 C MET C 377 -41.429 13.808 -26.536 1.00 39.56 C
ATOM 9567 O MET C 377 -41.649 14.910 -27.030 1.00 41.63 O
ATOM 9568 CB MET C 377 -42.281 13.983 -24.191 1.00 40.80 C
ATOM 9569 CG MET C 377 -43.455 13.673 -23.292 1.00 43.84 C
ATOM 9570 SD MET C 377 -43.187 14.248 -21.643 1.00 50.92 S
ATOM 9571 CE MET C 377 -43.494 15.970 -21.863 1.00 49.65 C
ATOM 9572 N LEU C 378 -40.384 13.065 -26.871 1.00 40.83 N
ATOM 9573 CA LEU C 378 -39.409 13.481 -27.870 1.00 41.09 C
ATOM 9574 C LEU C 378 -39.759 12.832 -29.196 1.00 42.18 C
ATOM 9575 O LEU C 378 -39.149 13.107 -30.230 1.00 43.12 O
ATOM 9576 CB LEU C 378 -38.011 13.048 -27.449 1.00 40.93 C
ATOM 9577 CG LEU C 378 -37.224 13.994 -26.547 1.00 39.83 C
ATOM 9578 CD1 LEU C 378 -35.827 13.437 -26.322 1.00 42.20 C
ATOM 9579 CD2 LEU C 378 -37.114 15.349 -27.211 1.00 41.18 C
ATOM 9580 N ASN C 379 -40.753 11.959 -29.140 1.00 43.93 N
ATOM 9581 CA ASN C 379 -41.247 11.214 -30.289 1.00 46.91 C
ATOM 9582 C ASN C 379 -40.314 10.092 -30.720 1.00 48.23 C
ATOM 9583 O ASN C 379 -40.084 9.870 -31.912 1.00 47.80 O
ATOM 9584 CB ASN C 379 -41.529 12.134 -31.466 1.00 48.05 C
ATOM 9585 CG ASN C 379 -42.566 11.553 -32.404 1.00 50.27 C
ATOM 9586 OD1 ASN C 379 -43.699 11.281 -32.000 1.00 46.25 O
ATOM 9587 ND2 ASN C 379 -42.181 11.350 -33.669 1.00 54.32 N
ATOM 9588 N TYR C 380 -39.791 9.400 -29.709 1.00 50.03 N
ATOM 9589 CA TYR C 380 -38.895 8.250 -29.835 1.00 50.92 C
ATOM 9590 C TYR C 380 -39.613 7.150 -29.060 1.00 53.84 C
ATOM 9591 O TYR C 380 -40.863 7.219 -28.969 1.00 55.79 O
ATOM 9592 CB TYR C 380 -37.564 8.508 -29.135 1.00 48.19 C
ATOM 9593 CG TYR C 380 -36.599 9.411 -29.847 1.00 45.50 C
ATOM 9594 CD1 TYR C 380 -35.874 10.373 -29.135 1.00 44.21 C
ATOM 9595 CD2 TYR C 380 -36.330 9.246 -31.201 1.00 45.19 C
ATOM 9596 CE1 TYR C 380 -34.899 11.144 -29.748 1.00 44.35 C
ATOM 9597 CE2 TYR C 380 -35.354 10.006 -31.833 1.00 45.85 C
ATOM 9598 CZ TYR C 380 -34.640 10.957 -31.102 1.00 45.61 C
ATOM 9599 OH TYR C 380 -33.661 11.711 -31.715 1.00 44.04 O
ATOM 9600 OXT TYR C 380 -38.917 6.251 -28.532 1.00 56.56 O
HETATM31868 CHA HEM C 501 -8.246 7.850 12.909 1.00 26.61 C
HETATM31869 CHB HEM C 501 -10.416 8.227 8.632 1.00 25.70 C
HETATM31870 CHC HEM C 501 -6.290 6.821 6.521 1.00 28.20 C
HETATM31871 CHD HEM C 501 -4.235 6.405 10.784 1.00 29.20 C
HETATM31872 C1A HEM C 501 -9.164 8.086 11.909 1.00 27.84 C
HETATM31873 C2A HEM C 501 -10.480 8.623 12.155 1.00 27.82 C
HETATM31874 C3A HEM C 501 -11.168 8.550 10.989 1.00 26.17 C
HETATM31875 C4A HEM C 501 -10.182 8.196 9.989 1.00 25.97 C
HETATM31876 CMA HEM C 501 -12.656 8.797 10.787 1.00 25.02 C
HETATM31877 CAA HEM C 501 -10.945 9.103 13.503 1.00 28.65 C
HETATM31878 CBA HEM C 501 -10.661 10.579 13.714 1.00 33.14 C
HETATM31879 CGA HEM C 501 -10.970 11.023 15.135 1.00 37.28 C
HETATM31880 O1A HEM C 501 -10.077 10.884 16.006 1.00 37.43 O
HETATM31881 O2A HEM C 501 -12.112 11.493 15.385 1.00 38.83 O
HETATM31882 C1B HEM C 501 -9.474 7.939 7.665 1.00 24.69 C
HETATM31883 C2B HEM C 501 -9.777 7.845 6.236 1.00 22.92 C
HETATM31884 C3B HEM C 501 -8.558 7.561 5.658 1.00 23.44 C
HETATM31885 C4B HEM C 501 -7.606 7.302 6.714 1.00 26.46 C
HETATM31886 CMB HEM C 501 -11.140 8.029 5.558 1.00 17.86 C
HETATM31887 CAB HEM C 501 -8.204 7.552 4.344 1.00 21.99 C
HETATM31888 CBB HEM C 501 -8.989 6.811 3.331 1.00 23.58 C
HETATM31889 C1C HEM C 501 -5.348 6.549 7.500 1.00 27.01 C
HETATM31890 C2C HEM C 501 -4.035 5.992 7.291 1.00 27.42 C
HETATM31891 C3C HEM C 501 -3.498 5.834 8.515 1.00 28.55 C
HETATM31892 C4C HEM C 501 -4.451 6.348 9.424 1.00 27.81 C
HETATM31893 CMC HEM C 501 -3.368 5.693 5.954 1.00 26.78 C
HETATM31894 CAC HEM C 501 -2.246 5.373 8.929 1.00 31.97 C
HETATM31895 CBC HEM C 501 -1.050 4.877 8.130 1.00 33.43 C
HETATM31896 C1D HEM C 501 -5.144 6.848 11.713 1.00 27.63 C
HETATM31897 C2D HEM C 501 -4.861 6.842 13.133 1.00 27.04 C
HETATM31898 C3D HEM C 501 -5.974 7.298 13.745 1.00 27.85 C
HETATM31899 C4D HEM C 501 -6.981 7.466 12.683 1.00 26.96 C
HETATM31900 CMD HEM C 501 -3.586 6.429 13.821 1.00 23.64 C
HETATM31901 CAD HEM C 501 -5.987 7.523 15.238 1.00 28.86 C
HETATM31902 CBD HEM C 501 -5.707 8.901 15.814 1.00 29.50 C
HETATM31903 CGD HEM C 501 -6.943 9.774 15.793 1.00 35.14 C
HETATM31904 O1D HEM C 501 -8.048 9.264 16.096 1.00 40.14 O
HETATM31905 O2D HEM C 501 -6.827 10.975 15.487 1.00 37.58 O
HETATM31906 NA HEM C 501 -8.939 7.908 10.558 1.00 27.10 N
HETATM31907 NB HEM C 501 -8.157 7.561 7.952 1.00 25.16 N
HETATM31908 NC HEM C 501 -5.594 6.775 8.812 1.00 27.02 N
HETATM31909 ND HEM C 501 -6.447 7.242 11.421 1.00 26.08 N
HETATM31910 FE HEM C 501 -7.258 7.418 9.637 1.00 25.37 F
HETATM31911 CHA HEM C 502 -14.245 9.656 -12.656 1.00 20.14 C
HETATM31912 CHB HEM C 502 -11.424 9.309 -8.745 1.00 20.25 C
HETATM31913 CHC HEM C 502 -15.158 7.212 -6.489 1.00 19.79 C
HETATM31914 CHD HEM C 502 -17.506 6.900 -10.545 1.00 18.47 C
HETATM31915 C1A HEM C 502 -13.190 9.788 -11.802 1.00 19.48 C
HETATM31916 C2A HEM C 502 -12.005 10.588 -12.055 1.00 21.41 C
HETATM31917 C3A HEM C 502 -11.154 10.387 -11.007 1.00 20.60 C
HETATM31918 C4A HEM C 502 -11.877 9.574 -10.070 1.00 21.75 C
HETATM31919 CMA HEM C 502 -9.843 11.100 -10.736 1.00 18.92 C
HETATM31920 CAA HEM C 502 -11.757 11.521 -13.246 1.00 21.99 C
HETATM31921 CBA HEM C 502 -12.206 12.972 -13.085 1.00 23.63 C
HETATM31922 CGA HEM C 502 -13.708 13.123 -12.821 1.00 25.44 C
HETATM31923 O1A HEM C 502 -14.079 13.409 -11.658 1.00 26.12 O
HETATM31924 O2A HEM C 502 -14.514 12.955 -13.769 1.00 22.38 O
HETATM31925 C1B HEM C 502 -12.216 8.700 -7.798 1.00 20.20 C
HETATM31926 C2B HEM C 502 -11.757 8.406 -6.439 1.00 20.16 C
HETATM31927 C3B HEM C 502 -12.815 7.787 -5.797 1.00 20.06 C
HETATM31928 C4B HEM C 502 -13.926 7.764 -6.791 1.00 20.95 C
HETATM31929 CMB HEM C 502 -10.396 8.723 -5.890 1.00 20.73 C
HETATM31930 CAB HEM C 502 -12.945 7.280 -4.526 1.00 19.37 C
HETATM31931 CBB HEM C 502 -11.792 6.847 -3.600 1.00 26.38 C
HETATM31932 C1C HEM C 502 -16.156 6.990 -7.381 1.00 19.00 C
HETATM31933 C2C HEM C 502 -17.483 6.564 -7.049 1.00 17.23 C
HETATM31934 C3C HEM C 502 -18.168 6.438 -8.218 1.00 17.32 C
HETATM31935 C4C HEM C 502 -17.231 6.868 -9.235 1.00 17.08 C
HETATM31936 CMC HEM C 502 -17.943 6.340 -5.639 1.00 17.10 C
HETATM31937 CAC HEM C 502 -19.447 5.934 -8.482 1.00 16.61 C
HETATM31938 CBC HEM C 502 -20.280 5.208 -7.444 1.00 16.62 C
HETATM31939 C1D HEM C 502 -16.737 7.506 -11.503 1.00 18.45 C
HETATM31940 C2D HEM C 502 -17.217 7.643 -12.893 1.00 18.77 C
HETATM31941 C3D HEM C 502 -16.414 8.557 -13.502 1.00 20.42 C
HETATM31942 C4D HEM C 502 -15.361 8.861 -12.438 1.00 20.18 C
HETATM31943 CMD HEM C 502 -18.381 6.897 -13.541 1.00 15.30 C
HETATM31944 CAD HEM C 502 -16.678 9.073 -14.929 1.00 20.60 C
HETATM31945 CBD HEM C 502 -16.746 10.581 -15.013 1.00 28.31 C
HETATM31946 CGD HEM C 502 -17.324 11.108 -16.334 1.00 32.51 C
HETATM31947 O1D HEM C 502 -18.573 11.144 -16.474 1.00 32.59 O
HETATM31948 O2D HEM C 502 -16.528 11.491 -17.232 1.00 32.29 O
HETATM31949 NA HEM C 502 -13.155 9.219 -10.571 1.00 20.29 N
HETATM31950 NB HEM C 502 -13.540 8.242 -8.027 1.00 17.93 N
HETATM31951 NC HEM C 502 -16.038 7.297 -8.717 1.00 19.59 N
HETATM31952 ND HEM C 502 -15.553 8.152 -11.265 1.00 17.31 N
HETATM31953 FE HEM C 502 -14.521 8.194 -9.636 1.00 20.09 F
HETATM31954 O6 FMX C2001 -20.701 7.106 12.145 1.00 50.00 O
HETATM31955 C6 FMX C2001 -19.892 6.284 12.446 1.00 46.18 C
HETATM31956 N2 FMX C2001 -19.826 5.640 13.621 1.00 45.35 N
HETATM31957 N1 FMX C2001 -20.727 5.850 14.700 1.00 39.97 N
HETATM31958 C21 FMX C2001 -21.960 5.201 14.819 1.00 34.23 C
HETATM31959 C22 FMX C2001 -22.858 5.630 15.820 1.00 33.01 C
HETATM31960 C23 FMX C2001 -24.111 5.006 15.967 1.00 31.26 C
HETATM31961 C24 FMX C2001 -24.471 3.949 15.118 1.00 34.33 C
HETATM31962 C25 FMX C2001 -23.573 3.511 14.114 1.00 34.73 C
HETATM31963 C26 FMX C2001 -22.323 4.134 13.961 1.00 33.74 C
HETATM31964 C3 FMX C2001 -18.788 4.772 13.643 1.00 47.65 C
HETATM31965 O4 FMX C2001 -18.099 4.787 12.487 1.00 49.49 O
HETATM31966 O3 FMX C2001 -18.498 4.057 14.594 1.00 45.92 O
HETATM31967 C5 FMX C2001 -18.734 5.757 11.596 1.00 48.18 C
HETATM31968 C7 FMX C2001 -17.758 6.889 11.276 1.00 47.69 C
HETATM31969 C8 FMX C2001 -19.179 4.980 10.340 1.00 49.99 C
HETATM31970 C9 FMX C2001 -20.278 4.139 10.414 1.00 53.86 C
HETATM31971 C10 FMX C2001 -20.688 3.397 9.320 1.00 55.78 C
HETATM31972 C11 FMX C2001 -20.005 3.472 8.108 1.00 56.66 C
HETATM31973 C12 FMX C2001 -18.904 4.320 8.016 1.00 52.90 C
HETATM31974 C13 FMX C2001 -18.489 5.074 9.139 1.00 49.79 C
HETATM31975 O14 FMX C2001 -20.394 2.732 7.030 1.00 61.58 O
HETATM31976 C15 FMX C2001 -20.284 1.382 7.235 1.00 62.41 C
HETATM31977 C16 FMX C2001 -19.042 0.750 7.334 1.00 61.08 C
HETATM31978 C17 FMX C2001 -18.952 -0.618 7.538 1.00 59.87 C
HETATM31979 C18 FMX C2001 -20.102 -1.381 7.647 1.00 59.89 C
HETATM31980 C19 FMX C2001 -21.342 -0.769 7.548 1.00 60.17 C
HETATM31981 C20 FMX C2001 -21.431 0.598 7.344 1.00 61.15 C
HETATM31982 C1 UQ C2002 -8.896 14.148 -14.183 1.00 84.78 C
HETATM31983 C2 UQ C2002 -9.785 13.767 -15.417 1.00 85.92 C
HETATM31984 C3 UQ C2002 -9.558 12.569 -16.141 1.00 85.99 C
HETATM31985 C4 UQ C2002 -8.412 11.612 -15.718 1.00 85.10 C
HETATM31986 C5 UQ C2002 -7.513 11.972 -14.500 1.00 84.40 C
HETATM31987 C6 UQ C2002 -7.737 13.182 -13.755 1.00 83.48 C
HETATM31988 CM5 UQ C2002 -6.378 10.947 -14.163 1.00 84.23 C
HETATM31989 CM3 UQ C2002 -9.812 12.441 -18.609 1.00 86.39 C
HETATM31990 CM2 UQ C2002 -10.462 15.697 -16.759 1.00 85.68 C
HETATM31991 C7 UQ C2002 -6.872 13.646 -12.501 1.00 81.77 C
HETATM31992 C8 UQ C2002 -6.507 12.622 -11.420 1.00 80.28 C
HETATM31993 C9 UQ C2002 -5.526 12.713 -10.478 1.00 81.28 C
HETATM31994 C10 UQ C2002 -4.646 13.960 -10.423 1.00 80.52 C
HETATM31995 C11 UQ C2002 -5.215 11.641 -9.437 1.00 81.50 C
HETATM31996 C12 UQ C2002 -4.213 10.529 -9.860 1.00 81.88 C
HETATM31997 O2 UQ C2002 -10.831 14.669 -15.792 1.00 86.29 O
HETATM31998 O3 UQ C2002 -10.370 12.205 -17.276 1.00 86.40 O
HETATM31999 O4 UQ C2002 -8.216 10.562 -16.360 1.00 85.47 O
HETATM32000 O1 UQ C2002 -9.118 15.224 -13.548 1.00 83.83 O
HETATM32001 C2 PEE C2007 -27.334 22.335 -12.504 1.00 40.44 C
HETATM32002 C1 PEE C2007 -27.647 22.547 -13.990 1.00 39.07 C
HETATM32003 N PEE C2007 -27.244 23.839 -19.830 1.00 41.72 N
HETATM32004 C3 PEE C2007 -28.373 23.030 -11.558 1.00 44.68 C
HETATM32005 C4 PEE C2007 -26.067 23.802 -17.624 1.00 42.05 C
HETATM32006 C5 PEE C2007 -26.385 24.608 -18.892 1.00 43.33 C
HETATM32007 C10 PEE C2007 -25.915 20.436 -11.805 1.00 39.40 C
HETATM32008 C11 PEE C2007 -25.660 18.920 -11.994 1.00 38.24 C
HETATM32009 C12 PEE C2007 -25.952 18.065 -10.745 1.00 35.16 C
HETATM32010 C13 PEE C2007 -24.681 17.652 -9.990 1.00 33.64 C
HETATM32011 C14 PEE C2007 -24.749 17.879 -8.462 1.00 37.74 C
HETATM32012 C15 PEE C2007 -25.156 16.653 -7.603 1.00 35.90 C
HETATM32013 C16 PEE C2007 -24.706 16.760 -6.131 1.00 39.94 C
HETATM32014 C17 PEE C2007 -25.797 16.446 -5.077 1.00 43.45 C
HETATM32015 C18 PEE C2007 -25.263 15.568 -3.950 1.00 46.22 C
HETATM32016 C19 PEE C2007 -25.900 14.578 -3.300 1.00 47.32 C
HETATM32017 C20 PEE C2007 -25.648 13.083 -3.383 1.00 51.39 C
HETATM32018 C21 PEE C2007 -26.609 12.358 -4.323 1.00 55.02 C
HETATM32019 C22 PEE C2007 -26.424 11.158 -4.910 1.00 56.93 C
HETATM32020 C23 PEE C2007 -26.677 9.790 -4.281 1.00 58.58 C
HETATM32021 C24 PEE C2007 -27.712 8.912 -5.040 1.00 58.96 C
HETATM32022 C25 PEE C2007 -28.018 7.553 -4.359 1.00 57.19 C
HETATM32023 C30 PEE C2007 -27.137 23.733 -9.581 1.00 54.11 C
HETATM32024 C31 PEE C2007 -27.129 23.755 -8.021 1.00 56.68 C
HETATM32025 C32 PEE C2007 -26.102 22.808 -7.354 1.00 58.29 C
HETATM32026 C33 PEE C2007 -26.337 22.674 -5.830 1.00 62.11 C
HETATM32027 C34 PEE C2007 -25.755 21.359 -5.258 1.00 65.33 C
HETATM32028 C35 PEE C2007 -25.082 21.551 -3.885 1.00 67.17 C
HETATM32029 C36 PEE C2007 -25.219 20.298 -2.993 1.00 70.17 C
HETATM32030 C37 PEE C2007 -26.291 20.477 -1.889 1.00 72.20 C
HETATM32031 C38 PEE C2007 -25.851 19.886 -0.529 1.00 72.01 C
HETATM32032 C39 PEE C2007 -26.543 18.550 -0.147 1.00 72.88 C
HETATM32033 C40 PEE C2007 -25.566 17.417 0.292 1.00 72.42 C
HETATM32034 C41 PEE C2007 -26.258 16.038 0.433 1.00 70.16 C
HETATM32035 C42 PEE C2007 -26.355 15.562 1.910 1.00 67.26 C
HETATM32036 C43 PEE C2007 -25.709 14.184 2.201 1.00 61.25 C
HETATM32037 C44 PEE C2007 -26.355 12.957 1.525 1.00 59.26 C
