PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2022-05-13
Number of transmembrane proteins: 7231 (alpha: 6680 , beta: 496 )
Content of 3l74
HEADER    OXIDOREDUCTASE                          28-DEC-09   3L74              
TITLE CYTOCHROME BC1 COMPLEX FROM CHICKEN WITH FAMOXADONE BOUND
COMPND MOL_ID: 1;
COMPND 2 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
COMPND 3 COMPLEX CORE PROTEIN I;
COMPND 4 CHAIN: A, N;
COMPND 5 EC: 1.10.2.2;
COMPND 6 MOL_ID: 2;
COMPND 7 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME-C REDUCTASE
COMPND 8 COMPLEX CORE PROTEIN 2;
COMPND 9 CHAIN: B, O;
COMPND 10 EC: 1.10.2.2;
COMPND 11 MOL_ID: 3;
COMPND 12 MOLECULE: CYTOCHROME B;
COMPND 13 CHAIN: C, P;
COMPND 14 SYNONYM: UBIQUINOL-CYTOCHROME-C REDUCTASE COMPLEX
COMPND 15 CYTOCHROME B SUBUNIT, CYTOCHROME B-C1 COMPLEX SUBUNIT 3,
COMPND 16 COMPLEX III SUBUNIT 3, COMPLEX III SUBUNIT III;
COMPND 17 EC: 1.10.2.2;
COMPND 18 MOL_ID: 4;
COMPND 19 MOLECULE: MITOCHONDRIAL CYTOCHROME C1, HEME PROTEIN;
COMPND 20 CHAIN: D, Q;
COMPND 21 EC: 1.10.2.2;
COMPND 22 MOL_ID: 5;
COMPND 23 MOLECULE: CYTOCHROME B-C1 COMPLEX SUBUNIT 5, RIESKE
COMPND 24 IRONSULFUR PROTEIN, MITOCHONDRIAL;
COMPND 25 CHAIN: E, R;
COMPND 26 FRAGMENT: UNP RESIDUES 77-272;
COMPND 27 SYNONYM: UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR
COMPND 28 SUBUNIT, RIESKE IRON-SULFUR PROTEIN, RISP, COMPLEX III
COMPND 29 SUBUNIT 5;
COMPND 30 EC: 1.10.2.2;
COMPND 31 MOL_ID: 6;
COMPND 32 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 14
COMPND 33 KDA PROTEIN;
COMPND 34 CHAIN: F, S;
COMPND 35 EC: 1.10.2.2;
COMPND 36 MOL_ID: 7;
COMPND 37 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE
COMPND 38 UBIQUINONE-BINDING PROTEIN QP-C;
COMPND 39 CHAIN: G, T;
COMPND 40 EC: 1.10.2.2;
COMPND 41 MOL_ID: 8;
COMPND 42 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE 11
COMPND 43 KDA PROTEIN, COMPLEX III SUBUNIT VIII;
COMPND 44 CHAIN: H, U;
COMPND 45 EC: 1.10.2.2;
COMPND 46 MOL_ID: 9;
COMPND 47 MOLECULE: CYTOCHROME B-C1 COMPLEX SUBUNIT RIESKE,
COMPND 48 MITOCHONDRIAL;
COMPND 49 CHAIN: I, V;
COMPND 50 FRAGMENT: UNP RESIDUES 45-76;
COMPND 51 SYNONYM: UBIQUINOL-CYTOCHROME C REDUCTASE IRON-SULFUR
COMPND 52 SUBUNIT, RIESKE IRON-SULFUR PROTEIN, RISP, COMPLEX III
COMPND 53 SUBUNIT 5;
COMPND 54 EC: 1.10.2.2;
COMPND 55 MOL_ID: 10;
COMPND 56 MOLECULE: MITOCHONDRIAL UBIQUINOL-CYTOCHROME C REDUCTASE
COMPND 57 7.2 KDA PROTEIN;
COMPND 58 CHAIN: J, W;
COMPND 59 EC: 1.10.2.2
SOURCE MOL_ID: 1;
SOURCE 2 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 3 ORGANISM_COMMON: CHICKEN;
SOURCE 4 ORGANISM_TAXID: 9031;
SOURCE 5 MOL_ID: 2;
SOURCE 6 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 7 ORGANISM_COMMON: CHICKEN;
SOURCE 8 ORGANISM_TAXID: 9031;
SOURCE 9 MOL_ID: 3;
SOURCE 10 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 11 ORGANISM_COMMON: CHICKEN;
SOURCE 12 ORGANISM_TAXID: 9031;
SOURCE 13 MOL_ID: 4;
SOURCE 14 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 15 ORGANISM_COMMON: CHICKEN;
SOURCE 16 ORGANISM_TAXID: 9031;
SOURCE 17 MOL_ID: 5;
SOURCE 18 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 19 ORGANISM_COMMON: CHICKEN;
SOURCE 20 ORGANISM_TAXID: 9031;
SOURCE 21 MOL_ID: 6;
SOURCE 22 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 23 ORGANISM_COMMON: CHICKEN;
SOURCE 24 ORGANISM_TAXID: 9031;
SOURCE 25 MOL_ID: 7;
SOURCE 26 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 27 ORGANISM_COMMON: CHICKEN;
SOURCE 28 ORGANISM_TAXID: 9031;
SOURCE 29 MOL_ID: 8;
SOURCE 30 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 31 ORGANISM_COMMON: CHICKEN;
SOURCE 32 ORGANISM_TAXID: 9031;
SOURCE 33 MOL_ID: 9;
SOURCE 34 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 35 ORGANISM_COMMON: CHICKEN;
SOURCE 36 ORGANISM_TAXID: 9031;
SOURCE 37 MOL_ID: 10;
SOURCE 38 ORGANISM_SCIENTIFIC: GALLUS GALLUS;
SOURCE 39 ORGANISM_COMMON: CHICKEN;
SOURCE 40 ORGANISM_TAXID: 9031
KEYWDS CYTOCHROME BC1, MEMBRANE PROTEIN, HEME PROTEIN, RIESKE IRON
KEYWDS 2 SULFUR PROTEIN, CYTOCHROME B, CYTOCHROME C1, COMPLEX III,
KEYWDS 3 MITOCHONDRIAL PROCESSING PROTEIN, UBIQUINONE, AZOXYSTROBIN
KEYWDS 4 OXIDOREDUCTASE, REDOX ENZYME RESPIRATORY CHAIN, ELECTRON
KEYWDS 5 TRANSPORT, HEME, INNER MEMBRANE, MEMBRANE, STROBILURINS
KEYWDS 6 BINDING, MITOCHONDRION, TRANSMEMBRANE, STIGMATELLIN, IRON,
KEYWDS 7 MITOCHONDRIAL INNER MEMBRANE, RESPIRATORY CHAIN, 2FE-2S,
KEYWDS 8 IRON-SULFUR, TRANSIT PEPTIDE, METAL-BINDING, MITOCHONDRION
KEYWDS 9 INNER MEMBRANE, TRANSPORT, DISULFIDE BOND
EXPDTA X-RAY DIFFRACTION
AUTHOR L.HUANG,E.A.BERRY
REVDAT 1 02-FEB-10 3L74 0
JRNL AUTH L.HUANG,E.A.BERRY
JRNL TITL FAMOXADONE AND RELATED INHIBITORS BIND LIKE METHOXY
JRNL TITL 2 ACRYLATE INHIBITORS IN THE QO SITE OF THE BC1 COMPL
JRNL TITL 3 AND FIX THE RIESKE IRON-SULFUR PROTEIN IN A POSITIO
JRNL TITL 4 CLOSE TO BUT DISTINCT FROM THAT SEEN WITH
JRNL TITL 5 STIGMATELLIN AND OTHER "DISTAL" QO INHIBITORS.
JRNL REF TO BE PUBLISHED
JRNL REFN
REMARK 2
REMARK 2 RESOLUTION. 2.76 ANGSTROMS.
REMARK 3
REMARK 3 REFINEMENT.
REMARK 3 PROGRAM : CNS 1.1
REMARK 3 AUTHORS : BRUNGER,ADAMS,CLORE,DELANO,GROS,GROSSE-
REMARK 3 : KUNSTLEVE,JIANG,KUSZEWSKI,NILGES, PANNU,
REMARK 3 : READ,RICE,SIMONSON,WARREN
REMARK 3
REMARK 3 REFINEMENT TARGET : ENGH & HUBER
REMARK 3
REMARK 3 DATA USED IN REFINEMENT.
REMARK 3 RESOLUTION RANGE HIGH (ANGSTROMS) : 2.76
REMARK 3 RESOLUTION RANGE LOW (ANGSTROMS) : 58.66
REMARK 3 DATA CUTOFF (SIGMA(F)) : 0.000
REMARK 3 DATA CUTOFF HIGH (ABS(F)) : 3668486.030
REMARK 3 DATA CUTOFF LOW (ABS(F)) : 0.0000
REMARK 3 COMPLETENESS (WORKING+TEST) (%) : 98.0
REMARK 3 NUMBER OF REFLECTIONS : 189275
REMARK 3
REMARK 3 FIT TO DATA USED IN REFINEMENT.
REMARK 3 CROSS-VALIDATION METHOD : THROUGHOUT
REMARK 3 FREE R VALUE TEST SET SELECTION : RANDOM
REMARK 3 R VALUE (WORKING SET) : 0.259
REMARK 3 FREE R VALUE : 0.286
REMARK 3 FREE R VALUE TEST SET SIZE (%) : 2.000
REMARK 3 FREE R VALUE TEST SET COUNT : 3693
REMARK 3 ESTIMATED ERROR OF FREE R VALUE : 0.005
REMARK 3
REMARK 3 FIT IN THE HIGHEST RESOLUTION BIN.
REMARK 3 TOTAL NUMBER OF BINS USED : 7
REMARK 3 BIN RESOLUTION RANGE HIGH (A) : 2.76
REMARK 3 BIN RESOLUTION RANGE LOW (A) : 2.91
REMARK 3 BIN COMPLETENESS (WORKING+TEST) (%) : 87.70
REMARK 3 REFLECTIONS IN BIN (WORKING SET) : 23542
REMARK 3 BIN R VALUE (WORKING SET) : 0.3710
REMARK 3 BIN FREE R VALUE : 0.3750
REMARK 3 BIN FREE R VALUE TEST SET SIZE (%) : 1.90
REMARK 3 BIN FREE R VALUE TEST SET COUNT : 451
REMARK 3 ESTIMATED ERROR OF BIN FREE R VALUE : 0.018
REMARK 3
REMARK 3 NUMBER OF NON-HYDROGEN ATOMS USED IN REFINEMENT.
REMARK 3 PROTEIN ATOMS : 31796
REMARK 3 NUCLEIC ACID ATOMS : 0
REMARK 3 HETEROGEN ATOMS : 879
REMARK 3 SOLVENT ATOMS : 28
REMARK 3
REMARK 3 B VALUES.
REMARK 3 FROM WILSON PLOT (A**2) : 71.90
REMARK 3 MEAN B VALUE (OVERALL, A**2) : 65.70
REMARK 3 OVERALL ANISOTROPIC B VALUE.
REMARK 3 B11 (A**2) : 18.79000
REMARK 3 B22 (A**2) : -18.34000
REMARK 3 B33 (A**2) : -0.45000
REMARK 3 B12 (A**2) : 0.00000
REMARK 3 B13 (A**2) : 0.00000
REMARK 3 B23 (A**2) : 0.00000
REMARK 3
REMARK 3 ESTIMATED COORDINATE ERROR.
REMARK 3 ESD FROM LUZZATI PLOT (A) : 0.44
REMARK 3 ESD FROM SIGMAA (A) : 0.56
REMARK 3 LOW RESOLUTION CUTOFF (A) : 5.00
REMARK 3
REMARK 3 CROSS-VALIDATED ESTIMATED COORDINATE ERROR.
REMARK 3 ESD FROM C-V LUZZATI PLOT (A) : 0.49
REMARK 3 ESD FROM C-V SIGMAA (A) : 0.61
REMARK 3
REMARK 3 RMS DEVIATIONS FROM IDEAL VALUES.
REMARK 3 BOND LENGTHS (A) : 0.008
REMARK 3 BOND ANGLES (DEGREES) : 1.30
REMARK 3 DIHEDRAL ANGLES (DEGREES) : 21.20
REMARK 3 IMPROPER ANGLES (DEGREES) : 0.90
REMARK 3
REMARK 3 ISOTROPIC THERMAL MODEL : RESTRAINED
REMARK 3
REMARK 3 ISOTROPIC THERMAL FACTOR RESTRAINTS. RMS SIGMA
REMARK 3 MAIN-CHAIN BOND (A**2) : 1.230 ; 1.500
REMARK 3 MAIN-CHAIN ANGLE (A**2) : 2.120 ; 2.000
REMARK 3 SIDE-CHAIN BOND (A**2) : 1.790 ; 2.000
REMARK 3 SIDE-CHAIN ANGLE (A**2) : 2.770 ; 2.500
REMARK 3
REMARK 3 BULK SOLVENT MODELING.
REMARK 3 METHOD USED : FLAT MODEL
REMARK 3 KSOL : 0.29
REMARK 3 BSOL : 26.84
REMARK 3
REMARK 3 NCS MODEL : CONSTR
REMARK 3
REMARK 3 NCS RESTRAINTS. RMS SIGMA/WEIGHT
REMARK 3 GROUP 1 POSITIONAL (A) : NULL ; NULL
REMARK 3 GROUP 1 B-FACTOR (A**2) : NULL ; NULL
REMARK 3
REMARK 3 PARAMETER FILE 1 : PROTEIN_REP.PARAM
REMARK 3 PARAMETER FILE 2 : HETERO10.PAR
REMARK 3 PARAMETER FILE 3 : FNMFMX2-STR.PAR
REMARK 3 PARAMETER FILE 4 : WATER.PARAM
REMARK 3 PARAMETER FILE 5 : PROSTH3.PAR
REMARK 3 PARAMETER FILE 6 : NULL
REMARK 3 TOPOLOGY FILE 1 : &_1_TOPOLOGY_INFILE_1
REMARK 3 TOPOLOGY FILE 2 : &_1_TOPOLOGY_INFILE_2
REMARK 3 TOPOLOGY FILE 3 : &_1_TOPOLOGY_INFILE_3
REMARK 3 TOPOLOGY FILE 4 : &_1_TOPOLOGY_INFILE_4
REMARK 3 TOPOLOGY FILE 5 : &_1_TOPOLOGY_INFILE_5
REMARK 3 TOPOLOGY FILE 6 : NULL
REMARK 3
REMARK 3 OTHER REFINEMENT REMARKS: NULL
REMARK 4
REMARK 4 3L74 COMPLIES WITH FORMAT V. 3.20, 01-DEC-08
REMARK 100
REMARK 100 THIS ENTRY HAS BEEN PROCESSED BY RCSB ON 21-JAN-10.