HETATM32038 C45 PEE C2007 -25.477 11.700 1.513 1.00 57.80 C
HETATM32039 C46 PEE C2007 -25.529 10.969 0.162 1.00 58.47 C
HETATM32040 O4 PEE C2007 -25.064 21.168 -11.304 1.00 43.20 O
HETATM32041 O5 PEE C2007 -26.362 24.427 -10.260 1.00 57.40 O
HETATM32042 O2 PEE C2007 -27.175 20.877 -12.243 1.00 39.76 O
HETATM32043 O3 PEE C2007 -28.099 22.862 -10.121 1.00 49.08 O
HETATM32044 O1P PEE C2007 -25.723 20.721 -16.950 1.00 42.52 O
HETATM32045 O2P PEE C2007 -28.310 20.610 -16.532 1.00 39.25 O
HETATM32046 O3P PEE C2007 -26.699 21.846 -14.820 1.00 39.81 O
HETATM32047 O4P PEE C2007 -27.174 22.927 -17.202 1.00 44.67 O
HETATM32048 P PEE C2007 -26.995 21.516 -16.368 1.00 40.52 P
HETATM32049 C2 PEE C2008 5.768 23.243 -14.889 1.00103.77 C
HETATM32050 C1 PEE C2008 5.839 24.218 -16.114 1.00 99.91 C
HETATM32051 C3 PEE C2008 7.073 23.240 -14.022 1.00105.82 C
HETATM32052 C4 PEE C2008 7.280 23.654 -20.439 1.00 91.83 C
HETATM32053 C5 PEE C2008 7.615 23.953 -21.919 1.00 89.95 C
HETATM32054 C10 PEE C2008 3.465 22.629 -14.153 1.00105.28 C
HETATM32055 C11 PEE C2008 2.090 23.336 -14.263 1.00105.00 C
HETATM32056 C12 PEE C2008 1.153 23.096 -13.061 1.00104.01 C
HETATM32057 C13 PEE C2008 -0.091 23.992 -13.145 1.00103.59 C
HETATM32058 C30 PEE C2008 8.535 21.388 -14.698 1.00110.36 C
HETATM32059 C31 PEE C2008 8.910 20.772 -16.087 1.00110.22 C
HETATM32060 C32 PEE C2008 10.336 20.170 -16.174 1.00109.00 C
HETATM32061 O4 PEE C2008 3.557 21.389 -14.156 1.00105.83 O
HETATM32062 O5 PEE C2008 8.474 20.700 -13.656 1.00111.22 O
HETATM32063 O2 PEE C2008 4.564 23.526 -14.051 1.00105.33 O
HETATM32064 O3 PEE C2008 8.279 22.789 -14.749 1.00109.01 O
HETATM32065 O1P PEE C2008 3.615 23.842 -18.729 1.00 93.69 O
HETATM32066 O2P PEE C2008 5.314 25.816 -18.704 1.00 94.44 O
HETATM32067 O3P PEE C2008 5.890 23.559 -17.425 1.00 95.78 O
HETATM32068 O4P PEE C2008 5.841 23.622 -20.132 1.00 92.53 O
HETATM32069 P PEE C2008 5.173 24.212 -18.749 1.00 93.22 P
HETATM32070 N1 AZI C2011 -10.751 12.814 21.653 1.00 63.35 N
HETATM32071 N2 AZI C2011 -9.773 12.998 22.256 1.00 64.87 N
HETATM32072 N3 AZI C2011 -8.785 13.178 22.863 1.00 62.73 N
HETATM32073 O1 UNL C2047 -25.449 6.964 -1.826 1.00 28.27 O
HETATM32074 O1 UNL C2046 -10.444 16.644 15.445 1.00 78.03 O
HETATM32075 O2 UNL C2046 -9.499 16.305 16.536 1.00 80.21 O
HETATM32076 O1 UNL C2048 -31.741 5.870 -14.188 1.00 41.31 O
HETATM32077 O2 UNL C2048 -31.739 7.328 -14.534 1.00 45.87 O
HETATM32078 C1 BOG C3010 -3.540 3.445 -18.273 1.00 82.97 C
HETATM32079 O1 BOG C3010 -3.851 4.292 -17.198 1.00 81.80 O
HETATM32080 C2 BOG C3010 -3.809 4.194 -19.622 1.00 82.75 C
HETATM32081 O5 BOG C3010 -2.141 3.065 -18.150 1.00 84.16 O
HETATM32082 C1' BOG C3010 -3.860 3.757 -15.853 1.00 79.44 C
HETATM32083 C2' BOG C3010 -3.008 4.643 -14.959 1.00 78.69 C
HETATM32084 C3' BOG C3010 -3.771 5.845 -14.452 1.00 78.36 C
HETATM32085 C4' BOG C3010 -3.226 6.200 -13.084 1.00 79.06 C
HETATM32086 C5' BOG C3010 -3.461 7.649 -12.701 1.00 79.85 C
HETATM32087 C6' BOG C3010 -2.174 8.457 -12.804 1.00 81.92 C
HETATM32088 C7' BOG C3010 -1.502 8.561 -11.454 1.00 83.29 C
HETATM32089 C8' BOG C3010 -0.266 9.364 -11.664 1.00 83.44 C
HETATM32698 O HOH C 381 -15.732 14.603 -10.004 1.00 26.06 O
HETATM32699 O HOH C 382 -15.636 11.105 10.803 1.00 26.22 O
HETATM32700 O HOH C 383 -16.436 12.465 16.889 1.00 48.78 O
HETATM32701 O HOH C 384 -19.055 10.015 -10.948 1.00 15.83 O
HETATM32702 O HOH C 385 -11.164 18.573 -14.218 1.00 39.57 O
HETATM32703 O HOH C 386 -14.295 11.795 -16.039 1.00 23.50 O
HETATM32704 O HOH C 387 -10.865 16.099 -11.270 1.00 22.78 O
HETATM32705 O HOH C1008 -9.898 19.929 -8.642 1.00 27.54 O
HETATM32706 O HOH C1288 -28.872 11.796 18.959 1.00 42.00 O
TER 32707 HOH C1288
ATOM 9602 N GLY D 1 -41.110 14.923 30.563 1.00 79.90 N
ATOM 9603 CA GLY D 1 -40.086 13.848 30.649 1.00 80.87 C
ATOM 9604 C GLY D 1 -38.884 14.100 29.754 1.00 81.60 C
ATOM 9605 O GLY D 1 -37.752 13.784 30.124 1.00 81.33 O
ATOM 9606 N GLU D 2 -39.133 14.671 28.575 1.00 82.43 N
ATOM 9607 CA GLU D 2 -38.080 14.974 27.590 1.00 81.81 C
ATOM 9608 C GLU D 2 -37.698 16.459 27.647 1.00 79.45 C
ATOM 9609 O GLU D 2 -37.136 17.011 26.687 1.00 78.87 O
ATOM 9610 CB GLU D 2 -38.577 14.661 26.177 1.00 83.98 C
ATOM 9611 CG GLU D 2 -39.249 13.312 26.016 1.00 88.11 C
ATOM 9612 CD GLU D 2 -40.054 13.228 24.728 1.00 90.90 C
ATOM 9613 OE1 GLU D 2 -39.477 13.527 23.658 1.00 92.01 O
ATOM 9614 OE2 GLU D 2 -41.256 12.868 24.786 1.00 91.56 O
ATOM 9615 N LEU D 3 -38.005 17.101 28.771 1.00 75.57 N
ATOM 9616 CA LEU D 3 -37.723 18.516 28.926 1.00 70.69 C
ATOM 9617 C LEU D 3 -36.321 18.802 29.396 1.00 67.12 C
ATOM 9618 O LEU D 3 -35.798 18.143 30.292 1.00 65.76 O
ATOM 9619 CB LEU D 3 -38.717 19.142 29.897 1.00 71.36 C
ATOM 9620 CG LEU D 3 -40.173 19.003 29.468 1.00 71.17 C
ATOM 9621 CD1 LEU D 3 -41.077 19.472 30.588 1.00 70.98 C
ATOM 9622 CD2 LEU D 3 -40.404 19.797 28.190 1.00 70.51 C
ATOM 9623 N GLU D 4 -35.720 19.798 28.763 1.00 63.78 N
ATOM 9624 CA GLU D 4 -34.383 20.234 29.096 1.00 60.97 C
ATOM 9625 C GLU D 4 -34.258 21.717 28.818 1.00 56.49 C
ATOM 9626 O GLU D 4 -34.910 22.253 27.928 1.00 53.76 O
ATOM 9627 CB GLU D 4 -33.343 19.448 28.301 1.00 64.31 C
ATOM 9628 CG GLU D 4 -33.684 19.252 26.843 1.00 70.29 C
ATOM 9629 CD GLU D 4 -32.749 18.262 26.143 1.00 73.24 C
ATOM 9630 OE1 GLU D 4 -32.973 17.992 24.943 1.00 74.25 O
ATOM 9631 OE2 GLU D 4 -31.796 17.756 26.788 1.00 74.41 O
ATOM 9632 N LEU D 5 -33.428 22.377 29.610 1.00 52.04 N
ATOM 9633 CA LEU D 5 -33.207 23.801 29.470 1.00 47.94 C
ATOM 9634 C LEU D 5 -31.808 24.003 28.896 1.00 45.81 C
ATOM 9635 O LEU D 5 -30.827 23.542 29.463 1.00 47.11 O
ATOM 9636 CB LEU D 5 -33.331 24.460 30.845 1.00 46.62 C
ATOM 9637 CG LEU D 5 -32.837 25.892 30.972 1.00 45.76 C
ATOM 9638 CD1 LEU D 5 -33.809 26.824 30.294 1.00 45.83 C
ATOM 9639 CD2 LEU D 5 -32.685 26.241 32.431 1.00 48.30 C
ATOM 9640 N HIS D 6 -31.700 24.685 27.768 1.00 44.45 N
ATOM 9641 CA HIS D 6 -30.383 24.901 27.179 1.00 44.23 C
ATOM 9642 C HIS D 6 -29.804 26.269 27.545 1.00 42.36 C
ATOM 9643 O HIS D 6 -30.498 27.290 27.494 1.00 43.42 O
ATOM 9644 CB HIS D 6 -30.462 24.715 25.664 1.00 46.99 C
ATOM 9645 CG HIS D 6 -30.889 23.335 25.255 1.00 51.39 C
ATOM 9646 ND1 HIS D 6 -31.424 23.054 24.015 1.00 51.06 N
ATOM 9647 CD2 HIS D 6 -30.880 22.161 25.934 1.00 53.26 C
ATOM 9648 CE1 HIS D 6 -31.731 21.768 23.951 1.00 53.00 C
ATOM 9649 NE2 HIS D 6 -31.412 21.204 25.103 1.00 53.89 N
ATOM 9650 N PRO D 7 -28.517 26.303 27.923 1.00 39.44 N
ATOM 9651 CA PRO D 7 -27.805 27.522 28.319 1.00 37.06 C
ATOM 9652 C PRO D 7 -27.725 28.614 27.263 1.00 35.58 C
ATOM 9653 O PRO D 7 -27.665 28.335 26.080 1.00 35.12 O
ATOM 9654 CB PRO D 7 -26.427 27.000 28.686 1.00 37.60 C
ATOM 9655 CG PRO D 7 -26.252 25.849 27.739 1.00 36.38 C
ATOM 9656 CD PRO D 7 -27.581 25.166 27.821 1.00 37.75 C
ATOM 9657 N PRO D 8 -27.725 29.887 27.686 1.00 35.24 N
ATOM 9658 CA PRO D 8 -27.640 30.989 26.721 1.00 33.12 C
ATOM 9659 C PRO D 8 -26.210 31.078 26.235 1.00 31.22 C
ATOM 9660 O PRO D 8 -25.338 30.400 26.754 1.00 33.12 O
ATOM 9661 CB PRO D 8 -28.024 32.212 27.558 1.00 30.78 C
ATOM 9662 CG PRO D 8 -27.457 31.878 28.871 1.00 28.69 C
ATOM 9663 CD PRO D 8 -27.854 30.416 29.058 1.00 33.05 C
ATOM 9664 N ALA D 9 -25.956 31.934 25.266 1.00 30.56 N
ATOM 9665 CA ALA D 9 -24.602 32.078 24.755 1.00 30.80 C
ATOM 9666 C ALA D 9 -23.906 33.301 25.338 1.00 31.85 C
ATOM 9667 O ALA D 9 -24.220 34.429 24.959 1.00 33.62 O
ATOM 9668 CB ALA D 9 -24.643 32.170 23.254 1.00 23.77 C
ATOM 9669 N PHE D 10 -22.969 33.100 26.261 1.00 33.16 N
ATOM 9670 CA PHE D 10 -22.265 34.250 26.836 1.00 33.45 C
ATOM 9671 C PHE D 10 -21.157 34.737 25.910 1.00 33.94 C
ATOM 9672 O PHE D 10 -20.482 33.952 25.238 1.00 34.59 O
ATOM 9673 CB PHE D 10 -21.674 33.912 28.204 1.00 33.93 C
ATOM 9674 CG PHE D 10 -22.705 33.558 29.232 1.00 35.86 C
ATOM 9675 CD1 PHE D 10 -23.310 32.311 29.222 1.00 36.10 C
ATOM 9676 CD2 PHE D 10 -23.091 34.481 30.197 1.00 35.79 C
ATOM 9677 CE1 PHE D 10 -24.283 31.983 30.155 1.00 36.33 C
ATOM 9678 CE2 PHE D 10 -24.068 34.158 31.133 1.00 37.03 C
ATOM 9679 CZ PHE D 10 -24.663 32.907 31.111 1.00 35.90 C
ATOM 9680 N PRO D 11 -20.954 36.054 25.862 1.00 34.15 N
ATOM 9681 CA PRO D 11 -19.920 36.645 25.009 1.00 33.49 C
ATOM 9682 C PRO D 11 -18.483 36.471 25.521 1.00 32.44 C
ATOM 9683 O PRO D 11 -17.814 37.461 25.823 1.00 31.66 O
ATOM 9684 CB PRO D 11 -20.341 38.108 24.954 1.00 31.31 C
ATOM 9685 CG PRO D 11 -20.854 38.323 26.295 1.00 30.23 C
ATOM 9686 CD PRO D 11 -21.713 37.107 26.549 1.00 32.80 C
ATOM 9687 N TRP D 12 -18.016 35.225 25.611 1.00 31.03 N
ATOM 9688 CA TRP D 12 -16.651 34.946 26.082 1.00 30.61 C
ATOM 9689 C TRP D 12 -15.636 35.759 25.272 1.00 30.83 C
ATOM 9690 O TRP D 12 -15.774 35.885 24.054 1.00 28.82 O
ATOM 9691 CB TRP D 12 -16.314 33.449 25.948 1.00 26.18 C
ATOM 9692 CG TRP D 12 -17.316 32.570 26.595 1.00 27.07 C
ATOM 9693 CD1 TRP D 12 -18.444 32.051 26.024 1.00 26.07 C
ATOM 9694 CD2 TRP D 12 -17.337 32.161 27.973 1.00 26.99 C
ATOM 9695 NE1 TRP D 12 -19.167 31.346 26.959 1.00 26.45 N
ATOM 9696 CE2 TRP D 12 -18.514 31.401 28.163 1.00 26.89 C
ATOM 9697 CE3 TRP D 12 -16.480 32.372 29.062 1.00 25.31 C
ATOM 9698 CZ2 TRP D 12 -18.859 30.852 29.398 1.00 27.16 C
ATOM 9699 CZ3 TRP D 12 -16.820 31.828 30.288 1.00 28.71 C
ATOM 9700 CH2 TRP D 12 -18.005 31.075 30.447 1.00 28.06 C
ATOM 9701 N SER D 13 -14.614 36.298 25.931 1.00 29.96 N
ATOM 9702 CA SER D 13 -13.637 37.066 25.189 1.00 30.97 C
ATOM 9703 C SER D 13 -12.781 36.177 24.277 1.00 32.14 C
ATOM 9704 O SER D 13 -11.901 36.664 23.576 1.00 34.40 O
ATOM 9705 CB SER D 13 -12.733 37.837 26.133 1.00 28.04 C
ATOM 9706 OG SER D 13 -11.816 36.957 26.735 1.00 31.21 O
ATOM 9707 N HIS D 14 -13.020 34.876 24.273 1.00 32.95 N
ATOM 9708 CA HIS D 14 -12.229 34.013 23.408 1.00 35.11 C
ATOM 9709 C HIS D 14 -13.102 33.335 22.371 1.00 37.20 C
ATOM 9710 O HIS D 14 -12.658 32.414 21.695 1.00 39.06 O
ATOM 9711 CB HIS D 14 -11.502 32.954 24.229 1.00 34.90 C
ATOM 9712 CG HIS D 14 -12.406 32.148 25.107 1.00 35.34 C
ATOM 9713 ND1 HIS D 14 -12.581 32.421 26.446 1.00 35.27 N
ATOM 9714 CD2 HIS D 14 -13.213 31.097 24.829 1.00 33.86 C
ATOM 9715 CE1 HIS D 14 -13.459 31.573 26.954 1.00 33.57 C
ATOM 9716 NE2 HIS D 14 -13.858 30.760 25.992 1.00 32.77 N
ATOM 9717 N GLY D 15 -14.344 33.797 22.252 1.00 38.31 N
ATOM 9718 CA GLY D 15 -15.271 33.210 21.304 1.00 38.55 C
ATOM 9719 C GLY D 15 -15.054 33.602 19.849 1.00 40.43 C
ATOM 9720 O GLY D 15 -15.349 32.814 18.936 1.00 40.42 O
ATOM 9721 N GLY D 16 -14.555 34.813 19.620 1.00 39.72 N
ATOM 9722 CA GLY D 16 -14.322 35.252 18.252 1.00 39.81 C
ATOM 9723 C GLY D 16 -13.316 34.396 17.495 1.00 39.20 C
ATOM 9724 O GLY D 16 -12.391 33.833 18.093 1.00 39.34 O
ATOM 9725 N PRO D 17 -13.462 34.279 16.170 1.00 37.93 N
ATOM 9726 CA PRO D 17 -12.503 33.458 15.422 1.00 38.61 C
ATOM 9727 C PRO D 17 -11.046 33.900 15.549 1.00 39.22 C
ATOM 9728 O PRO D 17 -10.143 33.110 15.305 1.00 42.06 O
ATOM 9729 CB PRO D 17 -13.029 33.525 13.984 1.00 37.08 C
ATOM 9730 CG PRO D 17 -13.808 34.821 13.951 1.00 33.33 C
ATOM 9731 CD PRO D 17 -14.501 34.828 15.284 1.00 35.12 C
ATOM 9732 N LEU D 18 -10.808 35.151 15.924 1.00 39.34 N
ATOM 9733 CA LEU D 18 -9.436 35.632 16.086 1.00 38.92 C
ATOM 9734 C LEU D 18 -9.162 36.054 17.531 1.00 39.29 C
ATOM 9735 O LEU D 18 -8.150 36.694 17.840 1.00 38.00 O
ATOM 9736 CB LEU D 18 -9.180 36.810 15.162 1.00 37.81 C
ATOM 9737 CG LEU D 18 -9.197 36.516 13.666 1.00 38.53 C
ATOM 9738 CD1 LEU D 18 -8.839 37.804 12.911 1.00 36.68 C
ATOM 9739 CD2 LEU D 18 -8.204 35.395 13.343 1.00 38.14 C
ATOM 9740 N SER D 19 -10.066 35.665 18.420 1.00 38.49 N
ATOM 9741 CA SER D 19 -9.953 36.028 19.811 1.00 38.24 C
ATOM 9742 C SER D 19 -9.212 35.011 20.645 1.00 38.23 C
ATOM 9743 O SER D 19 -9.657 33.876 20.802 1.00 38.72 O
ATOM 9744 CB SER D 19 -11.343 36.240 20.380 1.00 39.53 C
ATOM 9745 OG SER D 19 -12.142 36.894 19.422 1.00 40.96 O
ATOM 9746 N ALA D 20 -8.082 35.434 21.194 1.00 37.60 N
ATOM 9747 CA ALA D 20 -7.279 34.578 22.038 1.00 36.05 C
ATOM 9748 C ALA D 20 -7.995 34.478 23.370 1.00 37.33 C
ATOM 9749 O ALA D 20 -9.016 35.127 23.591 1.00 37.82 O
ATOM 9750 CB ALA D 20 -5.916 35.185 22.238 1.00 32.85 C
ATOM 9751 N LEU D 21 -7.458 33.647 24.248 1.00 37.37 N
ATOM 9752 CA LEU D 21 -7.995 33.476 25.581 1.00 36.01 C
ATOM 9753 C LEU D 21 -7.461 34.642 26.406 1.00 37.56 C
ATOM 9754 O LEU D 21 -6.396 35.178 26.102 1.00 37.16 O
ATOM 9755 CB LEU D 21 -7.474 32.173 26.186 1.00 33.69 C
ATOM 9756 CG LEU D 21 -8.060 30.823 25.786 1.00 33.46 C
ATOM 9757 CD1 LEU D 21 -7.110 29.721 26.195 1.00 30.74 C
ATOM 9758 CD2 LEU D 21 -9.409 30.629 26.457 1.00 32.65 C
ATOM 9759 N ASP D 22 -8.203 35.036 27.443 1.00 40.35 N
ATOM 9760 CA ASP D 22 -7.769 36.107 28.346 1.00 38.67 C
ATOM 9761 C ASP D 22 -6.925 35.394 29.373 1.00 36.76 C
ATOM 9762 O ASP D 22 -7.456 34.712 30.243 1.00 36.40 O
ATOM 9763 CB ASP D 22 -8.950 36.745 29.048 1.00 40.98 C
ATOM 9764 CG ASP D 22 -8.542 37.936 29.867 1.00 44.83 C
ATOM 9765 OD1 ASP D 22 -7.661 37.784 30.735 1.00 45.17 O
ATOM 9766 OD2 ASP D 22 -9.093 39.033 29.638 1.00 50.04 O
ATOM 9767 N HIS D 23 -5.614 35.541 29.284 1.00 36.24 N
ATOM 9768 CA HIS D 23 -4.747 34.823 30.203 1.00 37.18 C
ATOM 9769 C HIS D 23 -4.833 35.198 31.667 1.00 36.96 C
ATOM 9770 O HIS D 23 -4.550 34.372 32.545 1.00 35.74 O
ATOM 9771 CB HIS D 23 -3.311 34.856 29.691 1.00 36.18 C
ATOM 9772 CG HIS D 23 -3.127 34.041 28.449 1.00 38.31 C
ATOM 9773 ND1 HIS D 23 -2.115 33.116 28.304 1.00 37.32 N
ATOM 9774 CD2 HIS D 23 -3.852 33.992 27.305 1.00 36.69 C
ATOM 9775 CE1 HIS D 23 -2.225 32.532 27.122 1.00 37.13 C
ATOM 9776 NE2 HIS D 23 -3.270 33.047 26.497 1.00 37.09 N
ATOM 9777 N SER D 24 -5.224 36.436 31.944 1.00 37.14 N
ATOM 9778 CA SER D 24 -5.386 36.843 33.331 1.00 36.43 C
ATOM 9779 C SER D 24 -6.529 35.990 33.872 1.00 36.27 C
ATOM 9780 O SER D 24 -6.453 35.431 34.980 1.00 38.06 O
ATOM 9781 CB SER D 24 -5.753 38.321 33.421 1.00 36.35 C
ATOM 9782 OG SER D 24 -4.645 39.121 33.065 1.00 37.98 O
ATOM 9783 N SER D 25 -7.577 35.875 33.062 1.00 34.26 N
ATOM 9784 CA SER D 25 -8.744 35.095 33.416 1.00 33.60 C
ATOM 9785 C SER D 25 -8.384 33.623 33.559 1.00 35.46 C
ATOM 9786 O SER D 25 -8.892 32.952 34.463 1.00 36.84 O
ATOM 9787 CB SER D 25 -9.825 35.264 32.361 1.00 32.47 C
ATOM 9788 OG SER D 25 -11.028 34.668 32.785 1.00 34.36 O
ATOM 9789 N VAL D 26 -7.508 33.118 32.684 1.00 34.95 N
ATOM 9790 CA VAL D 26 -7.093 31.713 32.750 1.00 33.64 C
ATOM 9791 C VAL D 26 -6.264 31.433 33.996 1.00 33.44 C
ATOM 9792 O VAL D 26 -6.370 30.360 34.601 1.00 32.15 O
ATOM 9793 CB VAL D 26 -6.260 31.293 31.522 1.00 33.50 C
ATOM 9794 CG1 VAL D 26 -5.824 29.849 31.668 1.00 31.24 C
ATOM 9795 CG2 VAL D 26 -7.079 31.452 30.257 1.00 32.91 C
ATOM 9796 N ARG D 27 -5.439 32.406 34.374 1.00 34.67 N
ATOM 9797 CA ARG D 27 -4.598 32.274 35.562 1.00 35.69 C
ATOM 9798 C ARG D 27 -5.505 32.164 36.772 1.00 35.76 C
ATOM 9799 O ARG D 27 -5.381 31.226 37.573 1.00 35.61 O
ATOM 9800 CB ARG D 27 -3.684 33.485 35.721 1.00 36.38 C
ATOM 9801 CG ARG D 27 -2.745 33.410 36.930 1.00 35.13 C
ATOM 9802 CD ARG D 27 -1.797 34.599 36.933 1.00 34.32 C
ATOM 9803 NE ARG D 27 -0.994 34.691 38.147 1.00 35.26 N
ATOM 9804 CZ ARG D 27 0.264 34.286 38.250 1.00 34.63 C
ATOM 9805 NH1 ARG D 27 0.875 33.754 37.212 1.00 39.62 N
ATOM 9806 NH2 ARG D 27 0.922 34.435 39.386 1.00 34.38 N
ATOM 9807 N ARG D 28 -6.423 33.122 36.889 1.00 35.07 N
ATOM 9808 CA ARG D 28 -7.382 33.111 37.988 1.00 35.66 C
ATOM 9809 C ARG D 28 -8.151 31.790 37.988 1.00 35.45 C
ATOM 9810 O ARG D 28 -8.266 31.128 39.024 1.00 34.12 O
ATOM 9811 CB ARG D 28 -8.370 34.276 37.860 1.00 36.37 C
ATOM 9812 CG ARG D 28 -7.878 35.594 38.442 1.00 35.13 C
ATOM 9813 CD ARG D 28 -9.039 36.524 38.673 1.00 35.13 C
ATOM 9814 NE ARG D 28 -9.766 36.781 37.435 1.00 36.84 N
ATOM 9815 CZ ARG D 28 -9.373 37.638 36.497 1.00 36.36 C
ATOM 9816 NH1 ARG D 28 -8.255 38.336 36.654 1.00 35.68 N
ATOM 9817 NH2 ARG D 28 -10.101 37.788 35.398 1.00 37.18 N
ATOM 9818 N GLY D 29 -8.675 31.421 36.817 1.00 35.52 N
ATOM 9819 CA GLY D 29 -9.413 30.173 36.680 1.00 36.80 C
ATOM 9820 C GLY D 29 -8.657 28.990 37.266 1.00 36.36 C
ATOM 9821 O GLY D 29 -9.237 28.101 37.907 1.00 35.02 O
ATOM 9822 N PHE D 30 -7.347 28.986 37.054 1.00 35.23 N
ATOM 9823 CA PHE D 30 -6.521 27.910 37.564 1.00 35.53 C
ATOM 9824 C PHE D 30 -6.581 27.848 39.081 1.00 36.58 C
ATOM 9825 O PHE D 30 -6.648 26.762 39.678 1.00 38.06 O
ATOM 9826 CB PHE D 30 -5.071 28.101 37.148 1.00 33.89 C
ATOM 9827 CG PHE D 30 -4.126 27.222 37.901 1.00 32.67 C
ATOM 9828 CD1 PHE D 30 -4.121 25.854 37.700 1.00 31.57 C
ATOM 9829 CD2 PHE D 30 -3.275 27.754 38.860 1.00 33.98 C
ATOM 9830 CE1 PHE D 30 -3.278 25.028 38.445 1.00 30.63 C
ATOM 9831 CE2 PHE D 30 -2.429 26.931 39.610 1.00 32.25 C
ATOM 9832 CZ PHE D 30 -2.433 25.569 39.398 1.00 30.52 C
ATOM 9833 N GLN D 31 -6.529 29.019 39.707 1.00 36.14 N
ATOM 9834 CA GLN D 31 -6.572 29.097 41.156 1.00 35.64 C
ATOM 9835 C GLN D 31 -7.870 28.489 41.657 1.00 36.08 C
ATOM 9836 O GLN D 31 -7.885 27.794 42.675 1.00 37.29 O
ATOM 9837 CB GLN D 31 -6.478 30.544 41.606 1.00 35.87 C
ATOM 9838 CG GLN D 31 -6.126 30.729 43.079 1.00 39.77 C
ATOM 9839 CD GLN D 31 -6.246 32.192 43.524 1.00 42.24 C
ATOM 9840 OE1 GLN D 31 -5.687 33.103 42.885 1.00 40.16 O
ATOM 9841 NE2 GLN D 31 -6.983 32.423 44.621 1.00 42.04 N
ATOM 9842 N VAL D 32 -8.958 28.742 40.930 1.00 35.83 N
ATOM 9843 CA VAL D 32 -10.258 28.212 41.318 1.00 34.06 C
ATOM 9844 C VAL D 32 -10.236 26.708 41.250 1.00 32.98 C
ATOM 9845 O VAL D 32 -10.790 26.041 42.122 1.00 33.98 O
ATOM 9846 CB VAL D 32 -11.406 28.718 40.413 1.00 33.26 C
ATOM 9847 CG1 VAL D 32 -12.727 28.063 40.835 1.00 30.55 C
ATOM 9848 CG2 VAL D 32 -11.524 30.210 40.521 1.00 32.38 C
ATOM 9849 N TYR D 33 -9.606 26.179 40.210 1.00 32.53 N
ATOM 9850 CA TYR D 33 -9.528 24.741 40.052 1.00 34.17 C
ATOM 9851 C TYR D 33 -8.693 24.143 41.182 1.00 35.42 C
ATOM 9852 O TYR D 33 -9.077 23.155 41.834 1.00 34.03 O
ATOM 9853 CB TYR D 33 -8.868 24.360 38.729 1.00 33.40 C
ATOM 9854 CG TYR D 33 -8.554 22.877 38.705 1.00 35.24 C
ATOM 9855 CD1 TYR D 33 -9.583 21.931 38.649 1.00 36.34 C
ATOM 9856 CD2 TYR D 33 -7.261 22.418 38.889 1.00 32.59 C
ATOM 9857 CE1 TYR D 33 -9.332 20.577 38.796 1.00 35.94 C
ATOM 9858 CE2 TYR D 33 -7.005 21.065 39.034 1.00 35.97 C
ATOM 9859 CZ TYR D 33 -8.049 20.148 38.996 1.00 35.75 C
ATOM 9860 OH TYR D 33 -7.827 18.804 39.227 1.00 38.19 O
ATOM 9861 N LYS D 34 -7.533 24.748 41.387 1.00 34.60 N
ATOM 9862 CA LYS D 34 -6.617 24.283 42.397 1.00 34.80 C
ATOM 9863 C LYS D 34 -7.184 24.329 43.807 1.00 35.53 C
ATOM 9864 O LYS D 34 -7.109 23.349 44.539 1.00 34.35 O
ATOM 9865 CB LYS D 34 -5.322 25.094 42.334 1.00 34.61 C
ATOM 9866 CG LYS D 34 -4.418 24.868 43.526 1.00 33.71 C
ATOM 9867 CD LYS D 34 -3.086 25.534 43.330 1.00 37.73 C
ATOM 9868 CE LYS D 34 -2.405 25.821 44.663 1.00 38.53 C
ATOM 9869 NZ LYS D 34 -2.349 24.587 45.490 1.00 42.99 N
ATOM 9870 N GLN D 35 -7.754 25.470 44.183 1.00 36.57 N
ATOM 9871 CA GLN D 35 -8.293 25.651 45.521 1.00 35.33 C
ATOM 9872 C GLN D 35 -9.707 25.134 45.788 1.00 35.50 C
ATOM 9873 O GLN D 35 -10.080 24.944 46.945 1.00 35.01 O
ATOM 9874 CB GLN D 35 -8.202 27.124 45.885 1.00 36.96 C
ATOM 9875 CG GLN D 35 -6.777 27.617 45.957 1.00 38.83 C
ATOM 9876 CD GLN D 35 -6.695 29.074 46.289 1.00 41.44 C
ATOM 9877 OE1 GLN D 35 -5.603 29.636 46.400 1.00 45.54 O
ATOM 9878 NE2 GLN D 35 -7.852 29.711 46.449 1.00 43.02 N
ATOM 9879 N VAL D 36 -10.492 24.889 44.740 1.00 34.77 N
ATOM 9880 CA VAL D 36 -11.860 24.415 44.938 1.00 32.07 C
ATOM 9881 C VAL D 36 -12.209 23.084 44.280 1.00 31.45 C
ATOM 9882 O VAL D 36 -12.491 22.096 44.954 1.00 30.95 O
ATOM 9883 CB VAL D 36 -12.870 25.469 44.448 1.00 30.70 C
ATOM 9884 CG1 VAL D 36 -14.282 25.048 44.799 1.00 31.46 C
ATOM 9885 CG2 VAL D 36 -12.571 26.800 45.076 1.00 29.38 C
ATOM 9886 N CYS D 37 -12.169 23.058 42.959 1.00 31.09 N
ATOM 9887 CA CYS D 37 -12.544 21.872 42.206 1.00 32.03 C
ATOM 9888 C CYS D 37 -11.661 20.648 42.344 1.00 30.83 C
ATOM 9889 O CYS D 37 -12.149 19.518 42.289 1.00 30.36 O
ATOM 9890 CB CYS D 37 -12.661 22.237 40.724 1.00 32.86 C
ATOM 9891 SG CYS D 37 -13.352 23.909 40.463 1.00 36.30 S
ATOM 9892 N SER D 38 -10.363 20.858 42.510 1.00 30.27 N
ATOM 9893 CA SER D 38 -9.452 19.727 42.581 1.00 29.51 C
ATOM 9894 C SER D 38 -9.679 18.851 43.772 1.00 28.09 C
ATOM 9895 O SER D 38 -9.152 17.753 43.844 1.00 30.16 O
ATOM 9896 CB SER D 38 -8.003 20.192 42.548 1.00 30.09 C
ATOM 9897 OG SER D 38 -7.765 21.142 43.557 1.00 36.15 O
ATOM 9898 N ALA D 39 -10.465 19.321 44.721 1.00 28.15 N
ATOM 9899 CA ALA D 39 -10.744 18.498 45.895 1.00 28.65 C
ATOM 9900 C ALA D 39 -11.513 17.234 45.488 1.00 27.83 C
ATOM 9901 O ALA D 39 -11.406 16.212 46.145 1.00 27.99 O
ATOM 9902 CB ALA D 39 -11.552 19.297 46.932 1.00 26.36 C
ATOM 9903 N CYS D 40 -12.279 17.307 44.405 1.00 28.12 N
ATOM 9904 CA CYS D 40 -13.056 16.158 43.967 1.00 29.83 C
ATOM 9905 C CYS D 40 -12.834 15.835 42.508 1.00 29.72 C
ATOM 9906 O CYS D 40 -13.140 14.734 42.077 1.00 30.88 O
ATOM 9907 CB CYS D 40 -14.557 16.405 44.151 1.00 30.90 C
ATOM 9908 SG CYS D 40 -15.058 17.147 45.732 1.00 33.45 S
ATOM 9909 N HIS D 41 -12.313 16.787 41.744 1.00 30.05 N
ATOM 9910 CA HIS D 41 -12.111 16.569 40.315 1.00 30.03 C
ATOM 9911 C HIS D 41 -10.666 16.420 39.928 1.00 30.90 C
ATOM 9912 O HIS D 41 -9.830 17.225 40.338 1.00 33.04 O
ATOM 9913 CB HIS D 41 -12.689 17.740 39.503 1.00 30.09 C
ATOM 9914 CG HIS D 41 -14.186 17.785 39.457 1.00 29.66 C
ATOM 9915 ND1 HIS D 41 -14.937 16.878 38.747 1.00 30.71 N
ATOM 9916 CD2 HIS D 41 -15.070 18.654 40.004 1.00 29.17 C
ATOM 9917 CE1 HIS D 41 -16.217 17.186 38.854 1.00 30.27 C
ATOM 9918 NE2 HIS D 41 -16.327 18.262 39.612 1.00 28.14 N
ATOM 9919 N SER D 42 -10.373 15.410 39.118 1.00 30.28 N
ATOM 9920 CA SER D 42 -9.018 15.205 38.633 1.00 31.18 C
ATOM 9921 C SER D 42 -8.882 15.969 37.312 1.00 32.36 C
ATOM 9922 O SER D 42 -9.873 16.392 36.729 1.00 32.78 O
ATOM 9923 CB SER D 42 -8.766 13.721 38.372 1.00 32.28 C
ATOM 9924 OG SER D 42 -9.598 13.225 37.326 1.00 33.40 O
ATOM 9925 N MET D 43 -7.655 16.138 36.843 1.00 33.48 N
ATOM 9926 CA MET D 43 -7.385 16.805 35.567 1.00 32.67 C
ATOM 9927 C MET D 43 -6.159 16.085 35.040 1.00 33.21 C
ATOM 9928 O MET D 43 -5.092 16.685 34.830 1.00 30.94 O
ATOM 9929 CB MET D 43 -7.077 18.282 35.769 1.00 32.49 C
ATOM 9930 CG MET D 43 -6.874 19.001 34.463 1.00 33.40 C
ATOM 9931 SD MET D 43 -7.666 20.595 34.450 1.00 35.96 S
ATOM 9932 CE MET D 43 -6.287 21.590 34.586 1.00 39.45 C
ATOM 9933 N ASP D 44 -6.332 14.775 34.859 1.00 33.51 N
ATOM 9934 CA ASP D 44 -5.261 13.891 34.421 1.00 33.03 C
ATOM 9935 C ASP D 44 -4.361 14.364 33.305 1.00 32.05 C
ATOM 9936 O ASP D 44 -3.190 14.031 33.318 1.00 33.52 O
ATOM 9937 CB ASP D 44 -5.810 12.528 34.017 1.00 35.24 C
ATOM 9938 CG ASP D 44 -6.535 11.825 35.147 1.00 38.86 C
ATOM 9939 OD1 ASP D 44 -6.150 12.025 36.320 1.00 39.44 O
ATOM 9940 OD2 ASP D 44 -7.486 11.059 34.847 1.00 39.83 O
ATOM 9941 N TYR D 45 -4.869 15.146 32.357 1.00 30.08 N
ATOM 9942 CA TYR D 45 -4.035 15.546 31.235 1.00 28.34 C
ATOM 9943 C TYR D 45 -3.244 16.850 31.266 1.00 29.61 C
ATOM 9944 O TYR D 45 -2.640 17.225 30.264 1.00 31.75 O
ATOM 9945 CB TYR D 45 -4.858 15.476 29.955 1.00 26.92 C
ATOM 9946 CG TYR D 45 -5.372 14.085 29.686 1.00 28.03 C
ATOM 9947 CD1 TYR D 45 -6.530 13.613 30.312 1.00 27.56 C
ATOM 9948 CD2 TYR D 45 -4.678 13.212 28.839 1.00 29.10 C
ATOM 9949 CE1 TYR D 45 -6.982 12.312 30.102 1.00 27.73 C
ATOM 9950 CE2 TYR D 45 -5.124 11.889 28.620 1.00 26.50 C
ATOM 9951 CZ TYR D 45 -6.273 11.451 29.258 1.00 27.62 C
ATOM 9952 OH TYR D 45 -6.714 10.154 29.084 1.00 25.91 O
ATOM 9953 N VAL D 46 -3.209 17.542 32.395 1.00 29.76 N
ATOM 9954 CA VAL D 46 -2.449 18.780 32.447 1.00 28.27 C
ATOM 9955 C VAL D 46 -1.358 18.701 33.508 1.00 28.57 C
ATOM 9956 O VAL D 46 -1.586 18.273 34.630 1.00 28.43 O
ATOM 9957 CB VAL D 46 -3.354 19.987 32.730 1.00 29.18 C
ATOM 9958 CG1 VAL D 46 -2.537 21.277 32.654 1.00 28.63 C
ATOM 9959 CG2 VAL D 46 -4.481 20.021 31.726 1.00 26.82 C
ATOM 9960 N ALA D 47 -0.158 19.111 33.132 1.00 28.98 N
ATOM 9961 CA ALA D 47 0.974 19.077 34.035 1.00 29.65 C
ATOM 9962 C ALA D 47 1.355 20.501 34.422 1.00 30.02 C
ATOM 9963 O ALA D 47 1.044 21.469 33.713 1.00 28.79 O
ATOM 9964 CB ALA D 47 2.144 18.372 33.366 1.00 27.38 C
ATOM 9965 N PHE D 48 2.036 20.641 35.551 1.00 30.77 N
ATOM 9966 CA PHE D 48 2.418 21.972 35.988 1.00 31.04 C
ATOM 9967 C PHE D 48 3.257 22.723 34.946 1.00 31.30 C
ATOM 9968 O PHE D 48 3.191 23.952 34.881 1.00 34.35 O
ATOM 9969 CB PHE D 48 3.149 21.902 37.324 1.00 28.51 C
ATOM 9970 CG PHE D 48 2.295 21.403 38.456 1.00 27.69 C
ATOM 9971 CD1 PHE D 48 2.324 20.076 38.843 1.00 28.65 C
ATOM 9972 CD2 PHE D 48 1.471 22.271 39.156 1.00 30.01 C
ATOM 9973 CE1 PHE D 48 1.542 19.622 39.926 1.00 28.25 C