REMARK 100 THE RCSB ID CODE IS RCSB056916.
REMARK 200
REMARK 200 EXPERIMENTAL DETAILS
REMARK 200 EXPERIMENT TYPE : X-RAY DIFFRACTION
REMARK 200 DATE OF DATA COLLECTION : 28-JUL-06
REMARK 200 TEMPERATURE (KELVIN) : 100.0
REMARK 200 PH : 6.77
REMARK 200 NUMBER OF CRYSTALS USED : 1
REMARK 200
REMARK 200 SYNCHROTRON (Y/N) : Y
REMARK 200 RADIATION SOURCE : ALS
REMARK 200 BEAMLINE : 5.0.2
REMARK 200 X-RAY GENERATOR MODEL : NULL
REMARK 200 MONOCHROMATIC OR LAUE (M/L) : M
REMARK 200 WAVELENGTH OR RANGE (A) : 1.00
REMARK 200 MONOCHROMATOR : NULL
REMARK 200 OPTICS : NULL
REMARK 200
REMARK 200 DETECTOR TYPE : CCD
REMARK 200 DETECTOR MANUFACTURER : ADSC QUANTUM 315
REMARK 200 INTENSITY-INTEGRATION SOFTWARE : DENZO
REMARK 200 DATA SCALING SOFTWARE : SCALEPACK
REMARK 200
REMARK 200 NUMBER OF UNIQUE REFLECTIONS : 201091
REMARK 200 RESOLUTION RANGE HIGH (A) : 2.700
REMARK 200 RESOLUTION RANGE LOW (A) : 99.000
REMARK 200 REJECTION CRITERIA (SIGMA(I)) : -3.000
REMARK 200
REMARK 200 OVERALL.
REMARK 200 COMPLETENESS FOR RANGE (%) : 95.9
REMARK 200 DATA REDUNDANCY : 3.300
REMARK 200 R MERGE (I) : NULL
REMARK 200 R SYM (I) : 0.07800
REMARK 200 <I/SIGMA(I)> FOR THE DATA SET : 17.8000
REMARK 200
REMARK 200 IN THE HIGHEST RESOLUTION SHELL.
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE HIGH (A) : 2.70
REMARK 200 HIGHEST RESOLUTION SHELL, RANGE LOW (A) : 2.74
REMARK 200 COMPLETENESS FOR SHELL (%) : 66.0
REMARK 200 DATA REDUNDANCY IN SHELL : 2.80
REMARK 200 R MERGE FOR SHELL (I) : NULL
REMARK 200 R SYM FOR SHELL (I) : NULL
REMARK 200 <I/SIGMA(I)> FOR SHELL : 0.891
REMARK 200
REMARK 200 DIFFRACTION PROTOCOL: SINGLE WAVELENGTH
REMARK 200 METHOD USED TO DETERMINE THE STRUCTURE: RIGID BODY REFINEMENT
REMARK 200 SOFTWARE USED: CNS
REMARK 200 STARTING MODEL: PDB ENTRY 3H1H
REMARK 200
REMARK 200 REMARK: NULL
REMARK 280
REMARK 280 CRYSTAL
REMARK 280 SOLVENT CONTENT, VS (%): 69.76
REMARK 280 MATTHEWS COEFFICIENT, VM (ANGSTROMS**3/DA): 4.07
REMARK 280
REMARK 280 CRYSTALLIZATION CONDITIONS: FINAL CONCENTRATIONS BEFORE
REMARK 280 DIFFUSION: 50 MM CACODYLATE, 9.4 MM TRISHCL, 10 MM MGCL2, 50
REMARK 280 G/L GLYCEROL, 30 G/L PEG 3350DA, 0.23 MM EDTA, 0.47 G/L
REMARK 280 UNDECYL MALTOSIDE, 31 MM OCTYL GLUCOSIDE, PH 6.77 , VAPOR
REMARK 280 DIFFUSION, SITTING DROP, TEMPERATURE 273K
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY
REMARK 290 SYMMETRY OPERATORS FOR SPACE GROUP: P 21 21 21
REMARK 290
REMARK 290 SYMOP SYMMETRY
REMARK 290 NNNMMM OPERATOR
REMARK 290 1555 X,Y,Z
REMARK 290 2555 -X+1/2,-Y,Z+1/2
REMARK 290 3555 -X,Y+1/2,-Z+1/2
REMARK 290 4555 X+1/2,-Y+1/2,-Z
REMARK 290
REMARK 290 WHERE NNN -> OPERATOR NUMBER
REMARK 290 MMM -> TRANSLATION VECTOR
REMARK 290
REMARK 290 CRYSTALLOGRAPHIC SYMMETRY TRANSFORMATIONS
REMARK 290 THE FOLLOWING TRANSFORMATIONS OPERATE ON THE ATOM/HETATM
REMARK 290 RECORDS IN THIS ENTRY TO PRODUCE CRYSTALLOGRAPHICALLY
REMARK 290 RELATED MOLECULES.
REMARK 290 SMTRY1 1 1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 1 0.000000 1.000000 0.000000 0.00000
REMARK 290 SMTRY3 1 0.000000 0.000000 1.000000 0.00000
REMARK 290 SMTRY1 2 -1.000000 0.000000 0.000000 85.94650
REMARK 290 SMTRY2 2 0.000000 -1.000000 0.000000 0.00000
REMARK 290 SMTRY3 2 0.000000 0.000000 1.000000 120.37500
REMARK 290 SMTRY1 3 -1.000000 0.000000 0.000000 0.00000
REMARK 290 SMTRY2 3 0.000000 1.000000 0.000000 90.84350
REMARK 290 SMTRY3 3 0.000000 0.000000 -1.000000 120.37500
REMARK 290 SMTRY1 4 1.000000 0.000000 0.000000 85.94650
REMARK 290 SMTRY2 4 0.000000 -1.000000 0.000000 90.84350
REMARK 290 SMTRY3 4 0.000000 0.000000 -1.000000 0.00000
REMARK 290
REMARK 290 REMARK: NULL
REMARK 300
REMARK 300 BIOMOLECULE: 1
REMARK 300 SEE REMARK 350 FOR THE AUTHOR PROVIDED AND/OR PROGRAM
REMARK 300 GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN
REMARK 300 THIS ENTRY. THE REMARK MAY ALSO PROVIDE INFORMATION ON
REMARK 300 BURIED SURFACE AREA.
REMARK 350
REMARK 350 COORDINATES FOR A COMPLETE MULTIMER REPRESENTING THE KNOWN
REMARK 350 BIOLOGICALLY SIGNIFICANT OLIGOMERIZATION STATE OF THE
REMARK 350 MOLECULE CAN BE GENERATED BY APPLYING BIOMT TRANSFORMATIONS
REMARK 350 GIVEN BELOW. BOTH NON-CRYSTALLOGRAPHIC AND
REMARK 350 CRYSTALLOGRAPHIC OPERATIONS ARE GIVEN.
REMARK 350
REMARK 350 BIOMOLECULE: 1
REMARK 350 AUTHOR DETERMINED BIOLOGICAL UNIT: EICOSAMERIC
REMARK 350 SOFTWARE DETERMINED QUATERNARY STRUCTURE: EICOSAMERIC
REMARK 350 SOFTWARE USED: PISA
REMARK 350 TOTAL BURIED SURFACE AREA: 108420 ANGSTROM**2
REMARK 350 SURFACE AREA OF THE COMPLEX: 151930 ANGSTROM**2
REMARK 350 CHANGE IN SOLVENT FREE ENERGY: -694.0 KCAL/MOL
REMARK 350 APPLY THE FOLLOWING TO CHAINS: A, B, I, N, O, V, C, D, P,
REMARK 350 AND CHAINS: Q, U, H, T, G, F, S, E, R,
REMARK 350 AND CHAINS: W, J
REMARK 350 BIOMT1 1 1.000000 0.000000 0.000000 0.00000
REMARK 350 BIOMT2 1 0.000000 1.000000 0.000000 0.00000
REMARK 350 BIOMT3 1 0.000000 0.000000 1.000000 0.00000
REMARK 465
REMARK 465 MISSING RESIDUES
REMARK 465 THE FOLLOWING RESIDUES WERE NOT LOCATED IN THE
REMARK 465 EXPERIMENT. (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 465 IDENTIFIER; SSSEQ=SEQUENCE NUMBER; I=INSERTION CODE.)
REMARK 465
REMARK 465 M RES C SSSEQI
REMARK 465 ALA A 1
REMARK 465 ARG A 445
REMARK 465 PHE A 446
REMARK 465 SER B -1
REMARK 465 LEU B 0
REMARK 465 LYS B 1
REMARK 465 VAL B 2
REMARK 465 ALA B 3
REMARK 465 PRO B 4
REMARK 465 LYS B 5
REMARK 465 VAL B 6
REMARK 465 ALA B 7
REMARK 465 VAL B 8
REMARK 465 SER B 9
REMARK 465 ALA B 10
REMARK 465 ALA B 11
REMARK 465 ALA B 12
REMARK 465 GLU B 13
REMARK 465 ARG B 14
REMARK 465 VAL B 15
REMARK 465 LYS B 16
REMARK 465 LEU B 17
REMARK 465 CYS B 18
REMARK 465 ALA F 1
REMARK 465 ALA F 2
REMARK 465 ARG F 3
REMARK 465 ALA F 4
REMARK 465 THR F 5
REMARK 465 VAL F 6
REMARK 465 ALA F 7
REMARK 465 GLY F 8
REMARK 465 GLY F 9
REMARK 465 LEU H 2
REMARK 465 ARG H 3
REMARK 465 GLY H 4
REMARK 465 SER H 5
REMARK 465 GLY H 6
REMARK 465 GLU H 7
REMARK 465 GLU H 8
REMARK 465 TYR I 78
REMARK 465 ALA N 1
REMARK 465 ALA N 2
REMARK 465 ARG N 445
REMARK 465 PHE N 446
REMARK 465 SER O -1
REMARK 465 LEU O 0
REMARK 465 LYS O 1
REMARK 465 VAL O 2
REMARK 465 ALA O 3
REMARK 465 PRO O 4
REMARK 465 LYS O 5
REMARK 465 VAL O 6
REMARK 465 ALA O 7
REMARK 465 VAL O 8
REMARK 465 SER O 9
REMARK 465 ALA O 10
REMARK 465 ALA O 11
REMARK 465 ALA O 12
REMARK 465 GLU O 13
REMARK 465 ARG O 14
REMARK 465 VAL O 15
REMARK 465 LYS O 16
REMARK 465 LEU O 17
REMARK 465 MET P 1
REMARK 465 ALA S 1
REMARK 465 ALA S 2
REMARK 465 ARG S 3
REMARK 465 ALA S 4
REMARK 465 THR S 5
REMARK 465 VAL S 6
REMARK 465 ALA S 7
REMARK 465 GLY S 8
REMARK 465 GLY S 9
REMARK 465 GLY T 1
REMARK 465 ASP T 80
REMARK 465 GLN T 81
REMARK 465 LEU U 2
REMARK 465 ARG U 3
REMARK 465 GLY U 4
REMARK 465 SER U 5
REMARK 465 GLY U 6
REMARK 465 GLU U 7
REMARK 465 GLU U 8
REMARK 465 GLU U 9
REMARK 465 GLU U 10
REMARK 465 GLU U 11
REMARK 465 UNK V 26
REMARK 465 UNK V 27
REMARK 465 TYR V 78
REMARK 465 GLU W 64
REMARK 470
REMARK 470 MISSING ATOM
REMARK 470 THE FOLLOWING RESIDUES HAVE MISSING ATOMS(M=MODEL NUMBER;
REMARK 470 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 470 I=INSERTION CODE):
REMARK 470 M RES CSSEQI ATOMS
REMARK 470 ILE A 444 C O CB CG1 CG2 CD1
REMARK 470 MET C 1 CG SD CE
REMARK 470 GLU H 9 N CB CG CD OE1 OE2
REMARK 470 ARG I 47 N CB CG CD NE CZ NH1
REMARK 470 ARG I 47 NH2
REMARK 470 ARG I 61 CG CD NE CZ NH1 NH2
REMARK 470 ILE N 444 O CG1 CG2 CD1
REMARK 470 GLN R 186 N
REMARK 470 ARG V 47 N CB CG CD NE CZ NH1
REMARK 470 ARG V 47 NH2
REMARK 470 ARG V 61 CG CD NE CZ NH1 NH2
REMARK 470 GLU W 63 CA C O CB CG CD OE1
REMARK 470 GLU W 63 OE2
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: CLOSE CONTACTS IN SAME ASYMMETRIC UNIT
REMARK 500
REMARK 500 THE FOLLOWING ATOMS ARE IN CLOSE CONTACT.
REMARK 500
REMARK 500 ATM1 RES C SSEQI ATM2 RES C SSEQI DISTANCE
REMARK 500 O LEU N 19 N ASN N 21 2.19
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: COVALENT BOND ANGLES
REMARK 500
REMARK 500 THE STEREOCHEMICAL PARAMETERS OF THE FOLLOWING RESIDUES
REMARK 500 HAVE VALUES WHICH DEVIATE FROM EXPECTED VALUES BY MORE
REMARK 500 THAN 6*RMSD (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,3(1X,A4,2X),12X,F5.1)
REMARK 500
REMARK 500 EXPECTED VALUES PROTEIN: ENGH AND HUBER, 1999
REMARK 500 EXPECTED VALUES NUCLEIC ACID: CLOWNEY ET AL 1996
REMARK 500
REMARK 500 M RES CSSEQI ATM1 ATM2 ATM3
REMARK 500 PRO O 19 C - N - CA ANGL. DEV. = 10.8 DEGREES
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: TORSION ANGLES
REMARK 500
REMARK 500 TORSION ANGLES OUTSIDE THE EXPECTED RAMACHANDRAN REGIONS:
REMARK 500 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 500 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE).
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT:(10X,I3,1X,A3,1X,A1,I4,A1,4X,F7.2,3X,F7.2)
REMARK 500
REMARK 500 EXPECTED VALUES: GJ KLEYWEGT AND TA JONES (1996). PHI/PSI-
REMARK 500 CHOLOGY: RAMACHANDRAN REVISITED. STRUCTURE 4, 1395 - 1400
REMARK 500
REMARK 500 M RES CSSEQI PSI PHI
REMARK 500 ALA A 63 -8.15 -55.14
REMARK 500 CYS A 72 -76.60 -35.29
REMARK 500 SER A 91 -154.26 -123.84
REMARK 500 ASN A 119 51.08 -118.51
REMARK 500 THR A 161 -169.18 -111.60
REMARK 500 ALA A 192 -61.21 -27.61
REMARK 500 SER A 217 -92.88 -105.94
REMARK 500 TRP A 262 -72.56 -28.42
REMARK 500 ARG A 282 11.83 -55.60
REMARK 500 LYS A 288 5.60 -66.40
REMARK 500 ASP A 370 70.01 -109.07
REMARK 500 ARG A 388 150.17 176.17
REMARK 500 TRP A 443 106.67 65.53
REMARK 500 GLU B 25 173.53 -54.97
REMARK 500 ILE B 26 78.35 -178.13
REMARK 500 THR B 27 -172.02 -64.99
REMARK 500 LYS B 28 74.97 -169.70
REMARK 500 LEU B 29 157.98 -35.90
REMARK 500 LEU B 38 117.96 -174.58
REMARK 500 PHE B 41 17.39 55.77
REMARK 500 ASP B 114 5.08 -61.69
REMARK 500 PHE B 132 52.96 34.74
REMARK 500 PHE B 152 6.07 -69.80
REMARK 500 ALA B 171 -85.74 44.99
REMARK 500 ASN B 198 -32.68 -140.14
REMARK 500 ALA B 220 -74.18 -47.29
REMARK 500 ASN B 225 -89.59 -111.66
REMARK 500 ILE B 226 95.66 5.69
REMARK 500 ARG B 227 158.01 -33.33
REMARK 500 SER B 228 -170.73 -69.06
REMARK 500 SER B 266 142.74 -172.28
REMARK 500 ALA B 281 54.47 -115.49
REMARK 500 ARG B 287 1.39 59.04
REMARK 500 THR B 292 9.67 -69.08
REMARK 500 SER B 319 -173.57 177.20
REMARK 500 GLN B 349 57.32 -97.97
REMARK 500 ALA B 386 -3.16 -57.52
REMARK 500 SER B 389 24.80 173.99
REMARK 500 PRO B 395 -6.46 -55.87
REMARK 500 LEU B 430 13.63 -69.64
REMARK 500 ILE C 20 -59.70 -134.06
REMARK 500 TYR C 76 17.43 52.49
REMARK 500 TYR C 156 -70.08 71.94
REMARK 500 SER C 247 56.10 -152.75
REMARK 500 PRO C 286 16.24 -65.00
REMARK 500 ILE C 365 -58.21 -120.61
REMARK 500 ASN C 379 41.70 74.34
REMARK 500 VAL D 36 -64.22 -122.20
REMARK 500 MET D 43 59.56 -146.66
REMARK 500 VAL D 54 -60.73 -120.82
REMARK 500
REMARK 500 THIS ENTRY HAS 172 RAMACHANDRAN OUTLIERS.
REMARK 500
REMARK 500 REMARK: NULL
REMARK 500
REMARK 500 GEOMETRY AND STEREOCHEMISTRY
REMARK 500 SUBTOPIC: CHIRAL CENTERS
REMARK 500
REMARK 500 UNEXPECTED CONFIGURATION OF THE FOLLOWING CHIRAL
REMARK 500 CENTER(S) USING IMPROPER CA--C--CB--N CHIRALITY
REMARK 500 FOR AMINO ACIDS AND C1'--O4'--N1(N9)--C2' FOR
REMARK 500 NUCLEIC ACIDS OR EQUIVALENT ANGLE
REMARK 500 M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN
REMARK 500 IDENTIFIER; SSEQ=SEQUENCE NUMBER; I=INSERTION CODE
REMARK 500
REMARK 500 STANDARD TABLE:
REMARK 500 FORMAT: (10X,I3,1X,A3,1X,A1,I4,A1,6X,F5.1,6X,A1,10X,A1,3X,A16)
REMARK 500
REMARK 500 M RES CSSEQI IMPROPER EXPECTED FOUND DETAILS
REMARK 500 ARG O 227 23.4 L L OUTSIDE RANGE
REMARK 500
REMARK 500 REMARK: NULL
REMARK 610
REMARK 610 MISSING HETEROATOM
REMARK 610 THE FOLLOWING RESIDUES HAVE MISSING ATOMS (M=MODEL NUMBER;
REMARK 610 RES=RESIDUE NAME; C=CHAIN IDENTIFIER; SSEQ=SEQUENCE NUMBER;
REMARK 610 I=INSERTION CODE):
REMARK 610 M RES C SSEQI
REMARK 610 PEE A 2005
REMARK 610 UQ C 2002
REMARK 610 PEE C 2007
REMARK 610 PEE C 2008
REMARK 610 BOG C 3010
REMARK 610 CDL D 2003
REMARK 610 CDL G 2004
REMARK 610 PEE N 3005
REMARK 610 PEE N 3008
REMARK 610 BOG P 2010
REMARK 610 UQ P 3002
REMARK 610 PEE P 3007
REMARK 610 CDL Q 3003
REMARK 610 CDL T 3004
REMARK 620
REMARK 620 METAL COORDINATION
REMARK 620 (M=MODEL NUMBER; RES=RESIDUE NAME; C=CHAIN IDENTIFIER;
REMARK 620 SSEQ=SEQUENCE NUMBER; I=INSERTION CODE):
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM P 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS P 84 NE2
REMARK 620 2 HEM P 501 NA 89.7
REMARK 620 3 HEM P 501 NB 86.6 89.6
REMARK 620 4 HEM P 501 NC 94.1 176.1 91.2
REMARK 620 5 HEM P 501 ND 92.1 88.6 177.8 90.7
REMARK 620 6 HIS P 183 NE2 178.4 90.7 91.9 85.5 89.4
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM C 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS C 183 NE2
REMARK 620 2 HEM C 501 NA 89.5
REMARK 620 3 HEM C 501 NB 90.4 89.6
REMARK 620 4 HEM C 501 NC 85.9 174.8 93.0
REMARK 620 5 HEM C 501 ND 87.9 87.2 176.3 90.1
REMARK 620 6 HIS C 84 NE2 179.1 91.1 90.3 93.5 91.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEC Q 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS Q 41 NE2
REMARK 620 2 HEC Q 501 NA 91.1
REMARK 620 3 HEC Q 501 NB 93.1 89.6
REMARK 620 4 HEC Q 501 NC 93.5 175.1 88.6
REMARK 620 5 HEC Q 501 ND 90.2 88.7 176.2 92.9
REMARK 620 6 MET Q 160 SD 177.8 89.2 89.0 86.2 87.6
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEC D 501 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS D 41 NE2
REMARK 620 2 HEC D 501 NA 90.0
REMARK 620 3 HEC D 501 NB 90.4 90.9
REMARK 620 4 HEC D 501 NC 92.5 177.3 88.0
REMARK 620 5 HEC D 501 ND 89.9 90.0 179.1 91.2
REMARK 620 6 MET D 160 SD 178.2 91.6 88.6 85.9 91.1
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM C 502 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS C 197 NE2
REMARK 620 2 HEM C 502 NA 94.6
REMARK 620 3 HEM C 502 NB 94.6 91.8
REMARK 620 4 HEM C 502 NC 90.2 174.3 90.8
REMARK 620 5 HEM C 502 ND 86.0 88.9 179.0 88.4
REMARK 620 6 HIS C 98 NE2 173.3 90.2 89.8 84.7 89.5
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 HEM P 502 FE
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS P 197 NE2
REMARK 620 2 HEM P 502 NA 95.0
REMARK 620 3 HEM P 502 NB 93.1 89.8
REMARK 620 4 HEM P 502 NC 91.8 173.2 90.0
REMARK 620 5 HEM P 502 ND 87.3 89.9 179.5 90.2
REMARK 620 6 HIS P 98 NE2 174.6 88.8 90.8 84.4 88.8
REMARK 620 N 1 2 3 4 5
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES E 501 FE2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS E 161 ND1
REMARK 620 2 FES E 501 S1 116.8
REMARK 620 3 FES E 501 S2 113.0 104.3
REMARK 620 4 HIS E 141 ND1 92.2 114.3 116.5
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES R 501 FE2
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 HIS R 141 ND1
REMARK 620 2 FES R 501 S1 115.6
REMARK 620 3 FES R 501 S2 116.5 104.5
REMARK 620 4 HIS R 161 ND1 89.5 116.4 114.5
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES E 501 FE1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 CYS E 139 SG
REMARK 620 2 FES E 501 S1 113.1
REMARK 620 3 FES E 501 S2 108.3 103.9
REMARK 620 4 CYS E 158 SG 110.4 109.1 112.0
REMARK 620 N 1 2 3
REMARK 620
REMARK 620 COORDINATION ANGLES FOR: M RES CSSEQI METAL
REMARK 620 FES R 501 FE1
REMARK 620 N RES CSSEQI ATOM
REMARK 620 1 CYS R 158 SG
REMARK 620 2 FES R 501 S1 110.9
REMARK 620 3 FES R 501 S2 112.2 104.6
REMARK 620 4 CYS R 139 SG 109.0 110.5 109.6
REMARK 620 N 1 2 3
REMARK 800
REMARK 800 SITE
REMARK 800 SITE_IDENTIFIER: AC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM C 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM C 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEC D 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FES E 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM P 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEM P 502
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE HEC Q 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FES R 501
REMARK 800
REMARK 800 SITE_IDENTIFIER: AC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FMX C 2001
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE UQ C 2002
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL D 2003
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL G 2004
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE A 2005
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE C 2007
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE C 2008
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG D 2009
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG D 2091
REMARK 800
REMARK 800 SITE_IDENTIFIER: BC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG P 2010
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE AZI C 2011
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE FMX P 3001
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE UQ P 3002
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC4
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL Q 3003
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC5
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE CDL T 3004
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC6
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE N 3005
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC7
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE P 3007
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC8
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE PEE N 3008
REMARK 800
REMARK 800 SITE_IDENTIFIER: CC9
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG Q 3009
REMARK 800
REMARK 800 SITE_IDENTIFIER: DC1
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG Q 3091
REMARK 800
REMARK 800 SITE_IDENTIFIER: DC2
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE BOG C 3010
REMARK 800
REMARK 800 SITE_IDENTIFIER: DC3
REMARK 800 EVIDENCE_CODE: SOFTWARE
REMARK 800 SITE_DESCRIPTION: BINDING SITE FOR RESIDUE AZI P 3011
REMARK 900
REMARK 900 RELATED ENTRIES
REMARK 900 RELATED ID: 3L70 RELATED DB: PDB
REMARK 900 RELATED ID: 3L71 RELATED DB: PDB
REMARK 900 RELATED ID: 3L72 RELATED DB: PDB
REMARK 900 RELATED ID: 3L73 RELATED DB: PDB
REMARK 900 RELATED ID: 3L75 RELATED DB: PDB
REMARK 900 RELATED ID: 1L0L RELATED DB: PDB
REMARK 900 BOVINE BC1 WITH FAMOXADONE BOUND
REMARK 999
REMARK 999 SEQUENCE
REMARK 999 THE COMPLETE SEQUENCE OF CHAIN I AND V IS
REMARK 999 MLSVAARSGPFAPYLSAAAHAVPGPLKALAPAALRAEKVVLDLKRPLLCRESMSGRSARRDLVAG
REMARK 999 ISLNAPASVRY, UNP residues 1-76. THE N-TERMINUS IS DISORDERED.