ATOM 9974 CE2 PHE D 48 0.691 21.822 40.233 1.00 28.80 C
ATOM 9975 CZ PHE D 48 0.733 20.497 40.613 1.00 26.72 C
ATOM 9976 N ARG D 49 4.022 22.005 34.124 1.00 30.18 N
ATOM 9977 CA ARG D 49 4.842 22.652 33.102 1.00 28.87 C
ATOM 9978 C ARG D 49 3.987 23.353 32.042 1.00 30.48 C
ATOM 9979 O ARG D 49 4.397 24.360 31.474 1.00 32.67 O
ATOM 9980 CB ARG D 49 5.782 21.645 32.446 1.00 27.56 C
ATOM 9981 CG ARG D 49 5.091 20.474 31.750 1.00 30.56 C
ATOM 9982 CD ARG D 49 6.086 19.503 31.099 1.00 28.48 C
ATOM 9983 NE ARG D 49 5.415 18.319 30.568 1.00 30.35 N
ATOM 9984 CZ ARG D 49 4.584 18.329 29.528 1.00 29.76 C
ATOM 9985 NH1 ARG D 49 4.328 19.466 28.902 1.00 27.63 N
ATOM 9986 NH2 ARG D 49 4.007 17.201 29.115 1.00 28.70 N
ATOM 9987 N ASN D 50 2.794 22.838 31.784 1.00 29.94 N
ATOM 9988 CA ASN D 50 1.898 23.458 30.815 1.00 29.76 C
ATOM 9989 C ASN D 50 1.536 24.910 31.205 1.00 31.95 C
ATOM 9990 O ASN D 50 1.129 25.725 30.361 1.00 33.49 O
ATOM 9991 CB ASN D 50 0.620 22.624 30.697 1.00 27.66 C
ATOM 9992 CG ASN D 50 0.877 21.271 30.081 1.00 29.07 C
ATOM 9993 OD1 ASN D 50 1.317 21.186 28.944 1.00 27.76 O
ATOM 9994 ND2 ASN D 50 0.602 20.204 30.825 1.00 29.29 N
ATOM 9995 N LEU D 51 1.682 25.233 32.484 1.00 32.81 N
ATOM 9996 CA LEU D 51 1.349 26.564 32.959 1.00 33.41 C
ATOM 9997 C LEU D 51 2.361 27.597 32.503 1.00 33.80 C
ATOM 9998 O LEU D 51 2.013 28.728 32.168 1.00 33.52 O
ATOM 9999 CB LEU D 51 1.274 26.576 34.483 1.00 32.54 C
ATOM 10000 CG LEU D 51 0.187 25.723 35.125 1.00 33.32 C
ATOM 10001 CD1 LEU D 51 0.402 25.708 36.626 1.00 32.27 C
ATOM 10002 CD2 LEU D 51 -1.195 26.273 34.764 1.00 31.51 C
ATOM 10003 N ILE D 52 3.623 27.190 32.493 1.00 34.28 N
ATOM 10004 CA ILE D 52 4.718 28.077 32.119 1.00 33.13 C
ATOM 10005 C ILE D 52 4.536 28.815 30.809 1.00 33.17 C
ATOM 10006 O ILE D 52 4.223 28.215 29.798 1.00 34.18 O
ATOM 10007 CB ILE D 52 6.026 27.299 32.030 1.00 30.92 C
ATOM 10008 CG1 ILE D 52 6.262 26.537 33.334 1.00 29.49 C
ATOM 10009 CG2 ILE D 52 7.151 28.251 31.732 1.00 29.90 C
ATOM 10010 CD1 ILE D 52 7.532 25.785 33.362 1.00 26.73 C
ATOM 10011 N GLY D 53 4.745 30.124 30.831 1.00 34.13 N
ATOM 10012 CA GLY D 53 4.631 30.907 29.616 1.00 34.59 C
ATOM 10013 C GLY D 53 3.223 31.030 29.094 1.00 36.09 C
ATOM 10014 O GLY D 53 2.988 31.525 27.989 1.00 38.78 O
ATOM 10015 N VAL D 54 2.273 30.574 29.893 1.00 36.69 N
ATOM 10016 CA VAL D 54 0.871 30.645 29.529 1.00 36.02 C
ATOM 10017 C VAL D 54 0.182 31.464 30.606 1.00 37.67 C
ATOM 10018 O VAL D 54 -0.376 32.528 30.322 1.00 39.15 O
ATOM 10019 CB VAL D 54 0.236 29.241 29.465 1.00 36.09 C
ATOM 10020 CG1 VAL D 54 -1.282 29.346 29.273 1.00 34.32 C
ATOM 10021 CG2 VAL D 54 0.855 28.468 28.337 1.00 33.10 C
ATOM 10022 N THR D 55 0.240 30.976 31.844 1.00 37.08 N
ATOM 10023 CA THR D 55 -0.379 31.671 32.967 1.00 38.25 C
ATOM 10024 C THR D 55 0.604 31.958 34.112 1.00 38.50 C
ATOM 10025 O THR D 55 0.383 32.855 34.917 1.00 36.39 O
ATOM 10026 CB THR D 55 -1.557 30.852 33.545 1.00 38.64 C
ATOM 10027 OG1 THR D 55 -1.129 29.501 33.768 1.00 39.28 O
ATOM 10028 CG2 THR D 55 -2.746 30.868 32.594 1.00 38.72 C
ATOM 10029 N HIS D 56 1.691 31.199 34.164 1.00 38.86 N
ATOM 10030 CA HIS D 56 2.677 31.346 35.221 1.00 40.53 C
ATOM 10031 C HIS D 56 4.098 31.358 34.691 1.00 42.41 C
ATOM 10032 O HIS D 56 4.362 30.924 33.564 1.00 42.99 O
ATOM 10033 CB HIS D 56 2.567 30.176 36.208 1.00 41.41 C
ATOM 10034 CG HIS D 56 1.259 30.109 36.935 1.00 43.48 C
ATOM 10035 ND1 HIS D 56 0.055 29.915 36.290 1.00 42.48 N
ATOM 10036 CD2 HIS D 56 0.966 30.225 38.251 1.00 41.85 C
ATOM 10037 CE1 HIS D 56 -0.920 29.917 37.180 1.00 41.20 C
ATOM 10038 NE2 HIS D 56 -0.394 30.102 38.376 1.00 40.68 N
ATOM 10039 N THR D 57 5.016 31.835 35.531 1.00 43.15 N
ATOM 10040 CA THR D 57 6.433 31.861 35.188 1.00 43.04 C
ATOM 10041 C THR D 57 6.992 30.518 35.627 1.00 44.52 C
ATOM 10042 O THR D 57 6.394 29.830 36.453 1.00 44.79 O
ATOM 10043 CB THR D 57 7.208 32.925 35.960 1.00 40.83 C
ATOM 10044 OG1 THR D 57 7.236 32.565 37.346 1.00 40.60 O
ATOM 10045 CG2 THR D 57 6.567 34.296 35.776 1.00 39.89 C
ATOM 10046 N GLU D 58 8.137 30.143 35.081 1.00 45.30 N
ATOM 10047 CA GLU D 58 8.728 28.882 35.451 1.00 46.60 C
ATOM 10048 C GLU D 58 8.936 28.780 36.966 1.00 45.89 C
ATOM 10049 O GLU D 58 8.678 27.741 37.570 1.00 46.50 O
ATOM 10050 CB GLU D 58 10.046 28.711 34.724 1.00 49.81 C
ATOM 10051 CG GLU D 58 10.777 27.470 35.140 1.00 54.57 C
ATOM 10052 CD GLU D 58 11.718 27.005 34.072 1.00 57.81 C
ATOM 10053 OE1 GLU D 58 12.486 27.853 33.554 1.00 60.12 O
ATOM 10054 OE2 GLU D 58 11.683 25.794 33.755 1.00 60.03 O
ATOM 10055 N ALA D 59 9.396 29.857 37.587 1.00 44.48 N
ATOM 10056 CA ALA D 59 9.623 29.828 39.023 1.00 43.50 C
ATOM 10057 C ALA D 59 8.328 29.500 39.765 1.00 43.67 C
ATOM 10058 O ALA D 59 8.319 28.667 40.682 1.00 44.20 O
ATOM 10059 CB ALA D 59 10.171 31.152 39.481 1.00 43.65 C
ATOM 10060 N GLU D 60 7.236 30.156 39.367 1.00 41.68 N
ATOM 10061 CA GLU D 60 5.933 29.915 39.982 1.00 39.64 C
ATOM 10062 C GLU D 60 5.495 28.468 39.804 1.00 39.98 C
ATOM 10063 O GLU D 60 5.135 27.798 40.765 1.00 41.56 O
ATOM 10064 CB GLU D 60 4.868 30.813 39.360 1.00 36.79 C
ATOM 10065 CG GLU D 60 4.940 32.249 39.755 1.00 35.11 C
ATOM 10066 CD GLU D 60 4.009 33.105 38.933 1.00 39.07 C
ATOM 10067 OE1 GLU D 60 3.682 34.222 39.384 1.00 41.83 O
ATOM 10068 OE2 GLU D 60 3.607 32.671 37.827 1.00 38.33 O
ATOM 10069 N ALA D 61 5.530 27.996 38.564 1.00 39.83 N
ATOM 10070 CA ALA D 61 5.111 26.646 38.239 1.00 39.89 C
ATOM 10071 C ALA D 61 5.818 25.612 39.103 1.00 41.91 C
ATOM 10072 O ALA D 61 5.205 24.636 39.566 1.00 40.12 O
ATOM 10073 CB ALA D 61 5.369 26.375 36.765 1.00 39.29 C
ATOM 10074 N LYS D 62 7.112 25.828 39.322 1.00 43.50 N
ATOM 10075 CA LYS D 62 7.899 24.900 40.126 1.00 44.91 C
ATOM 10076 C LYS D 62 7.352 24.885 41.560 1.00 44.38 C
ATOM 10077 O LYS D 62 7.179 23.814 42.169 1.00 42.03 O
ATOM 10078 CB LYS D 62 9.371 25.319 40.109 1.00 45.45 C
ATOM 10079 CG LYS D 62 10.250 24.418 40.924 1.00 49.12 C
ATOM 10080 CD LYS D 62 11.713 24.811 40.819 1.00 53.88 C
ATOM 10081 CE LYS D 62 12.568 23.955 41.756 1.00 56.00 C
ATOM 10082 NZ LYS D 62 14.023 24.154 41.509 1.00 60.17 N
ATOM 10083 N ALA D 63 7.069 26.079 42.081 1.00 42.74 N
ATOM 10084 CA ALA D 63 6.525 26.222 43.422 1.00 42.33 C
ATOM 10085 C ALA D 63 5.237 25.409 43.483 1.00 42.64 C
ATOM 10086 O ALA D 63 5.112 24.483 44.279 1.00 43.78 O
ATOM 10087 CB ALA D 63 6.246 27.678 43.716 1.00 41.57 C
ATOM 10088 N LEU D 64 4.282 25.751 42.631 1.00 42.27 N
ATOM 10089 CA LEU D 64 3.025 25.017 42.575 1.00 41.86 C
ATOM 10090 C LEU D 64 3.221 23.505 42.610 1.00 42.66 C
ATOM 10091 O LEU D 64 2.555 22.810 43.370 1.00 43.90 O
ATOM 10092 CB LEU D 64 2.266 25.383 41.309 1.00 39.36 C
ATOM 10093 CG LEU D 64 1.702 26.793 41.381 1.00 37.00 C
ATOM 10094 CD1 LEU D 64 1.326 27.252 39.996 1.00 38.18 C
ATOM 10095 CD2 LEU D 64 0.518 26.818 42.313 1.00 31.99 C
ATOM 10096 N ALA D 65 4.138 22.991 41.800 1.00 43.40 N
ATOM 10097 CA ALA D 65 4.365 21.550 41.769 1.00 44.33 C
ATOM 10098 C ALA D 65 4.933 20.996 43.067 1.00 44.76 C
ATOM 10099 O ALA D 65 4.604 19.886 43.471 1.00 43.32 O
ATOM 10100 CB ALA D 65 5.289 21.182 40.601 1.00 42.45 C
ATOM 10101 N GLU D 66 5.785 21.770 43.726 1.00 47.55 N
ATOM 10102 CA GLU D 66 6.410 21.297 44.952 1.00 49.93 C
ATOM 10103 C GLU D 66 5.443 21.269 46.119 1.00 49.33 C
ATOM 10104 O GLU D 66 5.685 20.588 47.118 1.00 50.56 O
ATOM 10105 CB GLU D 66 7.659 22.135 45.261 1.00 52.82 C
ATOM 10106 CG GLU D 66 8.691 22.046 44.136 1.00 58.09 C
ATOM 10107 CD GLU D 66 9.919 22.909 44.362 1.00 62.32 C
ATOM 10108 OE1 GLU D 66 9.767 24.043 44.873 1.00 64.97 O
ATOM 10109 OE2 GLU D 66 11.037 22.464 44.008 1.00 64.66 O
ATOM 10110 N GLU D 67 4.338 21.992 45.987 1.00 48.04 N
ATOM 10111 CA GLU D 67 3.318 22.000 47.025 1.00 47.63 C
ATOM 10112 C GLU D 67 2.682 20.625 47.143 1.00 49.50 C
ATOM 10113 O GLU D 67 2.080 20.298 48.150 1.00 50.96 O
ATOM 10114 CB GLU D 67 2.230 23.005 46.693 1.00 45.14 C
ATOM 10115 CG GLU D 67 2.584 24.426 47.025 1.00 45.18 C
ATOM 10116 CD GLU D 67 1.476 25.361 46.640 1.00 46.95 C
ATOM 10117 OE1 GLU D 67 0.316 25.003 46.928 1.00 48.81 O
ATOM 10118 OE2 GLU D 67 1.749 26.436 46.054 1.00 46.93 O
ATOM 10119 N VAL D 68 2.817 19.817 46.105 1.00 52.98 N
ATOM 10120 CA VAL D 68 2.241 18.482 46.101 1.00 55.89 C
ATOM 10121 C VAL D 68 3.261 17.389 46.404 1.00 59.27 C
ATOM 10122 O VAL D 68 4.445 17.506 46.068 1.00 59.63 O
ATOM 10123 CB VAL D 68 1.622 18.156 44.729 1.00 55.40 C
ATOM 10124 CG1 VAL D 68 0.884 16.825 44.796 1.00 55.46 C
ATOM 10125 CG2 VAL D 68 0.712 19.280 44.283 1.00 53.80 C
ATOM 10126 N GLU D 69 2.793 16.325 47.050 1.00 62.68 N
ATOM 10127 CA GLU D 69 3.654 15.186 47.344 1.00 67.12 C
ATOM 10128 C GLU D 69 3.241 14.137 46.326 1.00 67.18 C
ATOM 10129 O GLU D 69 2.051 13.887 46.144 1.00 68.41 O
ATOM 10130 CB GLU D 69 3.425 14.644 48.769 1.00 71.17 C
ATOM 10131 CG GLU D 69 3.940 15.543 49.914 1.00 78.58 C
ATOM 10132 CD GLU D 69 5.464 15.764 49.896 1.00 82.47 C
ATOM 10133 OE1 GLU D 69 6.222 14.775 50.066 1.00 84.06 O
ATOM 10134 OE2 GLU D 69 5.902 16.932 49.715 1.00 83.68 O
ATOM 10135 N VAL D 70 4.205 13.548 45.634 1.00 66.34 N
ATOM 10136 CA VAL D 70 3.873 12.529 44.661 1.00 66.36 C
ATOM 10137 C VAL D 70 4.569 11.237 45.019 1.00 66.94 C
ATOM 10138 O VAL D 70 5.613 11.242 45.669 1.00 66.43 O
ATOM 10139 CB VAL D 70 4.271 12.952 43.247 1.00 65.54 C
ATOM 10140 CG1 VAL D 70 3.365 14.057 42.772 1.00 66.92 C
ATOM 10141 CG2 VAL D 70 5.683 13.442 43.244 1.00 67.80 C
ATOM 10142 N GLN D 71 3.970 10.128 44.606 1.00 68.51 N
ATOM 10143 CA GLN D 71 4.527 8.819 44.877 1.00 69.45 C
ATOM 10144 C GLN D 71 5.489 8.461 43.771 1.00 70.25 C
ATOM 10145 O GLN D 71 5.252 8.772 42.605 1.00 70.23 O
ATOM 10146 CB GLN D 71 3.427 7.773 44.951 1.00 69.49 C
ATOM 10147 CG GLN D 71 3.903 6.461 45.509 1.00 72.12 C
ATOM 10148 CD GLN D 71 2.756 5.585 45.958 1.00 73.73 C
ATOM 10149 OE1 GLN D 71 2.039 5.014 45.134 1.00 74.72 O
ATOM 10150 NE2 GLN D 71 2.566 5.479 47.275 1.00 72.97 N
ATOM 10151 N ASP D 72 6.580 7.806 44.145 1.00 71.70 N
ATOM 10152 CA ASP D 72 7.591 7.409 43.188 1.00 72.65 C
ATOM 10153 C ASP D 72 8.194 6.096 43.669 1.00 73.52 C
ATOM 10154 O ASP D 72 7.753 5.539 44.680 1.00 73.67 O
ATOM 10155 CB ASP D 72 8.657 8.499 43.095 1.00 72.59 C
ATOM 10156 CG ASP D 72 9.316 8.545 41.743 1.00 73.61 C
ATOM 10157 OD1 ASP D 72 9.925 7.528 41.354 1.00 75.00 O
ATOM 10158 OD2 ASP D 72 9.219 9.594 41.068 1.00 73.66 O
ATOM 10159 N GLY D 73 9.194 5.603 42.945 1.00 73.48 N
ATOM 10160 CA GLY D 73 9.830 4.356 43.322 1.00 73.11 C
ATOM 10161 C GLY D 73 9.609 3.292 42.271 1.00 73.38 C
ATOM 10162 O GLY D 73 9.150 3.602 41.178 1.00 71.97 O
ATOM 10163 N PRO D 74 9.910 2.021 42.578 1.00 74.72 N
ATOM 10164 CA PRO D 74 10.443 1.578 43.868 1.00 75.50 C
ATOM 10165 C PRO D 74 11.896 1.982 44.069 1.00 76.24 C
ATOM 10166 O PRO D 74 12.626 2.194 43.100 1.00 75.72 O
ATOM 10167 CB PRO D 74 10.267 0.067 43.802 1.00 75.52 C
ATOM 10168 CG PRO D 74 10.523 -0.215 42.363 1.00 75.14 C
ATOM 10169 CD PRO D 74 9.727 0.869 41.676 1.00 75.20 C
ATOM 10170 N ASP D 75 12.306 2.084 45.330 1.00 77.48 N
ATOM 10171 CA ASP D 75 13.678 2.449 45.664 1.00 79.56 C
ATOM 10172 C ASP D 75 14.559 1.209 45.704 1.00 80.70 C
ATOM 10173 O ASP D 75 14.244 0.194 45.084 1.00 81.30 O
ATOM 10174 CB ASP D 75 13.743 3.141 47.028 1.00 79.47 C
ATOM 10175 CG ASP D 75 13.166 2.288 48.143 1.00 80.28 C
ATOM 10176 OD1 ASP D 75 13.182 1.041 48.017 1.00 79.61 O
ATOM 10177 OD2 ASP D 75 12.707 2.867 49.152 1.00 80.23 O
ATOM 10178 N GLU D 76 15.649 1.304 46.460 1.00 82.16 N
ATOM 10179 CA GLU D 76 16.612 0.217 46.620 1.00 84.00 C
ATOM 10180 C GLU D 76 16.014 -1.052 47.244 1.00 83.90 C
ATOM 10181 O GLU D 76 16.441 -2.164 46.935 1.00 83.16 O
ATOM 10182 CB GLU D 76 17.794 0.688 47.478 1.00 86.79 C
ATOM 10183 CG GLU D 76 18.648 1.824 46.880 1.00 91.26 C
ATOM 10184 CD GLU D 76 17.986 3.207 46.944 1.00 93.28 C
ATOM 10185 OE1 GLU D 76 17.588 3.640 48.052 1.00 94.48 O
ATOM 10186 OE2 GLU D 76 17.879 3.870 45.886 1.00 93.67 O
ATOM 10187 N ASN D 77 15.030 -0.886 48.122 1.00 84.11 N
ATOM 10188 CA ASN D 77 14.397 -2.030 48.778 1.00 84.19 C
ATOM 10189 C ASN D 77 13.145 -2.477 48.039 1.00 83.43 C
ATOM 10190 O ASN D 77 12.476 -3.424 48.456 1.00 83.40 O
ATOM 10191 CB ASN D 77 14.009 -1.680 50.217 1.00 85.31 C
ATOM 10192 CG ASN D 77 15.150 -1.067 50.997 1.00 86.96 C
ATOM 10193 OD1 ASN D 77 16.260 -1.599 51.011 1.00 88.17 O
ATOM 10194 ND2 ASN D 77 14.882 0.059 51.659 1.00 87.71 N
ATOM 10195 N GLY D 78 12.829 -1.796 46.943 1.00 82.07 N
ATOM 10196 CA GLY D 78 11.636 -2.138 46.192 1.00 81.08 C
ATOM 10197 C GLY D 78 10.442 -1.492 46.867 1.00 80.17 C
ATOM 10198 O GLY D 78 9.308 -1.964 46.761 1.00 78.83 O
ATOM 10199 N GLU D 79 10.712 -0.396 47.565 1.00 79.17 N
ATOM 10200 CA GLU D 79 9.685 0.333 48.289 1.00 78.64 C
ATOM 10201 C GLU D 79 9.271 1.600 47.570 1.00 76.29 C
ATOM 10202 O GLU D 79 10.094 2.251 46.930 1.00 75.99 O
ATOM 10203 CB GLU D 79 10.200 0.709 49.676 1.00 82.72 C
ATOM 10204 CG GLU D 79 10.386 -0.461 50.624 1.00 87.74 C
ATOM 10205 CD GLU D 79 9.066 -1.120 50.981 1.00 91.09 C
ATOM 10206 OE1 GLU D 79 9.070 -2.054 51.815 1.00 92.66 O
ATOM 10207 OE2 GLU D 79 8.023 -0.699 50.426 1.00 93.13 O
ATOM 10208 N LEU D 80 7.990 1.946 47.680 1.00 73.06 N
ATOM 10209 CA LEU D 80 7.485 3.168 47.066 1.00 69.30 C
ATOM 10210 C LEU D 80 7.665 4.281 48.084 1.00 67.40 C
ATOM 10211 O LEU D 80 7.467 4.075 49.278 1.00 67.36 O
ATOM 10212 CB LEU D 80 6.005 3.036 46.717 1.00 68.77 C
ATOM 10213 CG LEU D 80 5.633 2.061 45.600 1.00 68.52 C
ATOM 10214 CD1 LEU D 80 4.156 2.217 45.290 1.00 67.24 C
ATOM 10215 CD2 LEU D 80 6.471 2.336 44.351 1.00 67.98 C
ATOM 10216 N PHE D 81 8.043 5.460 47.619 1.00 64.66 N
ATOM 10217 CA PHE D 81 8.252 6.569 48.529 1.00 63.11 C
ATOM 10218 C PHE D 81 7.598 7.839 48.013 1.00 62.37 C
ATOM 10219 O PHE D 81 7.130 7.888 46.881 1.00 62.09 O
ATOM 10220 CB PHE D 81 9.751 6.797 48.727 1.00 62.90 C
ATOM 10221 CG PHE D 81 10.482 7.132 47.461 1.00 62.93 C
ATOM 10222 CD1 PHE D 81 10.514 8.437 46.987 1.00 62.93 C
ATOM 10223 CD2 PHE D 81 11.102 6.134 46.716 1.00 62.78 C
ATOM 10224 CE1 PHE D 81 11.152 8.745 45.786 1.00 63.20 C
ATOM 10225 CE2 PHE D 81 11.739 6.429 45.516 1.00 62.93 C
ATOM 10226 CZ PHE D 81 11.762 7.736 45.050 1.00 63.61 C
ATOM 10227 N MET D 82 7.565 8.863 48.855 1.00 61.34 N
ATOM 10228 CA MET D 82 6.974 10.139 48.487 1.00 60.08 C
ATOM 10229 C MET D 82 8.077 11.140 48.229 1.00 60.00 C
ATOM 10230 O MET D 82 9.168 11.031 48.783 1.00 61.41 O
ATOM 10231 CB MET D 82 6.089 10.675 49.605 1.00 58.89 C
ATOM 10232 CG MET D 82 4.846 9.881 49.850 1.00 59.33 C
ATOM 10233 SD MET D 82 3.768 9.799 48.420 1.00 64.09 S
ATOM 10234 CE MET D 82 3.598 8.041 48.246 1.00 62.92 C
ATOM 10235 N ARG D 83 7.782 12.124 47.392 1.00 58.63 N
ATOM 10236 CA ARG D 83 8.745 13.158 47.060 1.00 56.99 C
ATOM 10237 C ARG D 83 7.966 14.407 46.694 1.00 57.19 C
ATOM 10238 O ARG D 83 6.754 14.359 46.492 1.00 57.20 O
ATOM 10239 CB ARG D 83 9.589 12.725 45.860 1.00 55.32 C
ATOM 10240 CG ARG D 83 8.770 12.490 44.584 1.00 52.96 C
ATOM 10241 CD ARG D 83 9.654 12.155 43.395 1.00 51.62 C
ATOM 10242 NE ARG D 83 8.899 11.955 42.157 1.00 51.02 N
ATOM 10243 CZ ARG D 83 8.233 12.909 41.514 1.00 48.71 C
ATOM 10244 NH1 ARG D 83 8.223 14.148 41.983 1.00 49.50 N
ATOM 10245 NH2 ARG D 83 7.562 12.621 40.410 1.00 44.55 N
ATOM 10246 N PRO D 84 8.649 15.552 46.628 1.00 57.22 N
ATOM 10247 CA PRO D 84 7.959 16.791 46.263 1.00 56.49 C
ATOM 10248 C PRO D 84 7.771 16.805 44.738 1.00 55.98 C
ATOM 10249 O PRO D 84 8.592 16.244 44.002 1.00 56.93 O
ATOM 10250 CB PRO D 84 8.915 17.873 46.760 1.00 56.34 C
ATOM 10251 CG PRO D 84 10.260 17.235 46.600 1.00 57.08 C
ATOM 10252 CD PRO D 84 10.017 15.824 47.105 1.00 56.97 C
ATOM 10253 N GLY D 85 6.692 17.432 44.269 1.00 54.83 N
ATOM 10254 CA GLY D 85 6.414 17.486 42.842 1.00 52.19 C
ATOM 10255 C GLY D 85 7.416 18.226 41.966 1.00 50.31 C
ATOM 10256 O GLY D 85 8.179 19.077 42.439 1.00 48.62 O
ATOM 10257 N LYS D 86 7.391 17.888 40.677 1.00 48.62 N
ATOM 10258 CA LYS D 86 8.264 18.469 39.655 1.00 46.95 C
ATOM 10259 C LYS D 86 7.348 19.037 38.578 1.00 44.61 C
ATOM 10260 O LYS D 86 6.266 18.506 38.361 1.00 45.17 O
ATOM 10261 CB LYS D 86 9.131 17.382 39.002 1.00 49.40 C
ATOM 10262 CG LYS D 86 9.962 16.536 39.937 1.00 51.85 C
ATOM 10263 CD LYS D 86 10.690 15.464 39.148 1.00 56.44 C
ATOM 10264 CE LYS D 86 11.692 14.697 40.020 1.00 61.63 C
ATOM 10265 NZ LYS D 86 12.575 13.798 39.201 1.00 64.78 N
ATOM 10266 N ILE D 87 7.777 20.079 37.874 1.00 41.34 N
ATOM 10267 CA ILE D 87 6.922 20.643 36.847 1.00 39.35 C
ATOM 10268 C ILE D 87 6.464 19.610 35.807 1.00 41.38 C
ATOM 10269 O ILE D 87 5.454 19.812 35.120 1.00 41.82 O
ATOM 10270 CB ILE D 87 7.600 21.821 36.123 1.00 36.39 C
ATOM 10271 CG1 ILE D 87 8.903 21.372 35.484 1.00 35.54 C
ATOM 10272 CG2 ILE D 87 7.826 22.961 37.092 1.00 34.79 C
ATOM 10273 CD1 ILE D 87 9.586 22.473 34.690 1.00 33.71 C
ATOM 10274 N SER D 88 7.190 18.502 35.702 1.00 40.96 N
ATOM 10275 CA SER D 88 6.841 17.469 34.737 1.00 41.18 C
ATOM 10276 C SER D 88 5.713 16.576 35.242 1.00 40.93 C
ATOM 10277 O SER D 88 5.217 15.716 34.511 1.00 41.54 O
ATOM 10278 CB SER D 88 8.074 16.621 34.398 1.00 42.00 C
ATOM 10279 OG SER D 88 8.600 15.994 35.554 1.00 46.67 O
ATOM 10280 N ASP D 89 5.308 16.773 36.492 1.00 40.27 N
ATOM 10281 CA ASP D 89 4.217 15.985 37.059 1.00 40.91 C
ATOM 10282 C ASP D 89 2.866 16.538 36.626 1.00 42.26 C
ATOM 10283 O ASP D 89 2.695 17.750 36.429 1.00 44.39 O
ATOM 10284 CB ASP D 89 4.242 16.005 38.590 1.00 42.34 C
ATOM 10285 CG ASP D 89 5.366 15.169 39.182 1.00 44.44 C
ATOM 10286 OD1 ASP D 89 5.565 14.029 38.701 1.00 45.25 O
ATOM 10287 OD2 ASP D 89 6.032 15.645 40.142 1.00 41.70 O
ATOM 10288 N TYR D 90 1.893 15.647 36.499 1.00 41.60 N
ATOM 10289 CA TYR D 90 0.551 16.058 36.137 1.00 39.28 C
ATOM 10290 C TYR D 90 -0.228 16.362 37.417 1.00 38.20 C
ATOM 10291 O TYR D 90 0.144 15.898 38.495 1.00 38.03 O
ATOM 10292 CB TYR D 90 -0.123 14.947 35.342 1.00 39.09 C
ATOM 10293 CG TYR D 90 0.466 14.812 33.970 1.00 39.34 C
ATOM 10294 CD1 TYR D 90 1.697 14.179 33.778 1.00 38.75 C
ATOM 10295 CD2 TYR D 90 -0.159 15.392 32.865 1.00 38.72 C
ATOM 10296 CE1 TYR D 90 2.302 14.130 32.520 1.00 36.18 C
ATOM 10297 CE2 TYR D 90 0.436 15.351 31.605 1.00 40.26 C
ATOM 10298 CZ TYR D 90 1.675 14.718 31.442 1.00 38.52 C
ATOM 10299 OH TYR D 90 2.288 14.713 30.207 1.00 40.05 O
ATOM 10300 N PHE D 91 -1.286 17.161 37.311 1.00 36.63 N
ATOM 10301 CA PHE D 91 -2.095 17.493 38.482 1.00 34.84 C
ATOM 10302 C PHE D 91 -2.539 16.232 39.236 1.00 34.66 C
ATOM 10303 O PHE D 91 -2.938 15.227 38.644 1.00 34.04 O
ATOM 10304 CB PHE D 91 -3.299 18.341 38.066 1.00 33.40 C
ATOM 10305 CG PHE D 91 -2.921 19.651 37.442 1.00 30.03 C
ATOM 10306 CD1 PHE D 91 -1.641 20.163 37.611 1.00 28.78 C
ATOM 10307 CD2 PHE D 91 -3.839 20.377 36.699 1.00 29.53 C
ATOM 10308 CE1 PHE D 91 -1.279 21.373 37.055 1.00 29.24 C
ATOM 10309 CE2 PHE D 91 -3.483 21.585 36.138 1.00 29.15 C
ATOM 10310 CZ PHE D 91 -2.201 22.087 36.315 1.00 29.06 C
ATOM 10311 N PRO D 92 -2.470 16.280 40.566 1.00 35.39 N
ATOM 10312 CA PRO D 92 -2.816 15.219 41.515 1.00 35.14 C
ATOM 10313 C PRO D 92 -4.252 14.773 41.441 1.00 37.00 C
ATOM 10314 O PRO D 92 -5.163 15.593 41.404 1.00 39.49 O
ATOM 10315 CB PRO D 92 -2.529 15.852 42.863 1.00 34.51 C
ATOM 10316 CG PRO D 92 -1.646 17.014 42.557 1.00 37.13 C
ATOM 10317 CD PRO D 92 -2.203 17.534 41.283 1.00 37.06 C
ATOM 10318 N LYS D 93 -4.463 13.468 41.448 1.00 37.18 N
ATOM 10319 CA LYS D 93 -5.815 12.951 41.408 1.00 38.15 C
ATOM 10320 C LYS D 93 -6.308 13.017 42.838 1.00 37.70 C
ATOM 10321 O LYS D 93 -5.565 12.722 43.763 1.00 38.23 O
ATOM 10322 CB LYS D 93 -5.834 11.487 40.943 1.00 41.00 C
ATOM 10323 CG LYS D 93 -5.191 11.213 39.593 1.00 44.39 C
ATOM 10324 CD LYS D 93 -5.519 9.802 39.140 1.00 50.19 C
ATOM 10325 CE LYS D 93 -4.999 9.514 37.744 1.00 52.80 C
ATOM 10326 NZ LYS D 93 -3.518 9.420 37.770 1.00 55.39 N
ATOM 10327 N PRO D 94 -7.567 13.405 43.046 1.00 38.11 N
ATOM 10328 CA PRO D 94 -8.100 13.482 44.409 1.00 37.82 C
ATOM 10329 C PRO D 94 -8.337 12.099 44.994 1.00 39.30 C
ATOM 10330 O PRO D 94 -8.336 11.933 46.207 1.00 39.90 O
ATOM 10331 CB PRO D 94 -9.407 14.238 44.229 1.00 36.03 C
ATOM 10332 CG PRO D 94 -9.178 15.027 43.008 1.00 37.94 C
ATOM 10333 CD PRO D 94 -8.481 14.057 42.102 1.00 37.96 C
ATOM 10334 N TYR D 95 -8.551 11.113 44.123 1.00 40.37 N
ATOM 10335 CA TYR D 95 -8.803 9.746 44.556 1.00 42.01 C
ATOM 10336 C TYR D 95 -7.995 8.755 43.725 1.00 43.94 C
ATOM 10337 O TYR D 95 -7.615 9.048 42.588 1.00 45.89 O
ATOM 10338 CB TYR D 95 -10.287 9.413 44.419 1.00 42.48 C
ATOM 10339 CG TYR D 95 -11.211 10.512 44.870 1.00 43.51 C
ATOM 10340 CD1 TYR D 95 -11.825 11.361 43.945 1.00 44.25 C
ATOM 10341 CD2 TYR D 95 -11.486 10.701 46.215 1.00 43.22 C
ATOM 10342 CE1 TYR D 95 -12.696 12.370 44.355 1.00 44.77 C
ATOM 10343 CE2 TYR D 95 -12.356 11.707 46.644 1.00 44.69 C
ATOM 10344 CZ TYR D 95 -12.956 12.535 45.713 1.00 46.20 C
ATOM 10345 OH TYR D 95 -13.814 13.518 46.147 1.00 46.86 O
ATOM 10346 N PRO D 96 -7.739 7.557 44.277 1.00 44.14 N
ATOM 10347 CA PRO D 96 -6.979 6.468 43.649 1.00 44.15 C
ATOM 10348 C PRO D 96 -7.709 5.752 42.520 1.00 45.57 C
ATOM 10349 O PRO D 96 -7.088 5.137 41.647 1.00 47.38 O
ATOM 10350 CB PRO D 96 -6.710 5.518 44.809 1.00 45.34 C
ATOM 10351 CG PRO D 96 -6.857 6.404 46.050 1.00 45.03 C
ATOM 10352 CD PRO D 96 -8.027 7.244 45.686 1.00 43.42 C
ATOM 10353 N ASN D 97 -9.033 5.827 42.539 1.00 46.00 N
ATOM 10354 CA ASN D 97 -9.850 5.166 41.527 1.00 44.92 C
ATOM 10355 C ASN D 97 -11.274 5.688 41.652 1.00 44.27 C
ATOM 10356 O ASN D 97 -11.654 6.212 42.698 1.00 41.00 O
ATOM 10357 CB ASN D 97 -9.823 3.663 41.766 1.00 45.36 C
ATOM 10358 CG ASN D 97 -10.176 3.314 43.188 1.00 46.94 C
ATOM 10359 OD1 ASN D 97 -11.344 3.371 43.586 1.00 46.58 O
ATOM 10360 ND2 ASN D 97 -9.161 2.987 43.984 1.00 47.22 N
ATOM 10361 N PRO D 98 -12.084 5.539 40.590 1.00 45.18 N
ATOM 10362 CA PRO D 98 -13.463 6.026 40.642 1.00 46.18 C
ATOM 10363 C PRO D 98 -14.271 5.435 41.795 1.00 46.23 C
ATOM 10364 O PRO D 98 -15.147 6.101 42.337 1.00 46.43 O
ATOM 10365 CB PRO D 98 -14.008 5.681 39.248 1.00 45.81 C
ATOM 10366 CG PRO D 98 -13.210 4.499 38.852 1.00 44.35 C
ATOM 10367 CD PRO D 98 -11.824 4.842 39.319 1.00 44.93 C
ATOM 10368 N GLU D 99 -13.965 4.199 42.182 1.00 46.60 N
ATOM 10369 CA GLU D 99 -14.668 3.570 43.298 1.00 46.77 C
ATOM 10370 C GLU D 99 -14.511 4.447 44.540 1.00 46.02 C
ATOM 10371 O GLU D 99 -15.485 4.757 45.220 1.00 47.61 O
ATOM 10372 CB GLU D 99 -14.104 2.175 43.605 1.00 48.51 C
ATOM 10373 CG GLU D 99 -14.464 1.059 42.627 1.00 49.91 C
ATOM 10374 CD GLU D 99 -13.866 1.255 41.232 1.00 53.65 C
ATOM 10375 OE1 GLU D 99 -12.710 1.733 41.113 1.00 55.85 O
ATOM 10376 OE2 GLU D 99 -14.552 0.909 40.248 1.00 54.30 O
ATOM 10377 N ALA D 100 -13.279 4.839 44.841 1.00 44.02 N
ATOM 10378 CA ALA D 100 -13.027 5.687 46.000 1.00 43.52 C
ATOM 10379 C ALA D 100 -13.745 7.035 45.826 1.00 43.64 C
ATOM 10380 O ALA D 100 -14.323 7.580 46.756 1.00 43.73 O
ATOM 10381 CB ALA D 100 -11.524 5.902 46.158 1.00 41.74 C
ATOM 10382 N ALA D 101 -13.708 7.554 44.608 1.00 43.73 N
ATOM 10383 CA ALA D 101 -14.330 8.821 44.284 1.00 42.24 C
ATOM 10384 C ALA D 101 -15.803 8.796 44.620 1.00 41.59 C
ATOM 10385 O ALA D 101 -16.297 9.675 45.324 1.00 41.47 O
ATOM 10386 CB ALA D 101 -14.147 9.114 42.810 1.00 42.38 C
ATOM 10387 N ARG D 102 -16.507 7.795 44.096 1.00 40.78 N
ATOM 10388 CA ARG D 102 -17.945 7.656 44.337 1.00 39.47 C
ATOM 10389 C ARG D 102 -18.164 7.501 45.820 1.00 38.94 C
ATOM 10390 O ARG D 102 -19.051 8.119 46.410 1.00 38.29 O
ATOM 10391 CB ARG D 102 -18.496 6.425 43.623 1.00 37.73 C
ATOM 10392 CG ARG D 102 -18.600 6.579 42.127 1.00 40.84 C
ATOM 10393 CD ARG D 102 -19.104 5.298 41.486 1.00 42.05 C
ATOM 10394 NE ARG D 102 -19.223 5.408 40.030 1.00 44.90 N
ATOM 10395 CZ ARG D 102 -20.039 6.258 39.403 1.00 46.06 C
ATOM 10396 NH1 ARG D 102 -20.814 7.081 40.101 1.00 45.84 N
ATOM 10397 NH2 ARG D 102 -20.088 6.288 38.074 1.00 45.86 N
ATOM 10398 N ALA D 103 -17.324 6.668 46.418 1.00 38.41 N
ATOM 10399 CA ALA D 103 -17.390 6.392 47.833 1.00 38.36 C
ATOM 10400 C ALA D 103 -17.354 7.678 48.652 1.00 39.54 C
ATOM 10401 O ALA D 103 -17.924 7.737 49.745 1.00 41.10 O
ATOM 10402 CB ALA D 103 -16.241 5.492 48.224 1.00 36.09 C
ATOM 10403 N ALA D 104 -16.697 8.705 48.122 1.00 37.45 N
ATOM 10404 CA ALA D 104 -16.570 9.960 48.837 1.00 35.92 C
ATOM 10405 C ALA D 104 -17.530 11.005 48.318 1.00 37.66 C
ATOM 10406 O ALA D 104 -17.402 12.180 48.659 1.00 40.38 O
ATOM 10407 CB ALA D 104 -15.161 10.462 48.717 1.00 34.20 C
ATOM 10408 N ASN D 105 -18.487 10.590 47.494 1.00 37.54 N
ATOM 10409 CA ASN D 105 -19.448 11.522 46.923 1.00 37.56 C
ATOM 10410 C ASN D 105 -20.829 10.915 46.760 1.00 40.04 C