DBREF 3L74 A 1 446 UNP D0VX31 D0VX31_CHICK 1 446
DBREF 3L74 B -1 439 UNP D0VX29 D0VX29_CHICK 1 441
DBREF 3L74 C 1 380 UNP P18946 CYB_CHICK 1 380
DBREF 3L74 D 1 241 UNP D0VX26 D0VX26_CHICK 1 241
DBREF 3L74 E 1 196 UNP Q5ZLR5 UCRI_CHICK 77 272
DBREF 3L74 F 1 110 UNP D0VX30 D0VX30_CHICK 1 110
DBREF 3L74 G 1 81 UNP D0VX32 D0VX32_CHICK 1 81
DBREF 3L74 H 2 78 UNP D0VX28 D0VX28_CHICK 1 77
DBREF 3L74 I 47 78 UNP Q5ZLR5 UCRI_CHICK 45 76
DBREF 3L74 J 4 64 UNP D0VX27 D0VX27_CHICK 1 61
DBREF 3L74 N 1 446 UNP D0VX31 D0VX31_CHICK 1 446
DBREF 3L74 O -1 439 UNP D0VX29 D0VX29_CHICK 1 441
DBREF 3L74 P 1 380 UNP P18946 CYB_CHICK 1 380
DBREF 3L74 Q 1 241 UNP D0VX26 D0VX26_CHICK 1 241
DBREF 3L74 R 1 196 UNP Q5ZLR5 UCRI_CHICK 77 272
DBREF 3L74 S 1 110 UNP D0VX30 D0VX30_CHICK 1 110
DBREF 3L74 T 1 81 UNP D0VX32 D0VX32_CHICK 1 81
DBREF 3L74 U 2 78 UNP D0VX28 D0VX28_CHICK 1 77
DBREF 3L74 V 47 78 UNP Q5ZLR5 UCRI_CHICK 45 76
DBREF 3L74 W 4 64 UNP D0VX27 D0VX27_CHICK 1 61
SEQRES 1 A 446 ALA ALA THR TYR ALA GLN THR LEU GLN ASN ILE PRO GLU
SEQRES 2 A 446 THR ASN VAL THR THR LEU ASP ASN GLY LEU ARG VAL ALA
SEQRES 3 A 446 SER GLU GLU SER SER GLN PRO THR CYS THR VAL GLY VAL
SEQRES 4 A 446 TRP ILE GLY ALA GLY SER ARG TYR GLU ASN GLU LYS ASN
SEQRES 5 A 446 ASN GLY ALA GLY TYR PHE VAL GLU HIS LEU ALA PHE LYS
SEQRES 6 A 446 GLY THR LYS LYS ARG PRO CYS ALA ALA PHE GLU LYS GLU
SEQRES 7 A 446 VAL GLU SER MET GLY ALA HIS PHE ASN GLY TYR THR SER
SEQRES 8 A 446 ARG GLU GLN THR ALA PHE TYR ILE LYS ALA LEU SER LYS
SEQRES 9 A 446 ASP MET PRO LYS VAL VAL GLU LEU LEU ALA ASP VAL VAL
SEQRES 10 A 446 GLN ASN CYS ALA LEU GLU GLU SER GLN ILE GLU LYS GLU
SEQRES 11 A 446 ARG GLY VAL ILE LEU GLN GLU LEU LYS GLU MET ASP ASN
SEQRES 12 A 446 ASP MET THR ASN VAL THR PHE ASP TYR LEU HIS ALA THR
SEQRES 13 A 446 ALA PHE GLN GLY THR ALA LEU ALA ARG THR VAL GLU GLY
SEQRES 14 A 446 THR THR GLU ASN ILE LYS HIS LEU THR ARG ALA ASP LEU
SEQRES 15 A 446 ALA SER TYR ILE ASP THR HIS PHE LYS ALA PRO ARG MET
SEQRES 16 A 446 VAL LEU ALA ALA ALA GLY GLY ILE SER HIS LYS GLU LEU
SEQRES 17 A 446 VAL ASP ALA ALA ARG GLN HIS PHE SER GLY VAL SER PHE
SEQRES 18 A 446 THR TYR LYS GLU ASP ALA VAL PRO ILE LEU PRO ARG CYS
SEQRES 19 A 446 ARG PHE THR GLY SER GLU ILE ARG ALA ARG ASP ASP ALA
SEQRES 20 A 446 LEU PRO VAL ALA HIS VAL ALA LEU ALA VAL GLU GLY PRO
SEQRES 21 A 446 GLY TRP ALA ASP PRO ASP ASN VAL VAL LEU HIS VAL ALA
SEQRES 22 A 446 ASN ALA ILE ILE GLY ARG TYR ASP ARG THR PHE GLY GLY
SEQRES 23 A 446 GLY LYS HIS LEU SER SER ARG LEU ALA ALA LEU ALA VAL
SEQRES 24 A 446 GLU HIS LYS LEU CYS HIS SER PHE GLN THR PHE ASN THR
SEQRES 25 A 446 SER TYR SER ASP THR GLY LEU PHE GLY PHE HIS PHE VAL
SEQRES 26 A 446 ALA ASP PRO LEU SER ILE ASP ASP MET MET PHE CYS ALA
SEQRES 27 A 446 GLN GLY GLU TRP MET ARG LEU CYS THR SER THR THR GLU
SEQRES 28 A 446 SER GLU VAL LYS ARG ALA LYS ASN HIS LEU ARG SER ALA
SEQRES 29 A 446 MET VAL ALA GLN LEU ASP GLY THR THR PRO VAL CYS GLU
SEQRES 30 A 446 THR ILE GLY SER HIS LEU LEU ASN TYR GLY ARG ARG ILE
SEQRES 31 A 446 SER LEU GLU GLU TRP ASP SER ARG ILE SER ALA VAL ASP
SEQRES 32 A 446 ALA ARG MET VAL ARG ASP VAL CYS SER LYS TYR ILE TYR
SEQRES 33 A 446 ASP LYS CYS PRO ALA LEU ALA ALA VAL GLY PRO ILE GLU
SEQRES 34 A 446 GLN LEU LEU ASP TYR ASN ARG ILE ARG SER GLY MET TYR
SEQRES 35 A 446 TRP ILE ARG PHE
SEQRES 1 B 441 SER LEU LYS VAL ALA PRO LYS VAL ALA VAL SER ALA ALA
SEQRES 2 B 441 ALA GLU ARG VAL LYS LEU CYS PRO GLY ALA GLU ASP LEU
SEQRES 3 B 441 GLU ILE THR LYS LEU PRO ASN GLY LEU ILE ILE ALA SER
SEQRES 4 B 441 LEU GLU ASN PHE SER PRO ALA SER ARG ILE GLY VAL PHE
SEQRES 5 B 441 ILE LYS ALA GLY SER ARG TYR GLU THR THR ALA ASN LEU
SEQRES 6 B 441 GLY THR ALA HIS LEU LEU ARG LEU ALA SER PRO LEU THR
SEQRES 7 B 441 THR LYS GLY ALA SER SER PHE ARG ILE THR ARG GLY ILE
SEQRES 8 B 441 GLU ALA VAL GLY GLY SER LEU SER VAL TYR SER THR ARG
SEQRES 9 B 441 GLU LYS MET THR TYR CYS VAL GLU CYS LEU ARG ASP HIS
SEQRES 10 B 441 VAL ASP THR VAL MET GLU TYR LEU LEU ASN VAL THR THR
SEQRES 11 B 441 ALA PRO GLU PHE ARG PRO TRP GLU VAL THR ASP LEU GLN
SEQRES 12 B 441 PRO GLN LEU LYS VAL ASP LYS ALA VAL ALA PHE GLN SER
SEQRES 13 B 441 PRO GLN VAL GLY VAL LEU GLU ASN LEU HIS ALA ALA ALA
SEQRES 14 B 441 TYR LYS THR ALA LEU ALA ASN PRO LEU TYR CYS PRO ASP
SEQRES 15 B 441 TYR ARG ILE GLY LYS ILE THR SER GLU GLN LEU HIS HIS
SEQRES 16 B 441 PHE VAL GLN ASN ASN PHE THR SER ALA ARG MET ALA LEU
SEQRES 17 B 441 VAL GLY ILE GLY VAL LYS HIS SER ASP LEU LYS GLN VAL
SEQRES 18 B 441 ALA GLU GLN PHE LEU ASN ILE ARG SER GLY ALA GLY THR
SEQRES 19 B 441 SER SER ALA LYS ALA THR TYR TRP GLY GLY GLU ILE ARG
SEQRES 20 B 441 GLU GLN ASN GLY HIS SER LEU VAL HIS ALA ALA VAL VAL
SEQRES 21 B 441 THR GLU GLY ALA ALA VAL GLY SER ALA GLU ALA ASN ALA
SEQRES 22 B 441 PHE SER VAL LEU GLN HIS VAL LEU GLY ALA GLY PRO LEU
SEQRES 23 B 441 ILE LYS ARG GLY SER SER VAL THR SER LYS LEU TYR GLN
SEQRES 24 B 441 GLY VAL ALA LYS ALA THR THR GLN PRO PHE ASP ALA SER
SEQRES 25 B 441 ALA PHE ASN VAL ASN TYR SER ASP SER GLY LEU PHE GLY
SEQRES 26 B 441 PHE TYR THR ILE SER GLN ALA ALA HIS ALA GLY GLU VAL
SEQRES 27 B 441 ILE ARG ALA ALA MET ASN GLN LEU LYS ALA ALA ALA GLN
SEQRES 28 B 441 GLY GLY VAL THR GLU GLU ASP VAL THR LYS ALA LYS ASN
SEQRES 29 B 441 GLN LEU LYS ALA THR TYR LEU MET SER VAL GLU THR ALA
SEQRES 30 B 441 GLN GLY LEU LEU ASN GLU ILE GLY SER GLU ALA LEU LEU
SEQRES 31 B 441 SER GLY THR HIS THR ALA PRO SER VAL VAL ALA GLN LYS
SEQRES 32 B 441 ILE ASP SER VAL THR SER ALA ASP VAL VAL ASN ALA ALA
SEQRES 33 B 441 LYS LYS PHE VAL SER GLY LYS LYS SER MET ALA ALA SER
SEQRES 34 B 441 GLY ASP LEU GLY SER THR PRO PHE LEU ASP GLU LEU
SEQRES 1 C 380 MET ALA PRO ASN ILE ARG LYS SER HIS PRO LEU LEU LYS
SEQRES 2 C 380 MET ILE ASN ASN SER LEU ILE ASP LEU PRO ALA PRO SER
SEQRES 3 C 380 ASN ILE SER ALA TRP TRP ASN PHE GLY SER LEU LEU ALA
SEQRES 4 C 380 VAL CYS LEU MET THR GLN ILE LEU THR GLY LEU LEU LEU
SEQRES 5 C 380 ALA MET HIS TYR THR ALA ASP THR SER LEU ALA PHE SER
SEQRES 6 C 380 SER VAL ALA HIS THR CYS ARG ASN VAL GLN TYR GLY TRP
SEQRES 7 C 380 LEU ILE ARG ASN LEU HIS ALA ASN GLY ALA SER PHE PHE
SEQRES 8 C 380 PHE ILE CYS ILE PHE LEU HIS ILE GLY ARG GLY LEU TYR
SEQRES 9 C 380 TYR GLY SER TYR LEU TYR LYS GLU THR TRP ASN THR GLY
SEQRES 10 C 380 VAL ILE LEU LEU LEU THR LEU MET ALA THR ALA PHE VAL
SEQRES 11 C 380 GLY TYR VAL LEU PRO TRP GLY GLN MET SER PHE TRP GLY
SEQRES 12 C 380 ALA THR VAL ILE THR ASN LEU PHE SER ALA ILE PRO TYR
SEQRES 13 C 380 ILE GLY HIS THR LEU VAL GLU TRP ALA TRP GLY GLY PHE
SEQRES 14 C 380 SER VAL ASP ASN PRO THR LEU THR ARG PHE PHE ALA LEU
SEQRES 15 C 380 HIS PHE LEU LEU PRO PHE ALA ILE ALA GLY ILE THR ILE
SEQRES 16 C 380 ILE HIS LEU THR PHE LEU HIS GLU SER GLY SER ASN ASN
SEQRES 17 C 380 PRO LEU GLY ILE SER SER ASP SER ASP LYS ILE PRO PHE
SEQRES 18 C 380 HIS PRO TYR TYR SER PHE LYS ASP ILE LEU GLY LEU THR
SEQRES 19 C 380 LEU MET LEU THR PRO PHE LEU THR LEU ALA LEU PHE SER
SEQRES 20 C 380 PRO ASN LEU LEU GLY ASP PRO GLU ASN PHE THR PRO ALA
SEQRES 21 C 380 ASN PRO LEU VAL THR PRO PRO HIS ILE LYS PRO GLU TRP
SEQRES 22 C 380 TYR PHE LEU PHE ALA TYR ALA ILE LEU ARG SER ILE PRO
SEQRES 23 C 380 ASN LYS LEU GLY GLY VAL LEU ALA LEU ALA ALA SER VAL
SEQRES 24 C 380 LEU ILE LEU PHE LEU ILE PRO PHE LEU HIS LYS SER LYS
SEQRES 25 C 380 GLN ARG THR MET THR PHE ARG PRO LEU SER GLN THR LEU
SEQRES 26 C 380 PHE TRP LEU LEU VAL ALA ASN LEU LEU ILE LEU THR TRP
SEQRES 27 C 380 ILE GLY SER GLN PRO VAL GLU HIS PRO PHE ILE ILE ILE
SEQRES 28 C 380 GLY GLN MET ALA SER LEU SER TYR PHE THR ILE LEU LEU
SEQRES 29 C 380 ILE LEU PHE PRO THR ILE GLY THR LEU GLU ASN LYS MET
SEQRES 30 C 380 LEU ASN TYR
SEQRES 1 D 241 GLY GLU LEU GLU LEU HIS PRO PRO ALA PHE PRO TRP SER
SEQRES 2 D 241 HIS GLY GLY PRO LEU SER ALA LEU ASP HIS SER SER VAL
SEQRES 3 D 241 ARG ARG GLY PHE GLN VAL TYR LYS GLN VAL CYS SER ALA
SEQRES 4 D 241 CYS HIS SER MET ASP TYR VAL ALA PHE ARG ASN LEU ILE
SEQRES 5 D 241 GLY VAL THR HIS THR GLU ALA GLU ALA LYS ALA LEU ALA
SEQRES 6 D 241 GLU GLU VAL GLU VAL GLN ASP GLY PRO ASP GLU ASN GLY
SEQRES 7 D 241 GLU LEU PHE MET ARG PRO GLY LYS ILE SER ASP TYR PHE
SEQRES 8 D 241 PRO LYS PRO TYR PRO ASN PRO GLU ALA ALA ARG ALA ALA
SEQRES 9 D 241 ASN ASN GLY ALA LEU PRO PRO ASP LEU SER TYR ILE VAL