ATOM 10411 O ASN D 105 -21.545 11.197 45.802 1.00 39.55 O
ATOM 10412 CB ASN D 105 -18.921 12.034 45.588 1.00 36.48 C
ATOM 10413 CG ASN D 105 -17.754 12.988 45.762 1.00 37.44 C
ATOM 10414 OD1 ASN D 105 -17.953 14.162 46.083 1.00 40.42 O
ATOM 10415 ND2 ASN D 105 -16.530 12.487 45.581 1.00 33.74 N
ATOM 10416 N ASN D 106 -21.194 10.064 47.708 1.00 42.92 N
ATOM 10417 CA ASN D 106 -22.502 9.427 47.701 1.00 45.02 C
ATOM 10418 C ASN D 106 -22.814 8.655 46.446 1.00 43.04 C
ATOM 10419 O ASN D 106 -23.900 8.771 45.898 1.00 43.71 O
ATOM 10420 CB ASN D 106 -23.585 10.474 47.933 1.00 50.08 C
ATOM 10421 CG ASN D 106 -23.290 11.335 49.140 1.00 57.06 C
ATOM 10422 OD1 ASN D 106 -23.168 10.823 50.263 1.00 60.31 O
ATOM 10423 ND2 ASN D 106 -23.148 12.650 48.921 1.00 60.02 N
ATOM 10424 N GLY D 107 -21.854 7.871 45.989 1.00 41.92 N
ATOM 10425 CA GLY D 107 -22.086 7.057 44.815 1.00 40.11 C
ATOM 10426 C GLY D 107 -21.956 7.805 43.516 1.00 39.11 C
ATOM 10427 O GLY D 107 -22.013 7.189 42.451 1.00 40.95 O
ATOM 10428 N ALA D 108 -21.790 9.122 43.588 1.00 35.82 N
ATOM 10429 CA ALA D 108 -21.645 9.920 42.381 1.00 33.26 C
ATOM 10430 C ALA D 108 -20.162 10.053 42.033 1.00 33.33 C
ATOM 10431 O ALA D 108 -19.294 10.126 42.914 1.00 32.28 O
ATOM 10432 CB ALA D 108 -22.266 11.294 42.575 1.00 31.00 C
ATOM 10433 N LEU D 109 -19.887 10.089 40.733 1.00 33.49 N
ATOM 10434 CA LEU D 109 -18.521 10.195 40.224 1.00 31.31 C
ATOM 10435 C LEU D 109 -18.187 11.547 39.573 1.00 29.80 C
ATOM 10436 O LEU D 109 -18.640 11.845 38.467 1.00 29.76 O
ATOM 10437 CB LEU D 109 -18.285 9.068 39.221 1.00 30.89 C
ATOM 10438 CG LEU D 109 -16.958 9.005 38.466 1.00 30.23 C
ATOM 10439 CD1 LEU D 109 -15.802 8.997 39.437 1.00 30.77 C
ATOM 10440 CD2 LEU D 109 -16.946 7.771 37.605 1.00 27.25 C
ATOM 10441 N PRO D 110 -17.404 12.391 40.266 1.00 27.72 N
ATOM 10442 CA PRO D 110 -17.063 13.685 39.661 1.00 26.41 C
ATOM 10443 C PRO D 110 -16.114 13.414 38.501 1.00 27.59 C
ATOM 10444 O PRO D 110 -15.015 12.902 38.697 1.00 28.81 O
ATOM 10445 CB PRO D 110 -16.391 14.451 40.804 1.00 24.48 C
ATOM 10446 CG PRO D 110 -15.883 13.346 41.719 1.00 26.12 C
ATOM 10447 CD PRO D 110 -16.935 12.291 41.660 1.00 24.63 C
ATOM 10448 N PRO D 111 -16.522 13.762 37.273 1.00 26.62 N
ATOM 10449 CA PRO D 111 -15.684 13.536 36.086 1.00 26.21 C
ATOM 10450 C PRO D 111 -14.357 14.329 36.023 1.00 27.47 C
ATOM 10451 O PRO D 111 -14.229 15.419 36.600 1.00 28.66 O
ATOM 10452 CB PRO D 111 -16.615 13.916 34.940 1.00 18.63 C
ATOM 10453 CG PRO D 111 -17.320 15.057 35.501 1.00 24.84 C
ATOM 10454 CD PRO D 111 -17.641 14.657 36.949 1.00 24.45 C
ATOM 10455 N ASP D 112 -13.375 13.771 35.314 1.00 27.49 N
ATOM 10456 CA ASP D 112 -12.093 14.440 35.126 1.00 27.52 C
ATOM 10457 C ASP D 112 -12.447 15.693 34.318 1.00 26.75 C
ATOM 10458 O ASP D 112 -13.324 15.637 33.465 1.00 27.75 O
ATOM 10459 CB ASP D 112 -11.141 13.521 34.345 1.00 25.79 C
ATOM 10460 CG ASP D 112 -9.790 14.160 34.084 1.00 28.86 C
ATOM 10461 OD1 ASP D 112 -9.655 14.864 33.042 1.00 28.25 O
ATOM 10462 OD2 ASP D 112 -8.874 13.968 34.929 1.00 23.77 O
ATOM 10463 N LEU D 113 -11.793 16.818 34.566 1.00 24.78 N
ATOM 10464 CA LEU D 113 -12.164 18.022 33.826 1.00 26.66 C
ATOM 10465 C LEU D 113 -11.298 18.442 32.642 1.00 27.45 C
ATOM 10466 O LEU D 113 -11.580 19.450 32.008 1.00 27.77 O
ATOM 10467 CB LEU D 113 -12.290 19.187 34.798 1.00 24.44 C
ATOM 10468 CG LEU D 113 -13.297 18.837 35.876 1.00 24.04 C
ATOM 10469 CD1 LEU D 113 -13.255 19.879 36.932 1.00 26.38 C
ATOM 10470 CD2 LEU D 113 -14.694 18.725 35.261 1.00 26.73 C
ATOM 10471 N SER D 114 -10.273 17.663 32.327 1.00 28.42 N
ATOM 10472 CA SER D 114 -9.377 17.987 31.218 1.00 28.90 C
ATOM 10473 C SER D 114 -10.090 18.335 29.918 1.00 28.75 C
ATOM 10474 O SER D 114 -9.694 19.274 29.223 1.00 28.67 O
ATOM 10475 CB SER D 114 -8.421 16.819 30.954 1.00 28.95 C
ATOM 10476 OG SER D 114 -7.704 16.483 32.124 1.00 32.83 O
ATOM 10477 N TYR D 115 -11.127 17.574 29.576 1.00 28.45 N
ATOM 10478 CA TYR D 115 -11.855 17.814 28.332 1.00 28.70 C
ATOM 10479 C TYR D 115 -13.338 18.115 28.581 1.00 29.80 C
ATOM 10480 O TYR D 115 -14.157 18.057 27.660 1.00 29.58 O
ATOM 10481 CB TYR D 115 -11.743 16.578 27.417 1.00 29.52 C
ATOM 10482 CG TYR D 115 -10.344 16.275 26.907 1.00 30.45 C
ATOM 10483 CD1 TYR D 115 -9.607 15.189 27.400 1.00 28.37 C
ATOM 10484 CD2 TYR D 115 -9.752 17.091 25.944 1.00 29.75 C
ATOM 10485 CE1 TYR D 115 -8.317 14.930 26.939 1.00 31.51 C
ATOM 10486 CE2 TYR D 115 -8.470 16.848 25.486 1.00 33.34 C
ATOM 10487 CZ TYR D 115 -7.750 15.771 25.974 1.00 34.35 C
ATOM 10488 OH TYR D 115 -6.484 15.546 25.454 1.00 36.88 O
ATOM 10489 N ILE D 116 -13.686 18.475 29.809 1.00 29.51 N
ATOM 10490 CA ILE D 116 -15.083 18.679 30.111 1.00 28.69 C
ATOM 10491 C ILE D 116 -15.834 19.679 29.218 1.00 30.17 C
ATOM 10492 O ILE D 116 -16.998 19.414 28.835 1.00 30.85 O
ATOM 10493 CB ILE D 116 -15.270 18.991 31.612 1.00 27.12 C
ATOM 10494 CG1 ILE D 116 -16.731 18.777 31.997 1.00 26.03 C
ATOM 10495 CG2 ILE D 116 -14.795 20.366 31.928 1.00 28.59 C
ATOM 10496 CD1 ILE D 116 -17.172 17.322 31.885 1.00 17.81 C
ATOM 10497 N VAL D 117 -15.206 20.797 28.845 1.00 28.23 N
ATOM 10498 CA VAL D 117 -15.926 21.735 27.989 1.00 27.11 C
ATOM 10499 C VAL D 117 -16.142 21.180 26.590 1.00 26.91 C
ATOM 10500 O VAL D 117 -16.933 21.704 25.834 1.00 28.34 O
ATOM 10501 CB VAL D 117 -15.247 23.116 27.872 1.00 26.34 C
ATOM 10502 CG1 VAL D 117 -15.068 23.715 29.243 1.00 25.97 C
ATOM 10503 CG2 VAL D 117 -13.944 23.008 27.146 1.00 25.29 C
ATOM 10504 N ASN D 118 -15.444 20.112 26.232 1.00 27.81 N
ATOM 10505 CA ASN D 118 -15.648 19.528 24.906 1.00 26.93 C
ATOM 10506 C ASN D 118 -16.501 18.275 25.011 1.00 26.70 C
ATOM 10507 O ASN D 118 -17.045 17.813 24.016 1.00 28.86 O
ATOM 10508 CB ASN D 118 -14.315 19.186 24.229 1.00 25.07 C
ATOM 10509 CG ASN D 118 -13.650 20.397 23.600 1.00 24.00 C
ATOM 10510 OD1 ASN D 118 -14.247 21.453 23.494 1.00 27.34 O
ATOM 10511 ND2 ASN D 118 -12.415 20.243 23.175 1.00 25.66 N
ATOM 10512 N ALA D 119 -16.632 17.748 26.223 1.00 26.07 N
ATOM 10513 CA ALA D 119 -17.403 16.532 26.461 1.00 26.67 C
ATOM 10514 C ALA D 119 -18.862 16.812 26.803 1.00 27.10 C
ATOM 10515 O ALA D 119 -19.620 15.900 27.121 1.00 29.28 O
ATOM 10516 CB ALA D 119 -16.749 15.732 27.588 1.00 23.33 C
ATOM 10517 N ARG D 120 -19.247 18.076 26.751 1.00 27.95 N
ATOM 10518 CA ARG D 120 -20.606 18.479 27.068 1.00 27.27 C
ATOM 10519 C ARG D 120 -21.102 19.462 26.035 1.00 28.49 C
ATOM 10520 O ARG D 120 -20.377 20.395 25.656 1.00 27.68 O
ATOM 10521 CB ARG D 120 -20.635 19.173 28.418 1.00 29.55 C
ATOM 10522 CG ARG D 120 -20.335 18.268 29.571 1.00 28.74 C
ATOM 10523 CD ARG D 120 -21.463 17.326 29.765 1.00 27.40 C
ATOM 10524 NE ARG D 120 -21.268 16.561 30.974 1.00 31.41 N
ATOM 10525 CZ ARG D 120 -20.336 15.631 31.108 1.00 28.02 C
ATOM 10526 NH1 ARG D 120 -19.535 15.363 30.091 1.00 27.58 N
ATOM 10527 NH2 ARG D 120 -20.194 15.002 32.263 1.00 25.09 N
ATOM 10528 N HIS D 121 -22.330 19.260 25.571 1.00 27.98 N
ATOM 10529 CA HIS D 121 -22.892 20.181 24.604 1.00 26.73 C
ATOM 10530 C HIS D 121 -22.992 21.507 25.309 1.00 26.52 C
ATOM 10531 O HIS D 121 -23.385 21.550 26.468 1.00 30.99 O
ATOM 10532 CB HIS D 121 -24.269 19.730 24.177 1.00 27.75 C
ATOM 10533 CG HIS D 121 -24.251 18.653 23.145 1.00 30.87 C
ATOM 10534 ND1 HIS D 121 -24.561 17.342 23.429 1.00 33.29 N
ATOM 10535 CD2 HIS D 121 -23.997 18.700 21.816 1.00 31.93 C
ATOM 10536 CE1 HIS D 121 -24.505 16.626 22.319 1.00 32.89 C
ATOM 10537 NE2 HIS D 121 -24.165 17.427 21.326 1.00 32.76 N
ATOM 10538 N GLY D 122 -22.613 22.584 24.638 1.00 25.86 N
ATOM 10539 CA GLY D 122 -22.690 23.895 25.257 1.00 26.48 C
ATOM 10540 C GLY D 122 -21.375 24.397 25.828 1.00 27.44 C
ATOM 10541 O GLY D 122 -21.255 25.591 26.167 1.00 29.52 O
ATOM 10542 N GLY D 123 -20.398 23.500 25.954 1.00 23.97 N
ATOM 10543 CA GLY D 123 -19.100 23.889 26.470 1.00 25.19 C
ATOM 10544 C GLY D 123 -19.129 24.776 27.696 1.00 26.98 C
ATOM 10545 O GLY D 123 -19.868 24.502 28.638 1.00 23.99 O
ATOM 10546 N GLU D 124 -18.334 25.851 27.691 1.00 30.20 N
ATOM 10547 CA GLU D 124 -18.313 26.744 28.847 1.00 32.34 C
ATOM 10548 C GLU D 124 -19.667 27.390 29.073 1.00 32.29 C
ATOM 10549 O GLU D 124 -19.998 27.746 30.199 1.00 34.52 O
ATOM 10550 CB GLU D 124 -17.224 27.827 28.732 1.00 33.54 C
ATOM 10551 CG GLU D 124 -17.119 28.531 27.393 1.00 35.74 C
ATOM 10552 CD GLU D 124 -16.183 27.804 26.445 1.00 36.94 C
ATOM 10553 OE1 GLU D 124 -16.490 26.645 26.087 1.00 37.61 O
ATOM 10554 OE2 GLU D 124 -15.140 28.382 26.067 1.00 34.74 O
ATOM 10555 N ASP D 125 -20.464 27.538 28.021 1.00 32.23 N
ATOM 10556 CA ASP D 125 -21.785 28.129 28.207 1.00 32.60 C
ATOM 10557 C ASP D 125 -22.592 27.228 29.135 1.00 30.94 C
ATOM 10558 O ASP D 125 -23.356 27.694 29.968 1.00 31.48 O
ATOM 10559 CB ASP D 125 -22.511 28.268 26.871 1.00 34.22 C
ATOM 10560 CG ASP D 125 -22.148 29.548 26.126 1.00 36.77 C
ATOM 10561 OD1 ASP D 125 -22.481 29.619 24.924 1.00 40.11 O
ATOM 10562 OD2 ASP D 125 -21.554 30.480 26.716 1.00 36.40 O
ATOM 10563 N TYR D 126 -22.396 25.929 28.998 1.00 28.83 N
ATOM 10564 CA TYR D 126 -23.104 24.989 29.831 1.00 27.81 C
ATOM 10565 C TYR D 126 -22.490 24.889 31.205 1.00 27.99 C
ATOM 10566 O TYR D 126 -23.211 24.805 32.184 1.00 31.03 O
ATOM 10567 CB TYR D 126 -23.105 23.603 29.193 1.00 26.43 C
ATOM 10568 CG TYR D 126 -23.501 22.514 30.155 1.00 25.20 C
ATOM 10569 CD1 TYR D 126 -24.825 22.391 30.593 1.00 24.64 C
ATOM 10570 CD2 TYR D 126 -22.543 21.632 30.676 1.00 22.80 C
ATOM 10571 CE1 TYR D 126 -25.186 21.418 31.524 1.00 23.82 C
ATOM 10572 CE2 TYR D 126 -22.894 20.665 31.607 1.00 22.44 C
ATOM 10573 CZ TYR D 126 -24.215 20.566 32.021 1.00 24.09 C
ATOM 10574 OH TYR D 126 -24.569 19.606 32.936 1.00 31.63 O
ATOM 10575 N VAL D 127 -21.165 24.883 31.294 1.00 28.60 N
ATOM 10576 CA VAL D 127 -20.515 24.764 32.601 1.00 29.77 C
ATOM 10577 C VAL D 127 -20.824 26.012 33.431 1.00 31.56 C
ATOM 10578 O VAL D 127 -21.068 25.921 34.644 1.00 32.38 O
ATOM 10579 CB VAL D 127 -18.960 24.535 32.466 1.00 27.52 C
ATOM 10580 CG1 VAL D 127 -18.300 24.420 33.832 1.00 21.42 C
ATOM 10581 CG2 VAL D 127 -18.698 23.261 31.704 1.00 25.85 C
ATOM 10582 N PHE D 128 -20.845 27.167 32.774 1.00 31.07 N
ATOM 10583 CA PHE D 128 -21.153 28.407 33.468 1.00 32.96 C
ATOM 10584 C PHE D 128 -22.604 28.422 33.969 1.00 33.99 C
ATOM 10585 O PHE D 128 -22.869 28.776 35.120 1.00 35.45 O
ATOM 10586 CB PHE D 128 -20.941 29.609 32.562 1.00 32.25 C
ATOM 10587 CG PHE D 128 -21.013 30.916 33.293 1.00 34.79 C
ATOM 10588 CD1 PHE D 128 -19.927 31.365 34.050 1.00 35.87 C
ATOM 10589 CD2 PHE D 128 -22.174 31.687 33.261 1.00 34.69 C
ATOM 10590 CE1 PHE D 128 -19.997 32.566 34.761 1.00 35.90 C
ATOM 10591 CE2 PHE D 128 -22.253 32.884 33.966 1.00 35.26 C
ATOM 10592 CZ PHE D 128 -21.163 33.325 34.718 1.00 35.80 C
ATOM 10593 N SER D 129 -23.542 28.056 33.102 1.00 32.21 N
ATOM 10594 CA SER D 129 -24.936 28.021 33.484 1.00 31.80 C
ATOM 10595 C SER D 129 -25.203 27.035 34.612 1.00 33.96 C
ATOM 10596 O SER D 129 -26.053 27.282 35.471 1.00 37.00 O
ATOM 10597 CB SER D 129 -25.797 27.661 32.295 1.00 31.09 C
ATOM 10598 OG SER D 129 -25.888 28.760 31.411 1.00 33.60 O
ATOM 10599 N LEU D 130 -24.484 25.924 34.626 1.00 32.77 N
ATOM 10600 CA LEU D 130 -24.685 24.942 35.680 1.00 33.71 C
ATOM 10601 C LEU D 130 -24.152 25.461 37.014 1.00 33.77 C
ATOM 10602 O LEU D 130 -24.821 25.328 38.034 1.00 34.84 O
ATOM 10603 CB LEU D 130 -23.986 23.609 35.329 1.00 32.22 C
ATOM 10604 CG LEU D 130 -24.154 22.401 36.269 1.00 30.10 C
ATOM 10605 CD1 LEU D 130 -25.411 21.630 35.902 1.00 29.62 C
ATOM 10606 CD2 LEU D 130 -22.936 21.462 36.149 1.00 31.46 C
ATOM 10607 N LEU D 131 -22.959 26.052 37.005 1.00 32.50 N
ATOM 10608 CA LEU D 131 -22.351 26.528 38.239 1.00 32.00 C
ATOM 10609 C LEU D 131 -23.118 27.650 38.900 1.00 34.06 C
ATOM 10610 O LEU D 131 -23.202 27.714 40.128 1.00 38.47 O
ATOM 10611 CB LEU D 131 -20.909 26.975 37.996 1.00 30.32 C
ATOM 10612 CG LEU D 131 -19.887 25.884 37.614 1.00 30.72 C
ATOM 10613 CD1 LEU D 131 -18.556 26.535 37.275 1.00 30.12 C
ATOM 10614 CD2 LEU D 131 -19.706 24.888 38.738 1.00 27.66 C
ATOM 10615 N THR D 132 -23.702 28.528 38.098 1.00 33.18 N
ATOM 10616 CA THR D 132 -24.449 29.652 38.637 1.00 30.29 C
ATOM 10617 C THR D 132 -25.967 29.446 38.626 1.00 30.58 C
ATOM 10618 O THR D 132 -26.713 30.315 39.074 1.00 33.45 O
ATOM 10619 CB THR D 132 -24.172 30.919 37.828 1.00 29.18 C
ATOM 10620 OG1 THR D 132 -24.703 30.756 36.515 1.00 30.29 O
ATOM 10621 CG2 THR D 132 -22.694 31.176 37.707 1.00 28.04 C
ATOM 10622 N GLY D 133 -26.434 28.313 38.120 1.00 28.14 N
ATOM 10623 CA GLY D 133 -27.864 28.102 38.044 1.00 25.83 C
ATOM 10624 C GLY D 133 -28.586 27.225 39.044 1.00 27.47 C
ATOM 10625 O GLY D 133 -29.669 26.725 38.746 1.00 28.07 O
ATOM 10626 N TYR D 134 -28.032 27.016 40.231 1.00 29.55 N
ATOM 10627 CA TYR D 134 -28.753 26.188 41.184 1.00 29.65 C
ATOM 10628 C TYR D 134 -29.980 26.936 41.731 1.00 30.98 C
ATOM 10629 O TYR D 134 -29.963 28.166 41.871 1.00 28.31 O
ATOM 10630 CB TYR D 134 -27.841 25.783 42.330 1.00 29.08 C
ATOM 10631 CG TYR D 134 -26.843 24.700 41.994 1.00 31.44 C
ATOM 10632 CD1 TYR D 134 -25.591 25.008 41.428 1.00 31.62 C
ATOM 10633 CD2 TYR D 134 -27.123 23.360 42.295 1.00 31.32 C
ATOM 10634 CE1 TYR D 134 -24.636 23.994 41.179 1.00 27.73 C
ATOM 10635 CE2 TYR D 134 -26.186 22.358 42.053 1.00 30.76 C
ATOM 10636 CZ TYR D 134 -24.947 22.683 41.503 1.00 28.75 C
ATOM 10637 OH TYR D 134 -24.030 21.685 41.327 1.00 28.42 O
ATOM 10638 N CYS D 135 -31.039 26.186 42.034 1.00 32.46 N
ATOM 10639 CA CYS D 135 -32.268 26.763 42.562 1.00 34.17 C
ATOM 10640 C CYS D 135 -33.185 25.672 43.102 1.00 36.85 C
ATOM 10641 O CYS D 135 -32.929 24.485 42.905 1.00 38.31 O
ATOM 10642 CB CYS D 135 -32.985 27.557 41.470 1.00 33.58 C
ATOM 10643 SG CYS D 135 -33.785 26.573 40.204 1.00 35.06 S
ATOM 10644 N ASP D 136 -34.263 26.066 43.781 1.00 39.83 N
ATOM 10645 CA ASP D 136 -35.189 25.087 44.354 1.00 39.89 C
ATOM 10646 C ASP D 136 -36.046 24.410 43.290 1.00 39.05 C
ATOM 10647 O ASP D 136 -36.398 25.004 42.266 1.00 38.34 O
ATOM 10648 CB ASP D 136 -36.089 25.744 45.406 1.00 42.98 C
ATOM 10649 CG ASP D 136 -35.299 26.329 46.576 1.00 48.18 C
ATOM 10650 OD1 ASP D 136 -34.431 25.620 47.140 1.00 49.87 O
ATOM 10651 OD2 ASP D 136 -35.553 27.502 46.938 1.00 52.14 O
ATOM 10652 N PRO D 137 -36.394 23.144 43.512 1.00 38.06 N
ATOM 10653 CA PRO D 137 -37.212 22.487 42.500 1.00 37.90 C
ATOM 10654 C PRO D 137 -38.576 23.142 42.328 1.00 39.34 C
ATOM 10655 O PRO D 137 -39.136 23.713 43.265 1.00 39.10 O
ATOM 10656 CB PRO D 137 -37.311 21.055 43.025 1.00 36.78 C
ATOM 10657 CG PRO D 137 -37.209 21.220 44.488 1.00 34.22 C
ATOM 10658 CD PRO D 137 -36.115 22.231 44.632 1.00 37.17 C
ATOM 10659 N PRO D 138 -39.131 23.066 41.114 1.00 40.94 N
ATOM 10660 CA PRO D 138 -40.444 23.639 40.807 1.00 40.43 C
ATOM 10661 C PRO D 138 -41.537 22.746 41.416 1.00 39.50 C
ATOM 10662 O PRO D 138 -41.308 21.569 41.708 1.00 40.66 O
ATOM 10663 CB PRO D 138 -40.460 23.619 39.296 1.00 40.34 C
ATOM 10664 CG PRO D 138 -39.777 22.310 39.018 1.00 41.25 C
ATOM 10665 CD PRO D 138 -38.576 22.383 39.935 1.00 41.37 C
ATOM 10666 N ALA D 139 -42.723 23.307 41.599 1.00 38.34 N
ATOM 10667 CA ALA D 139 -43.823 22.563 42.192 1.00 38.10 C
ATOM 10668 C ALA D 139 -44.062 21.215 41.533 1.00 38.61 C
ATOM 10669 O ALA D 139 -44.140 21.105 40.303 1.00 39.75 O
ATOM 10670 CB ALA D 139 -45.096 23.401 42.140 1.00 37.66 C
ATOM 10671 N GLY D 140 -44.180 20.188 42.360 1.00 38.13 N
ATOM 10672 CA GLY D 140 -44.442 18.860 41.842 1.00 39.26 C
ATOM 10673 C GLY D 140 -43.210 18.032 41.580 1.00 39.38 C
ATOM 10674 O GLY D 140 -43.316 16.881 41.151 1.00 39.38 O
ATOM 10675 N VAL D 141 -42.047 18.608 41.848 1.00 39.42 N
ATOM 10676 CA VAL D 141 -40.789 17.918 41.618 1.00 41.22 C
ATOM 10677 C VAL D 141 -40.023 17.742 42.908 1.00 43.32 C
ATOM 10678 O VAL D 141 -39.771 18.717 43.610 1.00 43.99 O
ATOM 10679 CB VAL D 141 -39.908 18.720 40.626 1.00 40.54 C
ATOM 10680 CG1 VAL D 141 -38.485 18.180 40.612 1.00 36.67 C
ATOM 10681 CG2 VAL D 141 -40.509 18.657 39.245 1.00 36.70 C
ATOM 10682 N VAL D 142 -39.650 16.509 43.231 1.00 45.11 N
ATOM 10683 CA VAL D 142 -38.875 16.289 44.448 1.00 48.80 C
ATOM 10684 C VAL D 142 -37.542 15.642 44.118 1.00 49.18 C
ATOM 10685 O VAL D 142 -37.469 14.674 43.367 1.00 48.88 O
ATOM 10686 CB VAL D 142 -39.620 15.407 45.488 1.00 50.02 C
ATOM 10687 CG1 VAL D 142 -40.980 16.018 45.793 1.00 52.38 C
ATOM 10688 CG2 VAL D 142 -39.763 13.977 44.982 1.00 51.28 C
ATOM 10689 N VAL D 143 -36.486 16.205 44.683 1.00 50.71 N
ATOM 10690 CA VAL D 143 -35.131 15.720 44.475 1.00 52.59 C
ATOM 10691 C VAL D 143 -34.805 14.693 45.568 1.00 53.80 C
ATOM 10692 O VAL D 143 -35.055 14.951 46.745 1.00 53.69 O
ATOM 10693 CB VAL D 143 -34.154 16.917 44.543 1.00 52.16 C
ATOM 10694 CG1 VAL D 143 -32.725 16.455 44.463 1.00 52.35 C
ATOM 10695 CG2 VAL D 143 -34.465 17.887 43.409 1.00 52.94 C
ATOM 10696 N ARG D 144 -34.255 13.533 45.196 1.00 54.19 N
ATOM 10697 CA ARG D 144 -33.932 12.532 46.206 1.00 54.70 C
ATOM 10698 C ARG D 144 -32.770 13.004 47.054 1.00 54.04 C
ATOM 10699 O ARG D 144 -31.978 13.849 46.637 1.00 53.39 O
ATOM 10700 CB ARG D 144 -33.613 11.168 45.579 1.00 57.20 C
ATOM 10701 CG ARG D 144 -32.184 10.963 45.156 1.00 62.13 C
ATOM 10702 CD ARG D 144 -31.940 9.497 44.778 1.00 66.18 C
ATOM 10703 NE ARG D 144 -30.589 9.259 44.249 1.00 70.48 N
ATOM 10704 CZ ARG D 144 -29.464 9.323 44.966 1.00 72.25 C
ATOM 10705 NH1 ARG D 144 -29.507 9.617 46.265 1.00 71.82 N
ATOM 10706 NH2 ARG D 144 -28.292 9.102 44.378 1.00 72.51 N
ATOM 10707 N GLU D 145 -32.680 12.459 48.258 1.00 54.95 N
ATOM 10708 CA GLU D 145 -31.632 12.838 49.190 1.00 55.96 C
ATOM 10709 C GLU D 145 -30.215 12.662 48.656 1.00 53.69 C
ATOM 10710 O GLU D 145 -29.843 11.590 48.173 1.00 55.06 O
ATOM 10711 CB GLU D 145 -31.782 12.057 50.489 1.00 58.59 C
ATOM 10712 CG GLU D 145 -30.636 12.300 51.427 1.00 65.63 C
ATOM 10713 CD GLU D 145 -30.990 12.000 52.859 1.00 70.64 C
ATOM 10714 OE1 GLU D 145 -31.400 10.843 53.144 1.00 72.08 O
ATOM 10715 OE2 GLU D 145 -30.854 12.933 53.693 1.00 73.46 O
ATOM 10716 N GLY D 146 -29.419 13.717 48.750 1.00 49.17 N
ATOM 10717 CA GLY D 146 -28.063 13.625 48.262 1.00 46.74 C
ATOM 10718 C GLY D 146 -27.906 14.385 46.970 1.00 46.00 C
ATOM 10719 O GLY D 146 -26.797 14.826 46.634 1.00 48.37 O
ATOM 10720 N LEU D 147 -29.006 14.551 46.240 1.00 42.75 N
ATOM 10721 CA LEU D 147 -28.957 15.280 44.982 1.00 40.04 C
ATOM 10722 C LEU D 147 -29.411 16.717 45.192 1.00 39.73 C
ATOM 10723 O LEU D 147 -30.017 17.046 46.219 1.00 39.78 O
ATOM 10724 CB LEU D 147 -29.828 14.590 43.928 1.00 38.99 C
ATOM 10725 CG LEU D 147 -29.385 13.165 43.579 1.00 38.04 C
ATOM 10726 CD1 LEU D 147 -30.340 12.506 42.612 1.00 34.19 C
ATOM 10727 CD2 LEU D 147 -28.003 13.231 42.996 1.00 37.28 C
ATOM 10728 N HIS D 148 -29.100 17.577 44.224 1.00 36.31 N
ATOM 10729 CA HIS D 148 -29.471 18.980 44.299 1.00 33.71 C
ATOM 10730 C HIS D 148 -30.144 19.411 43.010 1.00 34.49 C
ATOM 10731 O HIS D 148 -29.750 19.006 41.908 1.00 37.53 O
ATOM 10732 CB HIS D 148 -28.242 19.840 44.524 1.00 32.46 C
ATOM 10733 CG HIS D 148 -27.439 19.433 45.715 1.00 33.58 C
ATOM 10734 ND1 HIS D 148 -27.172 20.289 46.757 1.00 33.59 N
ATOM 10735 CD2 HIS D 148 -26.852 18.255 46.032 1.00 33.79 C
ATOM 10736 CE1 HIS D 148 -26.457 19.655 47.670 1.00 31.94 C
ATOM 10737 NE2 HIS D 148 -26.250 18.418 47.254 1.00 32.28 N
ATOM 10738 N TYR D 149 -31.164 20.244 43.132 1.00 32.61 N
ATOM 10739 CA TYR D 149 -31.861 20.680 41.956 1.00 28.68 C
ATOM 10740 C TYR D 149 -31.013 21.653 41.157 1.00 30.06 C
ATOM 10741 O TYR D 149 -30.408 22.597 41.708 1.00 30.64 O
ATOM 10742 CB TYR D 149 -33.187 21.345 42.312 1.00 27.08 C
ATOM 10743 CG TYR D 149 -34.005 21.596 41.087 1.00 26.41 C
ATOM 10744 CD1 TYR D 149 -34.719 20.568 40.501 1.00 24.99 C
ATOM 10745 CD2 TYR D 149 -33.969 22.831 40.428 1.00 26.32 C
ATOM 10746 CE1 TYR D 149 -35.374 20.746 39.293 1.00 25.22 C
ATOM 10747 CE2 TYR D 149 -34.634 23.017 39.197 1.00 25.06 C
ATOM 10748 CZ TYR D 149 -35.332 21.964 38.647 1.00 25.20 C
ATOM 10749 OH TYR D 149 -36.036 22.103 37.466 1.00 29.54 O
ATOM 10750 N ASN D 150 -30.950 21.390 39.855 1.00 27.86 N
ATOM 10751 CA ASN D 150 -30.240 22.249 38.931 1.00 29.37 C
ATOM 10752 C ASN D 150 -30.958 22.079 37.613 1.00 29.75 C
ATOM 10753 O ASN D 150 -30.925 21.011 37.001 1.00 32.29 O
ATOM 10754 CB ASN D 150 -28.763 21.867 38.791 1.00 28.31 C
ATOM 10755 CG ASN D 150 -27.956 22.970 38.139 1.00 29.29 C
ATOM 10756 OD1 ASN D 150 -28.209 23.356 36.989 1.00 29.75 O
ATOM 10757 ND2 ASN D 150 -27.001 23.510 38.877 1.00 28.19 N
ATOM 10758 N PRO D 151 -31.622 23.137 37.153 1.00 29.33 N
ATOM 10759 CA PRO D 151 -32.360 23.060 35.893 1.00 30.03 C
ATOM 10760 C PRO D 151 -31.496 22.813 34.661 1.00 30.83 C
ATOM 10761 O PRO D 151 -31.988 22.312 33.652 1.00 34.45 O
ATOM 10762 CB PRO D 151 -33.091 24.398 35.854 1.00 29.24 C
ATOM 10763 CG PRO D 151 -32.096 25.307 36.474 1.00 29.95 C
ATOM 10764 CD PRO D 151 -31.593 24.514 37.669 1.00 26.68 C
ATOM 10765 N TYR D 152 -30.212 23.148 34.739 1.00 29.64 N
ATOM 10766 CA TYR D 152 -29.321 22.958 33.602 1.00 27.27 C
ATOM 10767 C TYR D 152 -28.769 21.527 33.444 1.00 26.79 C
ATOM 10768 O TYR D 152 -28.403 21.098 32.352 1.00 25.28 O
ATOM 10769 CB TYR D 152 -28.198 23.986 33.674 1.00 25.40 C
ATOM 10770 CG TYR D 152 -28.656 25.338 33.209 1.00 26.76 C
ATOM 10771 CD1 TYR D 152 -28.948 25.563 31.857 1.00 25.85 C
ATOM 10772 CD2 TYR D 152 -28.885 26.378 34.122 1.00 25.44 C
ATOM 10773 CE1 TYR D 152 -29.461 26.786 31.423 1.00 26.12 C
ATOM 10774 CE2 TYR D 152 -29.399 27.601 33.700 1.00 24.83 C
ATOM 10775 CZ TYR D 152 -29.683 27.800 32.353 1.00 27.04 C
ATOM 10776 OH TYR D 152 -30.181 29.007 31.931 1.00 30.82 O
ATOM 10777 N PHE D 153 -28.738 20.780 34.529 1.00 27.41 N
ATOM 10778 CA PHE D 153 -28.251 19.418 34.465 1.00 29.64 C
ATOM 10779 C PHE D 153 -29.337 18.521 33.912 1.00 30.32 C
ATOM 10780 O PHE D 153 -30.505 18.661 34.269 1.00 30.77 O
ATOM 10781 CB PHE D 153 -27.895 18.932 35.857 1.00 30.54 C
ATOM 10782 CG PHE D 153 -27.226 17.600 35.875 1.00 30.90 C
ATOM 10783 CD1 PHE D 153 -25.908 17.462 35.434 1.00 32.24 C
ATOM 10784 CD2 PHE D 153 -27.874 16.498 36.411 1.00 28.97 C
ATOM 10785 CE1 PHE D 153 -25.245 16.245 35.548 1.00 28.07 C
ATOM 10786 CE2 PHE D 153 -27.224 15.288 36.522 1.00 27.41 C
ATOM 10787 CZ PHE D 153 -25.906 15.163 36.094 1.00 27.96 C
ATOM 10788 N PRO D 154 -28.979 17.586 33.020 1.00 31.95 N
ATOM 10789 CA PRO D 154 -30.043 16.721 32.500 1.00 30.56 C
ATOM 10790 C PRO D 154 -30.677 15.927 33.628 1.00 29.58 C
ATOM 10791 O PRO D 154 -29.978 15.370 34.479 1.00 30.52 O
ATOM 10792 CB PRO D 154 -29.321 15.860 31.455 1.00 26.91 C
ATOM 10793 CG PRO D 154 -27.914 15.893 31.866 1.00 29.81 C
ATOM 10794 CD PRO D 154 -27.710 17.321 32.323 1.00 32.07 C
ATOM 10795 N GLY D 155 -32.007 15.905 33.644 1.00 28.98 N
ATOM 10796 CA GLY D 155 -32.720 15.198 34.687 1.00 30.02 C
ATOM 10797 C GLY D 155 -32.963 16.152 35.830 1.00 32.48 C
ATOM 10798 O GLY D 155 -33.868 15.940 36.648 1.00 33.85 O
ATOM 10799 N GLN D 156 -32.138 17.201 35.869 1.00 33.21 N
ATOM 10800 CA GLN D 156 -32.173 18.282 36.861 1.00 33.03 C
ATOM 10801 C GLN D 156 -31.723 17.976 38.296 1.00 33.82 C
ATOM 10802 O GLN D 156 -31.650 18.890 39.120 1.00 35.86 O
ATOM 10803 CB GLN D 156 -33.560 18.925 36.897 1.00 33.36 C
ATOM 10804 CG GLN D 156 -33.974 19.637 35.609 1.00 33.58 C
ATOM 10805 CD GLN D 156 -34.473 18.688 34.502 1.00 35.94 C
ATOM 10806 OE1 GLN D 156 -35.405 17.892 34.691 1.00 32.58 O
ATOM 10807 NE2 GLN D 156 -33.855 18.791 33.332 1.00 40.55 N
ATOM 10808 N ALA D 157 -31.414 16.717 38.603 1.00 32.83 N
ATOM 10809 CA ALA D 157 -30.949 16.361 39.947 1.00 31.47 C
ATOM 10810 C ALA D 157 -29.472 15.955 39.871 1.00 32.55 C
ATOM 10811 O ALA D 157 -29.141 14.835 39.473 1.00 33.96 O
ATOM 10812 CB ALA D 157 -31.780 15.225 40.501 1.00 28.79 C
ATOM 10813 N ILE D 158 -28.583 16.862 40.262 1.00 32.14 N
ATOM 10814 CA ILE D 158 -27.154 16.601 40.196 1.00 31.68 C
ATOM 10815 C ILE D 158 -26.567 16.165 41.523 1.00 33.40 C
ATOM 10816 O ILE D 158 -27.090 16.505 42.586 1.00 37.51 O
ATOM 10817 CB ILE D 158 -26.422 17.856 39.717 1.00 32.39 C
ATOM 10818 CG1 ILE D 158 -25.083 17.486 39.101 1.00 32.35 C
ATOM 10819 CG2 ILE D 158 -26.205 18.817 40.881 1.00 33.30 C
ATOM 10820 CD1 ILE D 158 -24.404 18.667 38.447 1.00 33.52 C
ATOM 10821 N GLY D 159 -25.472 15.414 41.464 1.00 32.94 N
ATOM 10822 CA GLY D 159 -24.826 14.949 42.677 1.00 31.48 C
ATOM 10823 C GLY D 159 -23.760 15.920 43.157 1.00 31.22 C
ATOM 10824 O GLY D 159 -23.033 15.644 44.105 1.00 32.49 O
ATOM 10825 N MET D 160 -23.632 17.054 42.495 1.00 29.62 N
ATOM 10826 CA MET D 160 -22.648 18.017 42.947 1.00 31.86 C