SEQRES 10 D 241 ASN ALA ARG HIS GLY GLY GLU ASP TYR VAL PHE SER LEU
SEQRES 11 D 241 LEU THR GLY TYR CYS ASP PRO PRO ALA GLY VAL VAL VAL
SEQRES 12 D 241 ARG GLU GLY LEU HIS TYR ASN PRO TYR PHE PRO GLY GLN
SEQRES 13 D 241 ALA ILE GLY MET ALA PRO PRO ILE TYR ASN GLU ILE LEU
SEQRES 14 D 241 GLU TYR ASP ASP GLY THR PRO ALA THR MET SER GLN ILE
SEQRES 15 D 241 ALA LYS ASP VAL CYS THR PHE LEU ARG TRP ALA ALA GLU
SEQRES 16 D 241 PRO GLU HIS ASP GLN ARG LYS ARG MET GLY LEU LYS MET
SEQRES 17 D 241 LEU LEU ILE SER ALA LEU LEU THR SER LEU LEU TYR TYR
SEQRES 18 D 241 MET LYS ARG HIS LYS TRP SER VAL LEU LYS SER ARG LYS
SEQRES 19 D 241 MET ALA TYR ARG PRO PRO LYS
SEQRES 1 E 196 VAL HIS ASN ASP VAL THR VAL PRO ASP PHE SER ALA TYR
SEQRES 2 E 196 ARG ARG GLU ASP VAL MET ASP ALA THR THR SER SER GLN
SEQRES 3 E 196 THR SER SER GLU ASP ARG LYS GLY PHE SER TYR LEU VAL
SEQRES 4 E 196 THR ALA THR ALA CYS VAL ALA THR ALA TYR ALA ALA LYS
SEQRES 5 E 196 ASN VAL VAL THR GLN PHE ILE SER SER LEU SER ALA SER
SEQRES 6 E 196 ALA ASP VAL LEU ALA LEU SER LYS ILE GLU ILE LYS LEU
SEQRES 7 E 196 SER ASP ILE PRO GLU GLY LYS ASN VAL ALA PHE LYS TRP
SEQRES 8 E 196 ARG GLY LYS PRO LEU PHE VAL ARG HIS ARG THR GLN ALA
SEQRES 9 E 196 GLU ILE ASN GLN GLU ALA GLU VAL ASP VAL SER LYS LEU
SEQRES 10 E 196 ARG ASP PRO GLN HIS ASP LEU ASP ARG VAL LYS LYS PRO
SEQRES 11 E 196 GLU TRP VAL ILE LEU VAL GLY VAL CYS THR HIS LEU GLY
SEQRES 12 E 196 CYS VAL PRO ILE ALA ASN SER GLY ASP PHE GLY GLY TYR
SEQRES 13 E 196 TYR CYS PRO CYS HIS GLY SER HIS TYR ASP ALA SER GLY
SEQRES 14 E 196 ARG ILE ARG LYS GLY PRO ALA PRO TYR ASN LEU GLU VAL
SEQRES 15 E 196 PRO THR TYR GLN PHE VAL GLY ASP ASP LEU VAL VAL VAL
SEQRES 16 E 196 GLY
SEQRES 1 F 110 ALA ALA ARG ALA THR VAL ALA GLY GLY GLY ARG LEU MET
SEQRES 2 F 110 ASP ARG ILE ARG LYS TRP TYR TYR ASN ALA ALA GLY PHE
SEQRES 3 F 110 ASN LYS TYR GLY LEU MET ARG ASP ASP THR LEU TYR GLU
SEQRES 4 F 110 ASP ASP ASP VAL LYS GLU ALA LEU LYS ARG LEU PRO GLU
SEQRES 5 F 110 ASP LEU TYR ASN GLU ARG MET PHE ARG ILE LYS ARG ALA
SEQRES 6 F 110 LEU ASP LEU SER LEU LYS HIS ARG ILE LEU PRO LYS GLU
SEQRES 7 F 110 GLN TRP VAL LYS TYR GLU GLU ASP LYS PRO TYR LEU GLU
SEQRES 8 F 110 PRO TYR LEU LYS GLU VAL ILE ARG GLU ARG LEU GLU ARG
SEQRES 9 F 110 GLU ALA TRP ASN LYS LYS
SEQRES 1 G 81 GLY ILE HIS PHE GLY ASN LEU ALA ARG VAL ARG HIS ILE
SEQRES 2 G 81 ILE THR TYR SER LEU SER PRO PHE GLU GLN ARG ALA ILE
SEQRES 3 G 81 PRO ASN ILE PHE SER ASP ALA LEU PRO ASN VAL TRP ARG
SEQRES 4 G 81 ARG PHE SER SER GLN VAL PHE LYS VAL ALA PRO PRO PHE
SEQRES 5 G 81 LEU GLY ALA TYR LEU LEU TYR SER TRP GLY THR GLN GLU
SEQRES 6 G 81 PHE GLU ARG LEU LYS ARG LYS ASN PRO ALA ASP TYR GLU
SEQRES 7 G 81 ASN ASP GLN
SEQRES 1 H 77 LEU ARG GLY SER GLY GLU GLU GLU GLU GLU GLU LEU VAL
SEQRES 2 H 77 ASP PRO LEU THR THR ILE ARG GLU HIS CYS GLU GLN THR
SEQRES 3 H 77 GLU LYS CYS VAL LYS ALA ARG GLU ARG LEU GLU LEU CYS
SEQRES 4 H 77 ASP ALA ARG VAL SER SER ARG SER HIS THR GLU GLU GLN
SEQRES 5 H 77 CYS THR GLU GLU LEU PHE ASP PHE LEU HIS ALA ARG ASP
SEQRES 6 H 77 HIS CYS VAL ALA HIS LYS LEU PHE ASN LYS LEU LYS
SEQRES 1 I 47 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 I 47 UNK UNK ARG PRO LEU LEU CYS ARG GLU SER MET SER GLY
SEQRES 3 I 47 ARG SER ALA ARG ARG ASP LEU VAL ALA GLY ILE SER LEU
SEQRES 4 I 47 ASN ALA PRO ALA SER VAL ARG TYR
SEQRES 1 J 61 ALA LEU LEU ARG GLN ALA TYR SER ALA LEU PHE ARG ARG
SEQRES 2 J 61 THR SER THR PHE ALA LEU THR VAL VAL LEU GLY ALA VAL
SEQRES 3 J 61 LEU PHE GLU ARG ALA PHE ASP GLN GLY ALA ASP ALA ILE
SEQRES 4 J 61 PHE GLU HIS LEU ASN GLU GLY LYS LEU TRP LYS HIS ILE
SEQRES 5 J 61 LYS HIS LYS TYR GLU ALA SER GLU GLU
SEQRES 1 N 446 ALA ALA THR TYR ALA GLN THR LEU GLN ASN ILE PRO GLU
SEQRES 2 N 446 THR ASN VAL THR THR LEU ASP ASN GLY LEU ARG VAL ALA
SEQRES 3 N 446 SER GLU GLU SER SER GLN PRO THR CYS THR VAL GLY VAL
SEQRES 4 N 446 TRP ILE GLY ALA GLY SER ARG TYR GLU ASN GLU LYS ASN
SEQRES 5 N 446 ASN GLY ALA GLY TYR PHE VAL GLU HIS LEU ALA PHE LYS
SEQRES 6 N 446 GLY THR LYS LYS ARG PRO CYS ALA ALA PHE GLU LYS GLU
SEQRES 7 N 446 VAL GLU SER MET GLY ALA HIS PHE ASN GLY TYR THR SER
SEQRES 8 N 446 ARG GLU GLN THR ALA PHE TYR ILE LYS ALA LEU SER LYS
SEQRES 9 N 446 ASP MET PRO LYS VAL VAL GLU LEU LEU ALA ASP VAL VAL
SEQRES 10 N 446 GLN ASN CYS ALA LEU GLU GLU SER GLN ILE GLU LYS GLU
SEQRES 11 N 446 ARG GLY VAL ILE LEU GLN GLU LEU LYS GLU MET ASP ASN
SEQRES 12 N 446 ASP MET THR ASN VAL THR PHE ASP TYR LEU HIS ALA THR
SEQRES 13 N 446 ALA PHE GLN GLY THR ALA LEU ALA ARG THR VAL GLU GLY
SEQRES 14 N 446 THR THR GLU ASN ILE LYS HIS LEU THR ARG ALA ASP LEU
SEQRES 15 N 446 ALA SER TYR ILE ASP THR HIS PHE LYS ALA PRO ARG MET
SEQRES 16 N 446 VAL LEU ALA ALA ALA GLY GLY ILE SER HIS LYS GLU LEU
SEQRES 17 N 446 VAL ASP ALA ALA ARG GLN HIS PHE SER GLY VAL SER PHE
SEQRES 18 N 446 THR TYR LYS GLU ASP ALA VAL PRO ILE LEU PRO ARG CYS
SEQRES 19 N 446 ARG PHE THR GLY SER GLU ILE ARG ALA ARG ASP ASP ALA
SEQRES 20 N 446 LEU PRO VAL ALA HIS VAL ALA LEU ALA VAL GLU GLY PRO
SEQRES 21 N 446 GLY TRP ALA ASP PRO ASP ASN VAL VAL LEU HIS VAL ALA
SEQRES 22 N 446 ASN ALA ILE ILE GLY ARG TYR ASP ARG THR PHE GLY GLY
SEQRES 23 N 446 GLY LYS HIS LEU SER SER ARG LEU ALA ALA LEU ALA VAL
SEQRES 24 N 446 GLU HIS LYS LEU CYS HIS SER PHE GLN THR PHE ASN THR
SEQRES 25 N 446 SER TYR SER ASP THR GLY LEU PHE GLY PHE HIS PHE VAL
SEQRES 26 N 446 ALA ASP PRO LEU SER ILE ASP ASP MET MET PHE CYS ALA
SEQRES 27 N 446 GLN GLY GLU TRP MET ARG LEU CYS THR SER THR THR GLU
SEQRES 28 N 446 SER GLU VAL LYS ARG ALA LYS ASN HIS LEU ARG SER ALA
SEQRES 29 N 446 MET VAL ALA GLN LEU ASP GLY THR THR PRO VAL CYS GLU
SEQRES 30 N 446 THR ILE GLY SER HIS LEU LEU ASN TYR GLY ARG ARG ILE
SEQRES 31 N 446 SER LEU GLU GLU TRP ASP SER ARG ILE SER ALA VAL ASP
SEQRES 32 N 446 ALA ARG MET VAL ARG ASP VAL CYS SER LYS TYR ILE TYR
SEQRES 33 N 446 ASP LYS CYS PRO ALA LEU ALA ALA VAL GLY PRO ILE GLU
SEQRES 34 N 446 GLN LEU LEU ASP TYR ASN ARG ILE ARG SER GLY MET TYR
SEQRES 35 N 446 TRP ILE ARG PHE
SEQRES 1 O 441 SER LEU LYS VAL ALA PRO LYS VAL ALA VAL SER ALA ALA
SEQRES 2 O 441 ALA GLU ARG VAL LYS LEU CYS PRO GLY ALA GLU ASP LEU
SEQRES 3 O 441 GLU ILE THR LYS LEU PRO ASN GLY LEU ILE ILE ALA SER
SEQRES 4 O 441 LEU GLU ASN PHE SER PRO ALA SER ARG ILE GLY VAL PHE
SEQRES 5 O 441 ILE LYS ALA GLY SER ARG TYR GLU THR THR ALA ASN LEU
SEQRES 6 O 441 GLY THR ALA HIS LEU LEU ARG LEU ALA SER PRO LEU THR
SEQRES 7 O 441 THR LYS GLY ALA SER SER PHE ARG ILE THR ARG GLY ILE
SEQRES 8 O 441 GLU ALA VAL GLY GLY SER LEU SER VAL TYR SER THR ARG
SEQRES 9 O 441 GLU LYS MET THR TYR CYS VAL GLU CYS LEU ARG ASP HIS
SEQRES 10 O 441 VAL ASP THR VAL MET GLU TYR LEU LEU ASN VAL THR THR
SEQRES 11 O 441 ALA PRO GLU PHE ARG PRO TRP GLU VAL THR ASP LEU GLN
SEQRES 12 O 441 PRO GLN LEU LYS VAL ASP LYS ALA VAL ALA PHE GLN SER
SEQRES 13 O 441 PRO GLN VAL GLY VAL LEU GLU ASN LEU HIS ALA ALA ALA
SEQRES 14 O 441 TYR LYS THR ALA LEU ALA ASN PRO LEU TYR CYS PRO ASP
SEQRES 15 O 441 TYR ARG ILE GLY LYS ILE THR SER GLU GLN LEU HIS HIS
SEQRES 16 O 441 PHE VAL GLN ASN ASN PHE THR SER ALA ARG MET ALA LEU
SEQRES 17 O 441 VAL GLY ILE GLY VAL LYS HIS SER ASP LEU LYS GLN VAL
SEQRES 18 O 441 ALA GLU GLN PHE LEU ASN ILE ARG SER GLY ALA GLY THR
SEQRES 19 O 441 SER SER ALA LYS ALA THR TYR TRP GLY GLY GLU ILE ARG
SEQRES 20 O 441 GLU GLN ASN GLY HIS SER LEU VAL HIS ALA ALA VAL VAL
SEQRES 21 O 441 THR GLU GLY ALA ALA VAL GLY SER ALA GLU ALA ASN ALA
SEQRES 22 O 441 PHE SER VAL LEU GLN HIS VAL LEU GLY ALA GLY PRO LEU
SEQRES 23 O 441 ILE LYS ARG GLY SER SER VAL THR SER LYS LEU TYR GLN
SEQRES 24 O 441 GLY VAL ALA LYS ALA THR THR GLN PRO PHE ASP ALA SER
SEQRES 25 O 441 ALA PHE ASN VAL ASN TYR SER ASP SER GLY LEU PHE GLY
SEQRES 26 O 441 PHE TYR THR ILE SER GLN ALA ALA HIS ALA GLY GLU VAL
SEQRES 27 O 441 ILE ARG ALA ALA MET ASN GLN LEU LYS ALA ALA ALA GLN
SEQRES 28 O 441 GLY GLY VAL THR GLU GLU ASP VAL THR LYS ALA LYS ASN
SEQRES 29 O 441 GLN LEU LYS ALA THR TYR LEU MET SER VAL GLU THR ALA
SEQRES 30 O 441 GLN GLY LEU LEU ASN GLU ILE GLY SER GLU ALA LEU LEU
SEQRES 31 O 441 SER GLY THR HIS THR ALA PRO SER VAL VAL ALA GLN LYS
SEQRES 32 O 441 ILE ASP SER VAL THR SER ALA ASP VAL VAL ASN ALA ALA
SEQRES 33 O 441 LYS LYS PHE VAL SER GLY LYS LYS SER MET ALA ALA SER
SEQRES 34 O 441 GLY ASP LEU GLY SER THR PRO PHE LEU ASP GLU LEU
SEQRES 1 P 380 MET ALA PRO ASN ILE ARG LYS SER HIS PRO LEU LEU LYS
SEQRES 2 P 380 MET ILE ASN ASN SER LEU ILE ASP LEU PRO ALA PRO SER
SEQRES 3 P 380 ASN ILE SER ALA TRP TRP ASN PHE GLY SER LEU LEU ALA
SEQRES 4 P 380 VAL CYS LEU MET THR GLN ILE LEU THR GLY LEU LEU LEU
SEQRES 5 P 380 ALA MET HIS TYR THR ALA ASP THR SER LEU ALA PHE SER
SEQRES 6 P 380 SER VAL ALA HIS THR CYS ARG ASN VAL GLN TYR GLY TRP
SEQRES 7 P 380 LEU ILE ARG ASN LEU HIS ALA ASN GLY ALA SER PHE PHE
SEQRES 8 P 380 PHE ILE CYS ILE PHE LEU HIS ILE GLY ARG GLY LEU TYR
SEQRES 9 P 380 TYR GLY SER TYR LEU TYR LYS GLU THR TRP ASN THR GLY
SEQRES 10 P 380 VAL ILE LEU LEU LEU THR LEU MET ALA THR ALA PHE VAL
SEQRES 11 P 380 GLY TYR VAL LEU PRO TRP GLY GLN MET SER PHE TRP GLY
SEQRES 12 P 380 ALA THR VAL ILE THR ASN LEU PHE SER ALA ILE PRO TYR
SEQRES 13 P 380 ILE GLY HIS THR LEU VAL GLU TRP ALA TRP GLY GLY PHE
SEQRES 14 P 380 SER VAL ASP ASN PRO THR LEU THR ARG PHE PHE ALA LEU
SEQRES 15 P 380 HIS PHE LEU LEU PRO PHE ALA ILE ALA GLY ILE THR ILE
SEQRES 16 P 380 ILE HIS LEU THR PHE LEU HIS GLU SER GLY SER ASN ASN
SEQRES 17 P 380 PRO LEU GLY ILE SER SER ASP SER ASP LYS ILE PRO PHE
SEQRES 18 P 380 HIS PRO TYR TYR SER PHE LYS ASP ILE LEU GLY LEU THR
SEQRES 19 P 380 LEU MET LEU THR PRO PHE LEU THR LEU ALA LEU PHE SER
SEQRES 20 P 380 PRO ASN LEU LEU GLY ASP PRO GLU ASN PHE THR PRO ALA
SEQRES 21 P 380 ASN PRO LEU VAL THR PRO PRO HIS ILE LYS PRO GLU TRP
SEQRES 22 P 380 TYR PHE LEU PHE ALA TYR ALA ILE LEU ARG SER ILE PRO
SEQRES 23 P 380 ASN LYS LEU GLY GLY VAL LEU ALA LEU ALA ALA SER VAL
SEQRES 24 P 380 LEU ILE LEU PHE LEU ILE PRO PHE LEU HIS LYS SER LYS
SEQRES 25 P 380 GLN ARG THR MET THR PHE ARG PRO LEU SER GLN THR LEU
SEQRES 26 P 380 PHE TRP LEU LEU VAL ALA ASN LEU LEU ILE LEU THR TRP
SEQRES 27 P 380 ILE GLY SER GLN PRO VAL GLU HIS PRO PHE ILE ILE ILE
SEQRES 28 P 380 GLY GLN MET ALA SER LEU SER TYR PHE THR ILE LEU LEU
SEQRES 29 P 380 ILE LEU PHE PRO THR ILE GLY THR LEU GLU ASN LYS MET
SEQRES 30 P 380 LEU ASN TYR
SEQRES 1 Q 241 GLY GLU LEU GLU LEU HIS PRO PRO ALA PHE PRO TRP SER
SEQRES 2 Q 241 HIS GLY GLY PRO LEU SER ALA LEU ASP HIS SER SER VAL
SEQRES 3 Q 241 ARG ARG GLY PHE GLN VAL TYR LYS GLN VAL CYS SER ALA
SEQRES 4 Q 241 CYS HIS SER MET ASP TYR VAL ALA PHE ARG ASN LEU ILE
SEQRES 5 Q 241 GLY VAL THR HIS THR GLU ALA GLU ALA LYS ALA LEU ALA
SEQRES 6 Q 241 GLU GLU VAL GLU VAL GLN ASP GLY PRO ASP GLU ASN GLY
SEQRES 7 Q 241 GLU LEU PHE MET ARG PRO GLY LYS ILE SER ASP TYR PHE
SEQRES 8 Q 241 PRO LYS PRO TYR PRO ASN PRO GLU ALA ALA ARG ALA ALA
SEQRES 9 Q 241 ASN ASN GLY ALA LEU PRO PRO ASP LEU SER TYR ILE VAL
SEQRES 10 Q 241 ASN ALA ARG HIS GLY GLY GLU ASP TYR VAL PHE SER LEU
SEQRES 11 Q 241 LEU THR GLY TYR CYS ASP PRO PRO ALA GLY VAL VAL VAL
SEQRES 12 Q 241 ARG GLU GLY LEU HIS TYR ASN PRO TYR PHE PRO GLY GLN
SEQRES 13 Q 241 ALA ILE GLY MET ALA PRO PRO ILE TYR ASN GLU ILE LEU
SEQRES 14 Q 241 GLU TYR ASP ASP GLY THR PRO ALA THR MET SER GLN ILE
SEQRES 15 Q 241 ALA LYS ASP VAL CYS THR PHE LEU ARG TRP ALA ALA GLU
SEQRES 16 Q 241 PRO GLU HIS ASP GLN ARG LYS ARG MET GLY LEU LYS MET
SEQRES 17 Q 241 LEU LEU ILE SER ALA LEU LEU THR SER LEU LEU TYR TYR
SEQRES 18 Q 241 MET LYS ARG HIS LYS TRP SER VAL LEU LYS SER ARG LYS
SEQRES 19 Q 241 MET ALA TYR ARG PRO PRO LYS
SEQRES 1 R 196 VAL HIS ASN ASP VAL THR VAL PRO ASP PHE SER ALA TYR
SEQRES 2 R 196 ARG ARG GLU ASP VAL MET ASP ALA THR THR SER SER GLN
SEQRES 3 R 196 THR SER SER GLU ASP ARG LYS GLY PHE SER TYR LEU VAL
SEQRES 4 R 196 THR ALA THR ALA CYS VAL ALA THR ALA TYR ALA ALA LYS
SEQRES 5 R 196 ASN VAL VAL THR GLN PHE ILE SER SER LEU SER ALA SER
SEQRES 6 R 196 ALA ASP VAL LEU ALA LEU SER LYS ILE GLU ILE LYS LEU
SEQRES 7 R 196 SER ASP ILE PRO GLU GLY LYS ASN VAL ALA PHE LYS TRP
SEQRES 8 R 196 ARG GLY LYS PRO LEU PHE VAL ARG HIS ARG THR GLN ALA
SEQRES 9 R 196 GLU ILE ASN GLN GLU ALA GLU VAL ASP VAL SER LYS LEU
SEQRES 10 R 196 ARG ASP PRO GLN HIS ASP LEU ASP ARG VAL LYS LYS PRO
SEQRES 11 R 196 GLU TRP VAL ILE LEU VAL GLY VAL CYS THR HIS LEU GLY
SEQRES 12 R 196 CYS VAL PRO ILE ALA ASN SER GLY ASP PHE GLY GLY TYR
SEQRES 13 R 196 TYR CYS PRO CYS HIS GLY SER HIS TYR ASP ALA SER GLY
SEQRES 14 R 196 ARG ILE ARG LYS GLY PRO ALA PRO TYR ASN LEU GLU VAL
SEQRES 15 R 196 PRO THR TYR GLN PHE VAL GLY ASP ASP LEU VAL VAL VAL
SEQRES 16 R 196 GLY
SEQRES 1 S 110 ALA ALA ARG ALA THR VAL ALA GLY GLY GLY ARG LEU MET
SEQRES 2 S 110 ASP ARG ILE ARG LYS TRP TYR TYR ASN ALA ALA GLY PHE
SEQRES 3 S 110 ASN LYS TYR GLY LEU MET ARG ASP ASP THR LEU TYR GLU
SEQRES 4 S 110 ASP ASP ASP VAL LYS GLU ALA LEU LYS ARG LEU PRO GLU
SEQRES 5 S 110 ASP LEU TYR ASN GLU ARG MET PHE ARG ILE LYS ARG ALA
SEQRES 6 S 110 LEU ASP LEU SER LEU LYS HIS ARG ILE LEU PRO LYS GLU
SEQRES 7 S 110 GLN TRP VAL LYS TYR GLU GLU ASP LYS PRO TYR LEU GLU
SEQRES 8 S 110 PRO TYR LEU LYS GLU VAL ILE ARG GLU ARG LEU GLU ARG
SEQRES 9 S 110 GLU ALA TRP ASN LYS LYS
SEQRES 1 T 81 GLY ILE HIS PHE GLY ASN LEU ALA ARG VAL ARG HIS ILE
SEQRES 2 T 81 ILE THR TYR SER LEU SER PRO PHE GLU GLN ARG ALA ILE
SEQRES 3 T 81 PRO ASN ILE PHE SER ASP ALA LEU PRO ASN VAL TRP ARG
SEQRES 4 T 81 ARG PHE SER SER GLN VAL PHE LYS VAL ALA PRO PRO PHE
SEQRES 5 T 81 LEU GLY ALA TYR LEU LEU TYR SER TRP GLY THR GLN GLU
SEQRES 6 T 81 PHE GLU ARG LEU LYS ARG LYS ASN PRO ALA ASP TYR GLU
SEQRES 7 T 81 ASN ASP GLN
SEQRES 1 U 77 LEU ARG GLY SER GLY GLU GLU GLU GLU GLU GLU LEU VAL
SEQRES 2 U 77 ASP PRO LEU THR THR ILE ARG GLU HIS CYS GLU GLN THR
SEQRES 3 U 77 GLU LYS CYS VAL LYS ALA ARG GLU ARG LEU GLU LEU CYS
SEQRES 4 U 77 ASP ALA ARG VAL SER SER ARG SER HIS THR GLU GLU GLN
SEQRES 5 U 77 CYS THR GLU GLU LEU PHE ASP PHE LEU HIS ALA ARG ASP
SEQRES 6 U 77 HIS CYS VAL ALA HIS LYS LEU PHE ASN LYS LEU LYS
SEQRES 1 V 47 UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK UNK
SEQRES 2 V 47 UNK UNK ARG PRO LEU LEU CYS ARG GLU SER MET SER GLY
SEQRES 3 V 47 ARG SER ALA ARG ARG ASP LEU VAL ALA GLY ILE SER LEU
SEQRES 4 V 47 ASN ALA PRO ALA SER VAL ARG TYR
SEQRES 1 W 61 ALA LEU LEU ARG GLN ALA TYR SER ALA LEU PHE ARG ARG
SEQRES 2 W 61 THR SER THR PHE ALA LEU THR VAL VAL LEU GLY ALA VAL
SEQRES 3 W 61 LEU PHE GLU ARG ALA PHE ASP GLN GLY ALA ASP ALA ILE
SEQRES 4 W 61 PHE GLU HIS LEU ASN GLU GLY LYS LEU TRP LYS HIS ILE
SEQRES 5 W 61 LYS HIS LYS TYR GLU ALA SER GLU GLU
HET PEE A2005 50
HET UNL A3015 1
HET HEM C 501 43
HET HEM C 502 43
HET FMX C2001 28
HET UQ C2002 19
HET PEE C2007 48
HET PEE C2008 21
HET AZI C2011 3
HET UNL C2047 1
HET UNL C2046 2
HET UNL C2048 2
HET BOG C3010 12
HET HEC D 501 43
HET CDL D2003 42
HET BOG D2009 20
HET BOG D2091 20
HET FES E 501 4
HET UNL E2012 2
HET CDL G2004 40
HET PEE N3005 50
HET PEE N3008 5
HET HEM P 501 43
HET HEM P 502 43
HET BOG P2010 19
HET FMX P3001 28
HET UQ P3002 19
HET PEE P3007 48
HET AZI P3011 3
HET UNL P3013 1
HET UNL P3014 1
HET UNL P3047 1
HET UNL P3046 2
HET UNL P3048 2
HET HEC Q 501 43
HET CDL Q3003 42
HET BOG Q3009 20
HET BOG Q3091 20
HET UNL Q3012 1
HET FES R 501 4
HET CDL T3004 40
HETNAM PEE PHOSPHATIDYLETHANOLAMINE
HETNAM UNL UNKNOWN LIGAND
HETNAM HEM PROTOPORPHYRIN IX CONTAINING FE
HETNAM FMX FAMOXADONE
HETNAM UQ COENZYME Q10, (2Z,6E,10Z,14E,18E,22E,26Z)-ISOMER
HETNAM AZI AZIDE ION
HETNAM BOG B-OCTYLGLUCOSIDE
HETNAM HEC HEME C
HETNAM CDL CARDIOLIPIN
HETNAM FES FE2/S2 (INORGANIC) CLUSTER
HETSYN PEE D-GLYCEROL-1-[(2-AMINO-ETHYL)PHOSPHATE]-2,3-
HETSYN 2 PEE DIOCTADECANOATE, 2,3-DIOCTADECANOYL-GLYCEROL-1-[(2-
HETSYN 3 PEE AMINO-ETHYL)PHOSPHATE]
HETSYN HEM HEME
HETSYN FMX 5-METHYL-5-(4-PHENOXYPHENYL)-3-(PHENYLAMINO)-2,4-
HETSYN 2 FMX OXAZOLIDINEDIONE
HETSYN CDL DIPHOSPHATIDYL GLYCEROL; BIS-(1,2-DIACYL-SN-GLYCERO-3-
HETSYN 2 CDL PHOSPHO)-1',3'-SN-GLYCEROL
FORMUL 21 PEE 6(C41 H83 N O8 P 1+)
FORMUL 23 HEM 4(C34 H32 FE N4 O4)
FORMUL 25 FMX 2(C22 H18 N2 O4)
FORMUL 26 UQ 2(C59 H90 O4)
FORMUL 29 AZI 2(N3 1-)
FORMUL 33 BOG 6(C14 H28 O6)
FORMUL 34 HEC 2(C34 H34 FE N4 O4)
FORMUL 35 CDL 4(C81 H156 O17 P2 2-)
FORMUL 38 FES 2(FE2 S2)
FORMUL 62 HOH *28(H2 O)
HELIX 1 1 THR A 3 ASN A 10 1 8
HELIX 2 2 GLY A 44 GLU A 48 5 5
HELIX 3 3 GLY A 54 ALA A 63 1 10
HELIX 4 4 PRO A 71 SER A 81 1 11
HELIX 5 5 ASP A 105 ASN A 119 1 15