ATOM 10827 C MET D 160 -23.331 19.225 43.633 1.00 32.85 C
ATOM 10828 O MET D 160 -24.135 19.939 43.019 1.00 31.79 O
ATOM 10829 CB MET D 160 -21.789 18.506 41.775 1.00 29.50 C
ATOM 10830 CG MET D 160 -20.831 19.638 42.153 1.00 27.72 C
ATOM 10831 SD MET D 160 -19.777 20.251 40.819 1.00 31.48 S
ATOM 10832 CE MET D 160 -21.019 20.747 39.636 1.00 22.89 C
ATOM 10833 N ALA D 161 -23.016 19.434 44.911 1.00 32.21 N
ATOM 10834 CA ALA D 161 -23.563 20.573 45.643 1.00 31.17 C
ATOM 10835 C ALA D 161 -22.925 21.823 45.044 1.00 31.81 C
ATOM 10836 O ALA D 161 -21.809 21.775 44.513 1.00 32.35 O
ATOM 10837 CB ALA D 161 -23.206 20.475 47.109 1.00 27.03 C
ATOM 10838 N PRO D 162 -23.624 22.961 45.107 1.00 31.47 N
ATOM 10839 CA PRO D 162 -23.037 24.183 44.544 1.00 31.55 C
ATOM 10840 C PRO D 162 -21.595 24.344 45.046 1.00 31.35 C
ATOM 10841 O PRO D 162 -21.351 24.561 46.229 1.00 33.05 O
ATOM 10842 CB PRO D 162 -23.977 25.266 45.049 1.00 28.64 C
ATOM 10843 CG PRO D 162 -25.268 24.572 45.064 1.00 27.65 C
ATOM 10844 CD PRO D 162 -24.982 23.205 45.610 1.00 27.86 C
ATOM 10845 N PRO D 163 -20.623 24.220 44.144 1.00 30.82 N
ATOM 10846 CA PRO D 163 -19.211 24.339 44.494 1.00 30.06 C
ATOM 10847 C PRO D 163 -18.691 25.727 44.800 1.00 31.00 C
ATOM 10848 O PRO D 163 -17.733 25.873 45.563 1.00 32.26 O
ATOM 10849 CB PRO D 163 -18.507 23.720 43.285 1.00 29.74 C
ATOM 10850 CG PRO D 163 -19.397 24.132 42.144 1.00 30.04 C
ATOM 10851 CD PRO D 163 -20.787 23.861 42.720 1.00 32.07 C
ATOM 10852 N ILE D 164 -19.293 26.750 44.213 1.00 31.72 N
ATOM 10853 CA ILE D 164 -18.785 28.087 44.467 1.00 34.66 C
ATOM 10854 C ILE D 164 -19.806 29.121 44.904 1.00 36.66 C
ATOM 10855 O ILE D 164 -20.946 29.139 44.425 1.00 39.24 O
ATOM 10856 CB ILE D 164 -18.041 28.656 43.229 1.00 34.10 C
ATOM 10857 CG1 ILE D 164 -18.945 28.608 41.994 1.00 33.47 C
ATOM 10858 CG2 ILE D 164 -16.769 27.882 42.989 1.00 35.11 C
ATOM 10859 CD1 ILE D 164 -18.321 29.270 40.777 1.00 31.20 C
ATOM 10860 N TYR D 165 -19.371 29.989 45.816 1.00 36.81 N
ATOM 10861 CA TYR D 165 -20.192 31.084 46.337 1.00 35.53 C
ATOM 10862 C TYR D 165 -19.289 32.298 46.524 1.00 35.92 C
ATOM 10863 O TYR D 165 -18.071 32.158 46.457 1.00 36.56 O
ATOM 10864 CB TYR D 165 -20.815 30.686 47.664 1.00 28.93 C
ATOM 10865 CG TYR D 165 -19.869 29.976 48.596 1.00 28.01 C
ATOM 10866 CD1 TYR D 165 -19.791 28.578 48.614 1.00 27.51 C
ATOM 10867 CD2 TYR D 165 -19.083 30.686 49.493 1.00 23.66 C
ATOM 10868 CE1 TYR D 165 -18.965 27.908 49.511 1.00 22.16 C
ATOM 10869 CE2 TYR D 165 -18.257 30.029 50.380 1.00 22.87 C
ATOM 10870 CZ TYR D 165 -18.201 28.643 50.390 1.00 24.52 C
ATOM 10871 OH TYR D 165 -17.360 27.994 51.288 1.00 27.99 O
ATOM 10872 N ASN D 166 -19.868 33.478 46.747 1.00 37.60 N
ATOM 10873 CA ASN D 166 -19.062 34.692 46.934 1.00 36.83 C
ATOM 10874 C ASN D 166 -17.930 34.524 47.929 1.00 36.40 C
ATOM 10875 O ASN D 166 -18.088 33.906 48.976 1.00 33.32 O
ATOM 10876 CB ASN D 166 -19.916 35.858 47.406 1.00 37.62 C
ATOM 10877 CG ASN D 166 -20.849 36.362 46.339 1.00 41.72 C
ATOM 10878 OD1 ASN D 166 -20.489 36.422 45.165 1.00 44.44 O
ATOM 10879 ND2 ASN D 166 -22.054 36.746 46.739 1.00 42.52 N
ATOM 10880 N GLU D 167 -16.777 35.084 47.577 1.00 38.39 N
ATOM 10881 CA GLU D 167 -15.590 35.053 48.435 1.00 38.93 C
ATOM 10882 C GLU D 167 -15.187 33.689 48.978 1.00 37.00 C
ATOM 10883 O GLU D 167 -14.566 33.619 50.035 1.00 37.95 O
ATOM 10884 CB GLU D 167 -15.776 35.994 49.624 1.00 41.27 C
ATOM 10885 CG GLU D 167 -16.089 37.439 49.255 1.00 46.52 C
ATOM 10886 CD GLU D 167 -16.339 38.311 50.487 1.00 49.80 C
ATOM 10887 OE1 GLU D 167 -17.179 37.924 51.339 1.00 52.54 O
ATOM 10888 OE2 GLU D 167 -15.700 39.382 50.597 1.00 49.50 O
ATOM 10889 N ILE D 168 -15.518 32.615 48.272 1.00 34.10 N
ATOM 10890 CA ILE D 168 -15.150 31.290 48.731 1.00 30.99 C
ATOM 10891 C ILE D 168 -13.648 31.201 48.643 1.00 32.60 C
ATOM 10892 O ILE D 168 -13.041 30.230 49.106 1.00 34.42 O
ATOM 10893 CB ILE D 168 -15.786 30.175 47.873 1.00 29.15 C
ATOM 10894 CG1 ILE D 168 -15.379 28.813 48.432 1.00 27.69 C
ATOM 10895 CG2 ILE D 168 -15.381 30.320 46.418 1.00 25.23 C
ATOM 10896 CD1 ILE D 168 -15.997 27.651 47.683 1.00 29.68 C
ATOM 10897 N LEU D 169 -13.046 32.224 48.039 1.00 32.25 N
ATOM 10898 CA LEU D 169 -11.594 32.297 47.916 1.00 33.45 C
ATOM 10899 C LEU D 169 -11.207 33.736 47.590 1.00 34.51 C
ATOM 10900 O LEU D 169 -12.067 34.554 47.299 1.00 34.80 O
ATOM 10901 CB LEU D 169 -11.098 31.345 46.815 1.00 34.26 C
ATOM 10902 CG LEU D 169 -10.766 31.892 45.418 1.00 36.02 C
ATOM 10903 CD1 LEU D 169 -10.189 30.783 44.584 1.00 35.99 C
ATOM 10904 CD2 LEU D 169 -11.996 32.482 44.741 1.00 36.93 C
ATOM 10905 N GLU D 170 -9.919 34.048 47.651 1.00 37.95 N
ATOM 10906 CA GLU D 170 -9.435 35.382 47.323 1.00 41.53 C
ATOM 10907 C GLU D 170 -8.420 35.349 46.167 1.00 43.23 C
ATOM 10908 O GLU D 170 -7.377 34.696 46.249 1.00 43.74 O
ATOM 10909 CB GLU D 170 -8.810 36.034 48.556 1.00 44.05 C
ATOM 10910 CG GLU D 170 -9.833 36.299 49.662 1.00 53.22 C
ATOM 10911 CD GLU D 170 -9.282 37.103 50.846 1.00 57.57 C
ATOM 10912 OE1 GLU D 170 -8.415 36.574 51.586 1.00 59.46 O
ATOM 10913 OE2 GLU D 170 -9.726 38.268 51.032 1.00 59.89 O
ATOM 10914 N TYR D 171 -8.737 36.033 45.078 1.00 43.61 N
ATOM 10915 CA TYR D 171 -7.822 36.088 43.949 1.00 44.20 C
ATOM 10916 C TYR D 171 -6.636 36.935 44.370 1.00 47.33 C
ATOM 10917 O TYR D 171 -6.817 38.090 44.781 1.00 48.48 O
ATOM 10918 CB TYR D 171 -8.482 36.767 42.764 1.00 41.16 C
ATOM 10919 CG TYR D 171 -9.488 35.923 42.042 1.00 37.72 C
ATOM 10920 CD1 TYR D 171 -10.723 36.450 41.692 1.00 36.35 C
ATOM 10921 CD2 TYR D 171 -9.191 34.617 41.670 1.00 34.65 C
ATOM 10922 CE1 TYR D 171 -11.632 35.708 40.992 1.00 39.37 C
ATOM 10923 CE2 TYR D 171 -10.093 33.860 40.966 1.00 35.81 C
ATOM 10924 CZ TYR D 171 -11.318 34.408 40.627 1.00 37.10 C
ATOM 10925 OH TYR D 171 -12.241 33.679 39.920 1.00 38.67 O
ATOM 10926 N ASP D 172 -5.422 36.406 44.259 1.00 48.16 N
ATOM 10927 CA ASP D 172 -4.303 37.221 44.667 1.00 50.47 C
ATOM 10928 C ASP D 172 -4.000 38.399 43.750 1.00 49.21 C
ATOM 10929 O ASP D 172 -3.026 39.116 43.952 1.00 50.19 O
ATOM 10930 CB ASP D 172 -3.052 36.367 44.910 1.00 55.76 C
ATOM 10931 CG ASP D 172 -2.890 35.245 43.918 1.00 59.08 C
ATOM 10932 OD1 ASP D 172 -2.603 35.532 42.729 1.00 62.69 O
ATOM 10933 OD2 ASP D 172 -3.033 34.071 44.345 1.00 60.94 O
ATOM 10934 N ASP D 173 -4.852 38.622 42.759 1.00 47.47 N
ATOM 10935 CA ASP D 173 -4.652 39.740 41.854 1.00 46.45 C
ATOM 10936 C ASP D 173 -5.679 40.790 42.223 1.00 46.30 C
ATOM 10937 O ASP D 173 -5.858 41.789 41.511 1.00 46.60 O
ATOM 10938 CB ASP D 173 -4.833 39.302 40.398 1.00 47.66 C
ATOM 10939 CG ASP D 173 -6.299 39.193 39.986 1.00 48.90 C
ATOM 10940 OD1 ASP D 173 -7.138 38.818 40.841 1.00 48.66 O
ATOM 10941 OD2 ASP D 173 -6.600 39.464 38.797 1.00 48.27 O
ATOM 10942 N GLY D 174 -6.372 40.540 43.334 1.00 44.06 N
ATOM 10943 CA GLY D 174 -7.369 41.477 43.823 1.00 42.69 C
ATOM 10944 C GLY D 174 -8.710 41.548 43.115 1.00 42.64 C
ATOM 10945 O GLY D 174 -9.538 42.395 43.447 1.00 44.80 O
ATOM 10946 N THR D 175 -8.956 40.683 42.143 1.00 40.46 N
ATOM 10947 CA THR D 175 -10.245 40.734 41.474 1.00 38.25 C
ATOM 10948 C THR D 175 -11.351 40.376 42.478 1.00 36.72 C
ATOM 10949 O THR D 175 -11.197 39.477 43.295 1.00 35.15 O
ATOM 10950 CB THR D 175 -10.278 39.766 40.278 1.00 37.98 C
ATOM 10951 OG1 THR D 175 -9.303 40.176 39.313 1.00 35.94 O
ATOM 10952 CG2 THR D 175 -11.662 39.757 39.634 1.00 38.38 C
ATOM 10953 N PRO D 176 -12.469 41.112 42.453 1.00 36.35 N
ATOM 10954 CA PRO D 176 -13.564 40.817 43.383 1.00 35.93 C
ATOM 10955 C PRO D 176 -14.118 39.397 43.176 1.00 36.68 C
ATOM 10956 O PRO D 176 -14.825 39.127 42.206 1.00 39.77 O
ATOM 10957 CB PRO D 176 -14.587 41.901 43.055 1.00 32.30 C
ATOM 10958 CG PRO D 176 -13.720 43.047 42.673 1.00 32.24 C
ATOM 10959 CD PRO D 176 -12.684 42.407 41.786 1.00 35.50 C
ATOM 10960 N ALA D 177 -13.799 38.495 44.096 1.00 35.13 N
ATOM 10961 CA ALA D 177 -14.255 37.122 44.006 1.00 33.44 C
ATOM 10962 C ALA D 177 -15.772 36.882 44.173 1.00 34.14 C
ATOM 10963 O ALA D 177 -16.223 36.327 45.186 1.00 33.58 O
ATOM 10964 CB ALA D 177 -13.476 36.272 44.994 1.00 30.61 C
ATOM 10965 N THR D 178 -16.562 37.285 43.178 1.00 34.99 N
ATOM 10966 CA THR D 178 -17.997 37.028 43.233 1.00 38.05 C
ATOM 10967 C THR D 178 -18.251 35.685 42.537 1.00 39.03 C
ATOM 10968 O THR D 178 -17.479 35.285 41.664 1.00 40.47 O
ATOM 10969 CB THR D 178 -18.814 38.136 42.543 1.00 39.38 C
ATOM 10970 OG1 THR D 178 -18.258 38.422 41.255 1.00 42.83 O
ATOM 10971 CG2 THR D 178 -18.801 39.403 43.388 1.00 40.59 C
ATOM 10972 N MET D 179 -19.321 34.989 42.929 1.00 38.61 N
ATOM 10973 CA MET D 179 -19.652 33.680 42.357 1.00 35.42 C
ATOM 10974 C MET D 179 -19.554 33.640 40.847 1.00 36.35 C
ATOM 10975 O MET D 179 -18.839 32.814 40.296 1.00 37.77 O
ATOM 10976 CB MET D 179 -21.056 33.253 42.760 1.00 33.77 C
ATOM 10977 CG MET D 179 -21.337 31.794 42.488 1.00 31.88 C
ATOM 10978 SD MET D 179 -23.095 31.403 42.314 1.00 33.81 S
ATOM 10979 CE MET D 179 -23.368 30.395 43.835 1.00 32.25 C
ATOM 10980 N SER D 180 -20.275 34.532 40.174 1.00 36.34 N
ATOM 10981 CA SER D 180 -20.255 34.561 38.723 1.00 35.16 C
ATOM 10982 C SER D 180 -18.855 34.877 38.188 1.00 34.87 C
ATOM 10983 O SER D 180 -18.439 34.330 37.173 1.00 35.60 O
ATOM 10984 CB SER D 180 -21.283 35.568 38.188 1.00 34.04 C
ATOM 10985 OG SER D 180 -20.892 36.902 38.450 1.00 33.46 O
ATOM 10986 N GLN D 181 -18.131 35.757 38.862 1.00 33.72 N
ATOM 10987 CA GLN D 181 -16.779 36.086 38.425 1.00 34.18 C
ATOM 10988 C GLN D 181 -15.899 34.824 38.438 1.00 34.86 C
ATOM 10989 O GLN D 181 -15.092 34.596 37.518 1.00 33.26 O
ATOM 10990 CB GLN D 181 -16.159 37.112 39.365 1.00 33.61 C
ATOM 10991 CG GLN D 181 -14.680 37.361 39.127 1.00 33.47 C
ATOM 10992 CD GLN D 181 -14.413 37.924 37.746 1.00 35.62 C
ATOM 10993 OE1 GLN D 181 -15.025 38.917 37.326 1.00 36.43 O
ATOM 10994 NE2 GLN D 181 -13.495 37.296 37.027 1.00 35.22 N
ATOM 10995 N ILE D 182 -16.065 34.025 39.495 1.00 33.59 N
ATOM 10996 CA ILE D 182 -15.309 32.800 39.700 1.00 32.79 C
ATOM 10997 C ILE D 182 -15.661 31.757 38.663 1.00 33.27 C
ATOM 10998 O ILE D 182 -14.778 31.103 38.115 1.00 33.89 O
ATOM 10999 CB ILE D 182 -15.558 32.235 41.111 1.00 35.02 C
ATOM 11000 CG1 ILE D 182 -14.866 33.133 42.153 1.00 36.29 C
ATOM 11001 CG2 ILE D 182 -15.062 30.784 41.213 1.00 34.86 C
ATOM 11002 CD1 ILE D 182 -15.072 32.696 43.599 1.00 34.28 C
ATOM 11003 N ALA D 183 -16.949 31.608 38.385 1.00 32.49 N
ATOM 11004 CA ALA D 183 -17.396 30.649 37.394 1.00 33.15 C
ATOM 11005 C ALA D 183 -16.817 31.018 36.037 1.00 33.69 C
ATOM 11006 O ALA D 183 -16.254 30.180 35.343 1.00 33.95 O
ATOM 11007 CB ALA D 183 -18.909 30.647 37.324 1.00 33.06 C
ATOM 11008 N LYS D 184 -16.957 32.286 35.673 1.00 35.19 N
ATOM 11009 CA LYS D 184 -16.477 32.795 34.393 1.00 35.89 C
ATOM 11010 C LYS D 184 -14.993 32.514 34.230 1.00 36.97 C
ATOM 11011 O LYS D 184 -14.547 32.105 33.162 1.00 37.80 O
ATOM 11012 CB LYS D 184 -16.797 34.289 34.301 1.00 35.79 C
ATOM 11013 CG LYS D 184 -16.362 35.011 33.047 1.00 36.57 C
ATOM 11014 CD LYS D 184 -14.969 35.566 33.240 1.00 37.90 C
ATOM 11015 CE LYS D 184 -14.571 36.514 32.135 1.00 37.44 C
ATOM 11016 NZ LYS D 184 -13.096 36.798 32.224 1.00 39.18 N
ATOM 11017 N ASP D 185 -14.220 32.707 35.285 1.00 37.99 N
ATOM 11018 CA ASP D 185 -12.795 32.419 35.190 1.00 39.24 C
ATOM 11019 C ASP D 185 -12.508 30.917 35.050 1.00 37.18 C
ATOM 11020 O ASP D 185 -11.860 30.493 34.097 1.00 39.27 O
ATOM 11021 CB ASP D 185 -12.034 32.954 36.415 1.00 42.68 C
ATOM 11022 CG ASP D 185 -11.917 34.471 36.421 1.00 45.07 C
ATOM 11023 OD1 ASP D 185 -11.749 35.066 35.323 1.00 44.94 O
ATOM 11024 OD2 ASP D 185 -11.975 35.056 37.529 1.00 44.63 O
ATOM 11025 N VAL D 186 -12.982 30.109 35.991 1.00 34.09 N
ATOM 11026 CA VAL D 186 -12.717 28.676 35.926 1.00 31.22 C
ATOM 11027 C VAL D 186 -13.165 28.083 34.592 1.00 30.32 C
ATOM 11028 O VAL D 186 -12.563 27.126 34.093 1.00 27.39 O
ATOM 11029 CB VAL D 186 -13.393 27.897 37.099 1.00 31.02 C
ATOM 11030 CG1 VAL D 186 -14.893 27.813 36.902 1.00 30.28 C
ATOM 11031 CG2 VAL D 186 -12.785 26.490 37.207 1.00 30.22 C
ATOM 11032 N CYS D 187 -14.218 28.647 34.011 1.00 29.28 N
ATOM 11033 CA CYS D 187 -14.689 28.145 32.731 1.00 30.60 C
ATOM 11034 C CYS D 187 -13.670 28.489 31.655 1.00 30.00 C
ATOM 11035 O CYS D 187 -13.395 27.686 30.771 1.00 29.44 O
ATOM 11036 CB CYS D 187