HELIX 6 6 GLU A 123 ASP A 142 1 20
HELIX 7 7 ASP A 144 PHE A 158 1 15
HELIX 8 8 THR A 170 LEU A 177 1 8
HELIX 9 9 THR A 178 PHE A 190 1 13
HELIX 10 10 LYS A 191 PRO A 193 5 3
HELIX 11 11 SER A 204 PHE A 216 1 13
HELIX 12 12 PRO A 265 GLY A 278 1 14
HELIX 13 13 GLY A 286 LEU A 290 5 5
HELIX 14 14 SER A 292 LYS A 302 1 11
HELIX 15 15 SER A 330 THR A 349 1 20
HELIX 16 16 THR A 350 GLN A 368 1 19
HELIX 17 17 GLY A 371 GLY A 387 1 17
HELIX 18 18 SER A 391 VAL A 402 1 12
HELIX 19 19 ASP A 403 ILE A 415 1 13
HELIX 20 20 ASP A 433 GLY A 440 1 8
HELIX 21 21 GLY B 54 GLU B 58 5 5
HELIX 22 22 THR B 59 LEU B 63 5 5
HELIX 23 23 GLY B 64 ALA B 72 1 9
HELIX 24 24 SER B 81 VAL B 92 1 12
HELIX 25 25 HIS B 115 ALA B 129 1 15
HELIX 26 26 ARG B 133 GLN B 141 1 9
HELIX 27 27 GLN B 141 PHE B 152 1 12
HELIX 28 28 SER B 154 TYR B 168 1 15
HELIX 29 29 THR B 170 ASN B 174 5 5
HELIX 30 30 PRO B 179 ILE B 183 5 5
HELIX 31 31 THR B 187 ASN B 197 1 11
HELIX 32 32 LYS B 212 LEU B 224 1 13
HELIX 33 33 SER B 266 GLY B 280 1 15
HELIX 34 34 SER B 293 THR B 303 1 11
HELIX 35 35 HIS B 332 GLN B 349 1 18
HELIX 36 36 THR B 353 VAL B 372 1 20
HELIX 37 37 THR B 374 SER B 389 1 16
HELIX 38 38 ALA B 394 SER B 404 1 11
HELIX 39 39 THR B 406 GLY B 420 1 15
HELIX 40 40 ASP B 429 THR B 433 5 5
HELIX 41 41 PHE B 435 LEU B 439 5 5
HELIX 42 42 ASN C 4 HIS C 9 1 6
HELIX 43 43 LEU C 11 ILE C 20 1 10
HELIX 44 44 SER C 29 TRP C 32 5 4
HELIX 45 45 ASN C 33 MET C 54 1 22
HELIX 46 46 LEU C 62 VAL C 74 1 13
HELIX 47 47 TYR C 76 TYR C 105 1 30
HELIX 48 48 GLY C 106 LEU C 109 5 4
HELIX 49 49 TYR C 110 LEU C 134 1 25
HELIX 50 50 GLY C 137 SER C 152 1 16
HELIX 51 51 ILE C 157 GLY C 167 1 11
HELIX 52 52 ASP C 172 GLU C 203 1 32
HELIX 53 53 SER C 214 SER C 216 5 3
HELIX 54 54 PHE C 221 SER C 247 1 27
HELIX 55 55 ASP C 253 THR C 258 5 6
HELIX 56 56 GLU C 272 TYR C 274 5 3
HELIX 57 57 PHE C 275 ILE C 285 1 11
HELIX 58 58 ASN C 287 ILE C 305 1 19
HELIX 59 59 PRO C 306 HIS C 309 5 4
HELIX 60 60 ARG C 319 SER C 341 1 23
HELIX 61 61 PRO C 347 ILE C 365 1 19
HELIX 62 62 ILE C 365 LEU C 378 1 14
HELIX 63 63 ASP D 22 VAL D 36 1 15
HELIX 64 64 CYS D 37 CYS D 40 5 4
HELIX 65 65 ALA D 47 ILE D 52 5 6
HELIX 66 66 THR D 57 GLU D 67 1 11
HELIX 67 67 ASN D 97 ALA D 104 1 8
HELIX 68 68 GLY D 122 GLY D 133 1 12
HELIX 69 69 THR D 178 GLU D 195 1 18
HELIX 70 70 GLU D 197 SER D 232 1 36
HELIX 71 71 VAL E 1 VAL E 5 5 5
HELIX 72 72 ARG E 15 MET E 19 5 5
HELIX 73 73 SER E 25 SER E 61 1 37
HELIX 74 74 SER E 65 ALA E 70 1 6
HELIX 75 75 THR E 102 GLU E 109 1 8
HELIX 76 76 ARG F 11 GLY F 25 1 15
HELIX 77 77 PHE F 26 GLY F 30 5 5
HELIX 78 78 MET F 32 LEU F 37 5 6
HELIX 79 79 ASP F 40 LEU F 50 1 11
HELIX 80 80 PRO F 51 HIS F 72 1 22
HELIX 81 81 PRO F 76 TRP F 80 5 5
HELIX 82 82 LYS F 82 ASP F 86 5 5
HELIX 83 83 LEU F 90 ASN F 108 1 19
HELIX 84 84 ASP G 32 LEU G 69 1 38
HELIX 85 85 ASN G 73 TYR G 77 5 5
HELIX 86 86 ASP H 15 GLU H 25 1 11
HELIX 87 87 THR H 27 ARG H 47 1 21
HELIX 88 88 CYS H 54 LEU H 77 1 24
HELIX 89 89 CYS I 51 SER I 56 1 6
HELIX 90 90 ALA J 4 LEU J 13 1 10
HELIX 91 91 ARG J 16 LEU J 46 1 31
HELIX 92 92 LEU J 51 LYS J 56 1 6
HELIX 93 93 HIS J 57 TYR J 59 5 3
HELIX 94 94 THR N 3 ASN N 10 1 8
HELIX 95 95 GLY N 44 GLU N 48 5 5
HELIX 96 96 GLY N 54 ALA N 63 1 10
HELIX 97 97 PRO N 71 SER N 81 1 11
HELIX 98 98 ASP N 105 ASN N 119 1 15
HELIX 99 99 GLU N 123 ASP N 142 1 20
HELIX 100 100 ASP N 144 PHE N 158 1 15
HELIX 101 101 THR N 170 LEU N 177 1 8
HELIX 102 102 THR N 178 PHE N 190 1 13
HELIX 103 103 LYS N 191 PRO N 193 5 3
HELIX 104 104 SER N 204 PHE N 216 1 13
HELIX 105 105 TYR N 223 ALA N 227 5 5
HELIX 106 106 PRO N 265 GLY N 278 1 14
HELIX 107 107 GLY N 286 LEU N 290 5 5
HELIX 108 108 SER N 292 LYS N 302 1 11
HELIX 109 109 SER N 330 THR N 349 1 20
HELIX 110 110 THR N 350 GLN N 368 1 19
HELIX 111 111 GLY N 371 GLY N 387 1 17
HELIX 112 112 SER N 391 VAL N 402 1 12
HELIX 113 113 ASP N 403 ILE N 415 1 13
HELIX 114 114 ASP N 433 GLY N 440 1 8
HELIX 115 115 GLY O 54 GLU O 58 5 5
HELIX 116 116 THR O 59 LEU O 63 5 5
HELIX 117 117 GLY O 64 ALA O 72 1 9
HELIX 118 118 SER O 81 VAL O 92 1 12
HELIX 119 119 HIS O 115 ALA O 129 1 15
HELIX 120 120 ARG O 133 GLN O 141 1 9
HELIX 121 121 GLN O 141 PHE O 152 1 12
HELIX 122 122 SER O 154 TYR O 168 1 15
HELIX 123 123 THR O 170 ASN O 174 5 5
HELIX 124 124 PRO O 179 ILE O 183 5 5
HELIX 125 125 THR O 187 PHE O 199 1 13
HELIX 126 126 LYS O 212 LEU O 224 1 13
HELIX 127 127 ALA O 267 GLY O 280 1 14
HELIX 128 128 SER O 293 THR O 303 1 11
HELIX 129 129 HIS O 332 GLN O 349 1 18
HELIX 130 130 GLU O 355 VAL O 372 1 18
HELIX 131 131 THR O 374 SER O 389 1 16
HELIX 132 132 ALA O 394 SER O 404 1 11
HELIX 133 133 THR O 406 GLY O 420 1 15
HELIX 134 134 ASP O 429 THR O 433 5 5
HELIX 135 135 PHE O 435 LEU O 439 5 5
HELIX 136 136 ASN P 4 HIS P 9 1 6
HELIX 137 137 LEU P 11 ILE P 20 1 10
HELIX 138 138 SER P 29 TRP P 32 5 4
HELIX 139 139 ASN P 33 MET P 54 1 22
HELIX 140 140 LEU P 62 VAL P 74 1 13
HELIX 141 141 TYR P 76 TYR P 105 1 30
HELIX 142 142 GLY P 106 LEU P 109 5 4
HELIX 143 143 TYR P 110 LEU P 134 1 25
HELIX 144 144 GLY P 137 PHE P 151 1 15
HELIX 145 145 SER P 152 ILE P 154 5 3
HELIX 146 146 ILE P 157 GLY P 167 1 11
HELIX 147 147 ASP P 172 HIS P 202 1 31
HELIX 148 148 PHE P 221 SER P 247 1 27
HELIX 149 149 ASP P 253 THR P 258 5 6
HELIX 150 150 GLU P 272 TYR P 274 5 3
HELIX 151 151 PHE P 275 ILE P 285 1 11
HELIX 152 152 ASN P 287 ILE P 301 1 15
HELIX 153 153 LEU P 302 HIS P 309 5 8
HELIX 154 154 ARG P 319 SER P 341 1 23
HELIX 155 155 PRO P 347 ILE P 365 1 19
HELIX 156 156 ILE P 365 LEU P 378 1 14
HELIX 157 157 ASP Q 22 VAL Q 36 1 15
HELIX 158 158 CYS Q 37 CYS Q 40 5 4
HELIX 159 159 ALA Q 47 ILE Q 52 5 6
HELIX 160 160 THR Q 57 GLU Q 67 1 11
HELIX 161 161 ASN Q 97 ALA Q 104 1 8
HELIX 162 162 GLY Q 122 GLY Q 133 1 12
HELIX 163 163 THR Q 178 GLU Q 195 1 18
HELIX 164 164 GLU Q 197 SER Q 232 1 36
HELIX 165 165 VAL R 1 VAL R 5 5 5
HELIX 166 166 ARG R 15 MET R 19 5 5
HELIX 167 167 SER R 25 THR R 27 5 3
HELIX 168 168 SER R 28 SER R 61 1 34
HELIX 169 169 SER R 65 ALA R 70 1 6
HELIX 170 170 ILE R 106 VAL R 112 1 7
HELIX 171 171 LEU S 12 GLY S 25 1 14
HELIX 172 172 PHE S 26 GLY S 30 5 5
HELIX 173 173 ARG S 33 LEU S 37 5 5
HELIX 174 174 ASP S 40 LEU S 50 1 11
HELIX 175 175 PRO S 51 HIS S 72 1 22
HELIX 176 176 LYS S 82 ASP S 86 5 5
HELIX 177 177 LEU S 90 LYS S 110 1 21
HELIX 178 178 ASP T 32 LEU T 69 1 38
HELIX 179 179 ASN T 73 TYR T 77 5 5
HELIX 180 180 ASP U 15 GLU U 25 1 11
HELIX 181 181 THR U 27 ARG U 47 1 21
HELIX 182 182 CYS U 54 LEU U 77 1 24
HELIX 183 183 CYS V 51 SER V 56 1 6
HELIX 184 184 ALA W 4 LEU W 13 1 10
HELIX 185 185 ARG W 16 LEU W 46 1 31
HELIX 186 186 LEU W 51 LYS W 56 1 6
HELIX 187 187 HIS W 57 TYR W 59 5 3
SHEET 1 A 6 THR A 14 THR A 18 0
SHEET 2 A 6 ARG A 24 GLU A 29 -1 O VAL A 25 N THR A 17
SHEET 3 A 6 MET A 195 GLY A 201 1 O LEU A 197 N ARG A 24
SHEET 4 A 6 THR A 34 ILE A 41 -1 N GLY A 38 O ALA A 198
SHEET 5 A 6 THR A 95 LEU A 102 -1 O ALA A 101 N CYS A 35
SHEET 6 A 6 HIS A 85 THR A 90 -1 N TYR A 89 O ALA A 96
SHEET 1 B 8 ARG A 279 ASP A 281 0
SHEET 2 B 8 SER A 306 SER A 313 -1 O PHE A 307 N TYR A 280
SHEET 3 B 8 GLY A 318 ALA A 326 -1 O HIS A 323 N GLN A 308
SHEET 4 B 8 ALA A 251 GLY A 259 -1 N GLY A 259 O GLY A 318
SHEET 5 B 8 ALA A 421 GLY A 426 -1 O VAL A 425 N HIS A 252
SHEET 6 B 8 SER A 239 ASP A 245 1 N ALA A 243 O ALA A 424
SHEET 7 B 8 ARG G 11 LEU G 18 -1 O THR G 15 N ARG A 242
SHEET 8 B 8 LYS D 234 TYR D 237 -1 N LYS D 234 O TYR G 16
SHEET 1 C 8 ILE B 26 LYS B 28 0
SHEET 2 C 8 ILE B 34 ALA B 36 -1 O ILE B 35 N THR B 27
SHEET 3 C 8 MET B 204 VAL B 207 1 O LEU B 206 N ILE B 34
SHEET 4 C 8 ALA B 44 ILE B 51 -1 N GLY B 48 O VAL B 207
SHEET 5 C 8 LYS B 104 LEU B 112 -1 O CYS B 111 N SER B 45
SHEET 6 C 8 SER B 95 THR B 101 -1 N TYR B 99 O THR B 106
SHEET 7 C 8 VAL I 65 SER I 69 -1 O ILE I 68 N VAL B 98
SHEET 8 C 8 SER I 75 ARG I 77 -1 O SER I 75 N GLY I 67
SHEET 1 D 5 GLU B 243 GLN B 247 0
SHEET 2 D 5 LYS B 422 GLY B 428 1 O ALA B 426 N GLU B 246
SHEET 3 D 5 LEU B 252 GLU B 260 -1 N VAL B 258 O SER B 423
SHEET 4 D 5 SER B 319 GLN B 329 -1 O THR B 326 N ALA B 255
SHEET 5 D 5 PHE B 307 TYR B 316 -1 N PHE B 312 O GLY B 323
SHEET 1 E 2 PRO C 23 PRO C 25 0
SHEET 2 E 2 LYS C 218 PRO C 220 -1 O ILE C 219 N ALA C 24
SHEET 1 F 2 GLU D 69 ASP D 72 0
SHEET 2 F 2 PHE D 81 PRO D 84 -1 O ARG D 83 N VAL D 70
SHEET 1 G 2 HIS D 148 TYR D 149 0
SHEET 2 G 2 ALA D 157 ILE D 158 -1 O ILE D 158 N HIS D 148
SHEET 1 H 3 ILE E 74 GLU E 75 0
SHEET 2 H 3 VAL E 194 VAL E 195 -1 O VAL E 195 N ILE E 74
SHEET 3 H 3 TYR E 185 GLN E 186 -1 N GLN E 186 O VAL E 194
SHEET 1 I 3 ASN E 86 TRP E 91 0
SHEET 2 I 3 LYS E 94 HIS E 100 -1 O LEU E 96 N PHE E 89
SHEET 3 I 3 TRP E 132 VAL E 136 -1 O LEU E 135 N PHE E 97
SHEET 1 J 4 ILE E 147 ALA E 148 0
SHEET 2 J 4 GLY E 154 CYS E 158 -1 O TYR E 157 N ILE E 147
SHEET 3 J 4 SER E 163 ASP E 166 -1 O TYR E 165 N TYR E 156
SHEET 4 J 4 ILE E 171 LYS E 173 -1 O LYS E 173 N HIS E 164
SHEET 1 K 6 THR N 14 THR N 18 0
SHEET 2 K 6 ARG N 24 GLU N 29 -1 O VAL N 25 N THR N 17
SHEET 3 K 6 MET N 195 GLY N 201 1 O LEU N 197 N ARG N 24
SHEET 4 K 6 THR N 34 ILE N 41 -1 N GLY N 38 O ALA N 198
SHEET 5 K 6 THR N 95 LEU N 102 -1 O ILE N 99 N VAL N 37
SHEET 6 K 6 HIS N 85 THR N 90 -1 N HIS N 85 O LYS N 100
SHEET 1 L 8 ARG N 279 ASP N 281 0
SHEET 2 L 8 SER N 306 SER N 313 -1 O PHE N 307 N TYR N 280
SHEET 3 L 8 GLY N 318 ALA N 326 -1 O HIS N 323 N GLN N 308
SHEET 4 L 8 ALA N 251 GLY N 259 -1 N GLY N 259 O GLY N 318
SHEET 5 L 8 ALA N 421 GLY N 426 -1 O ALA N 421 N ALA N 256
SHEET 6 L 8 SER N 239 ASP N 245 1 N SER N 239 O LEU N 422
SHEET 7 L 8 ARG T 11 LEU T 18 -1 O THR T 15 N ARG N 242
SHEET 8 L 8 LYS Q 234 TYR Q 237 -1 N LYS Q 234 O TYR T 16
SHEET 1 M 8 ILE O 26 LYS O 28 0
SHEET 2 M 8 ILE O 34 ALA O 36 -1 O ILE O 35 N THR O 27
SHEET 3 M 8 MET O 204 VAL O 207 1 O LEU O 206 N ILE O 34
SHEET 4 M 8 ALA O 44 ILE O 51 -1 N PHE O 50 O ALA O 205
SHEET 5 M 8 LYS O 104 LEU O 112 -1 O TYR O 107 N VAL O 49
SHEET 6 M 8 SER O 95 THR O 101 -1 N TYR O 99 O THR O 106
SHEET 7 M 8 ALA V 66 SER V 69 -1 O ILE V 68 N VAL O 98
SHEET 8 M 8 SER V 75 VAL V 76 -1 O SER V 75 N GLY V 67
SHEET 1 N 5 GLU O 243 GLN O 247 0
SHEET 2 N 5 LYS O 422 GLY O 428 1 O ALA O 426 N GLU O 246
SHEET 3 N 5 LEU O 252 GLU O 260 -1 N VAL O 258 O SER O 423
SHEET 4 N 5 SER O 319 GLN O 329 -1 O THR O 326 N ALA O 255
SHEET 5 N 5 PHE O 307 TYR O 316 -1 N PHE O 312 O GLY O 323
SHEET 1 O 2 PRO P 23 PRO P 25 0
SHEET 2 O 2 LYS P 218 PRO P 220 -1 O ILE P 219 N ALA P 24
SHEET 1 P 2 GLU Q 69 ASP Q 72 0
SHEET 2 P 2 PHE Q 81 PRO Q 84 -1 O ARG Q 83 N VAL Q 70
SHEET 1 Q 2 HIS Q 148 TYR Q 149 0
SHEET 2 Q 2 ALA Q 157 ILE Q 158 -1 O ILE Q 158 N HIS Q 148
SHEET 1 R 2 ILE R 74 GLU R 75 0
SHEET 2 R 2 VAL R 194 VAL R 195 -1 O VAL R 195 N ILE R 74
SHEET 1 S 3 ASN R 86 TRP R 91 0
SHEET 2 S 3 LYS R 94 HIS R 100 -1 O LEU R 96 N PHE R 89
SHEET 3 S 3 TRP R 132 VAL R 136 -1 O LEU R 135 N PHE R 97
SHEET 1 T 3 GLY R 154 CYS R 158 0
SHEET 2 T 3 SER R 163 ASP R 166 -1 O TYR R 165 N TYR R 156
SHEET 3 T 3 ILE R 171 LYS R 173 -1 O LYS R 173 N HIS R 164
SSBOND 1 CYS E 144 CYS E 160 1555 1555 2.03
SSBOND 2 CYS H 24 CYS H 68 1555 1555 2.05
SSBOND 3 CYS H 40 CYS H 54 1555 1555 2.06
SSBOND 4 CYS R 144 CYS R 160 1555 1555 2.03
SSBOND 5 CYS U 24 CYS U 68 1555 1555 2.04
SSBOND 6 CYS U 40 CYS U 54 1555 1555 2.04
LINK NE2 HIS P 84 FE HEM P 501 1555 1555 2.00
LINK NE2 HIS C 183 FE HEM C 501 1555 1555 2.00
LINK NE2 HIS P 183 FE HEM P 501 1555 1555 2.00
LINK NE2 HIS Q 41 FE HEC Q 501 1555 1555 2.00
LINK NE2 HIS D 41 FE HEC D 501 1555 1555 2.00
LINK NE2 HIS C 84 FE HEM C 501 1555 1555 2.01
LINK NE2 HIS C 197 FE HEM C 502 1555 1555 2.01
LINK NE2 HIS P 197 FE HEM P 502 1555 1555 2.01
LINK NE2 HIS P 98 FE HEM P 502 1555 1555 2.01
LINK NE2 HIS C 98 FE HEM C 502 1555 1555 2.02
LINK ND1 HIS E 161 FE2 FES E 501 1555 1555 2.14
LINK ND1 HIS E 141 FE2 FES E 501 1555 1555 2.15
LINK ND1 HIS R 141 FE2 FES R 501 1555 1555 2.16
LINK SD MET D 160 FE HEC D 501 1555 1555 2.16
LINK ND1 HIS R 161 FE2 FES R 501 1555 1555 2.16
LINK SD MET Q 160 FE HEC Q 501 1555 1555 2.19
LINK SG CYS E 139 FE1 FES E 501 1555 1555 2.25
LINK SG CYS R 158 FE1 FES R 501 1555 1555 2.26
LINK SG CYS E 158 FE1 FES E 501 1555 1555 2.26
LINK SG CYS R 139 FE1 FES R 501 1555 1555 2.27
CISPEP 1 HIS C 222 PRO C 223 0 0.30
CISPEP 2 HIS C 346 PRO C 347 0 0.08
CISPEP 3 GLY D 73 PRO D 74 0 0.02
CISPEP 4 HIS P 222 PRO P 223 0 0.28
CISPEP 5 HIS P 346 PRO P 347 0 0.07
CISPEP 6 GLY Q 73 PRO Q 74 0 0.09
SITE 1 AC1 15 GLN C 45 ILE C 46 GLY C 49 LEU C 50
SITE 2 AC1 15 LEU C 52 ALA C 53 ARG C 81 HIS C 84
SITE 3 AC1 15 LEU C 124 GLY C 131 LEU C 134 PRO C 135
SITE 4 AC1 15 HIS C 183 PHE C 184 PRO C 187
SITE 1 AC2 17 TRP C 32 GLY C 35 LEU C 38 HIS C 98
SITE 2 AC2 17 ARG C 101 SER C 107 THR C 113 TRP C 114
SITE 3 AC2 17 GLY C 117 LEU C 120 HIS C 197 LEU C 198
SITE 4 AC2 17 SER C 206 ASN C 207 HOH C 381 HOH C 386
SITE 5 AC2 17 UQ C2002
SITE 1 AC3 15 VAL D 36 CYS D 37 CYS D 40 HIS D 41
SITE 2 AC3 15 ASN D 105 PRO D 110 PRO D 111 ARG D 120
SITE 3 AC3 15 TYR D 126 PHE D 153 ILE D 158 GLY D 159
SITE 4 AC3 15 MET D 160 PRO D 163 ILE D 164
SITE 1 AC4 8 CYS E 139 HIS E 141 LEU E 142 CYS E 144
SITE 2 AC4 8 CYS E 158 HIS E 161 GLY E 162 SER E 163
SITE 1 AC5 16 GLN P 45 ILE P 46 GLY P 49 LEU P 50
SITE 2 AC5 16 LEU P 52 ALA P 53 ARG P 81 HIS P 84
SITE 3 AC5 16 LEU P 124 ALA P 128 GLY P 131 LEU P 134
SITE 4 AC5 16 PRO P 135 HIS P 183 PHE P 184 PRO P 187
SITE 1 AC6 19 TRP P 32 GLY P 35 LEU P 38 HIS P 98
SITE 2 AC6 19 ILE P 99 ARG P 101 SER P 107 THR P 113
SITE 3 AC6 19 TRP P 114 GLY P 117 LEU P 120 HIS P 197
SITE 4 AC6 19 LEU P 198 LEU P 201 SER P 206 ASN P 207
SITE 5 AC6 19 HOH P 381 HOH P 388 UQ P3002
SITE 1 AC7 14 VAL Q 36 CYS Q 37 CYS Q 40 HIS Q 41
SITE 2 AC7 14 PRO Q 110 PRO Q 111 ARG Q 120 TYR Q 126
SITE 3 AC7 14 PHE Q 153 ILE Q 158 GLY Q 159 MET Q 160
SITE 4 AC7 14 PRO Q 163 ILE Q 164
SITE 1 AC8 8 CYS R 139 HIS R 141 LEU R 142 CYS R 144
SITE 2 AC8 8 CYS R 158 HIS R 161 GLY R 162 SER R 163
SITE 1 AC9 10 MET C 125 PHE C 129 TYR C 132 GLY C 143
SITE 2 AC9 10 ILE C 147 ILE C 269 PRO C 271 GLU C 272
SITE 3 AC9 10 TYR C 274 PHE C 275
SITE 1 BC1 10 LEU C 22 ILE C 28 ALA C 39 LEU C 198
SITE 2 BC1 10 HIS C 202 SER C 206 PHE C 221 ASP C 229
SITE 3 BC1 10 HOH C 387 HEM C 502
SITE 1 BC2 10 ALA C 30 GLY C 232 TYR D 220 LYS D 223
SITE 2 BC2 10 ARG D 224 HIS F 72 ARG F 73 ALA G 33
SITE 3 BC2 10 ARG G 40 CDL G2004
SITE 1 BC3 10 SER C 29 ALA C 30 TRP C 31 TYR C 105
SITE 2 BC3 10 PEE C2007 CDL D2003 HIS F 72 ARG G 40
SITE 3 BC3 10 PHE G 41 GLN G 44
SITE 1 BC4 10 TYR A 442 PHE C 227 ILE C 230 PEE C2008
SITE 2 BC4 10 MET D 222 LYS D 226 TYR E 37 THR E 40
SITE 3 BC4 10 CYS E 44 GLU J 32
SITE 1 BC5 13 TRP C 31 PHE C 96 TYR C 104 TYR C 105
SITE 2 BC5 13 PHE C 277 THR C 317 PHE C 326 TRP C 327
SITE 3 BC5 13 LEU C 334 TYR C 359 TYR F 29 VAL G 48
SITE 4 BC5 13 CDL G2004
SITE 1 BC6 6 SER A 439 TYR A 442 PEE A2005 HIS C 222
SITE 2 BC6 6 PHE C 227 ILE C 230
SITE 1 BC7 9 TYR C 76 GLN D 200 ARG D 203 MET D 204
SITE 2 BC7 9 LYS D 207 ILE D 211 BOG D2091 ASN E 53
SITE 3 BC7 9 GLN E 57
SITE 1 BC8 7 HIS D 23 TRP D 192 PRO D 196 ASP D 199
SITE 2 BC8 7 GLN D 200 ARG D 203 BOG D2009
SITE 1 BC9 5 MET P 14 ILE P 15 ASN P 17 SER P 18
SITE 2 BC9 5 THR P 199
SITE 1 CC1 2 ARG C 81 ASN C 256
SITE 1 CC2 9 MET P 125 PHE P 129 TYR P 132 GLY P 143
SITE 2 CC2 9 ILE P 269 PRO P 271 GLU P 272 TYR P 274
SITE 3 CC2 9 PHE P 275
SITE 1 CC3 10 LEU P 22 ILE P 28 ALA P 39 LEU P 198
SITE 2 CC3 10 LEU P 201 HIS P 202 SER P 206 PHE P 221
SITE 3 CC3 10 ASP P 229 HEM P 502
SITE 1 CC4 12 ALA P 30 GLY P 232 TYR Q 220 LYS Q 223
SITE 2 CC4 12 ARG Q 224 HIS S 72 ARG S 73 ILE T 26
SITE 3 CC4 12 ILE T 29 ALA T 33 ARG T 40 CDL T3004
SITE 1 CC5 9 SER P 29 ALA P 30 TRP P 31 TYR P 105
SITE 2 CC5 9 PEE P3007 CDL Q3003 ARG T 40 PHE T 41
SITE 3 CC5 9 GLN T 44
SITE 1 CC6 8 TYR N 442 PHE P 227 ILE P 230 MET Q 222
SITE 2 CC6 8 THR R 40 CYS R 44 THR R 47 GLU W 32
SITE 1 CC7 14 TRP P 31 PHE P 96 TYR P 104 TYR P 105
SITE 2 CC7 14 PHE P 277 THR P 317 PHE P 326 TRP P 327
SITE 3 CC7 14 LEU P 334 TYR P 359 TYR S 29 GLN T 44
SITE 4 CC7 14 VAL T 48 CDL T3004
SITE 1 CC8 2 TYR N 442 HIS P 222
SITE 1 CC9 9 TYR P 76 LEU P 241 GLN Q 200 ARG Q 203
SITE 2 CC9 9 MET Q 204 LYS Q 207 BOG Q3091 ASN R 53
SITE 3 CC9 9 GLN R 57
SITE 1 DC1 2 GLN Q 200 BOG Q3009
SITE 1 DC2 3 LEU C 198 THR C 199 HIS C 202
SITE 1 DC3 2 PHE P 64 ARG P 81
CRYST1 171.893 181.687 240.750 90.00 90.00 90.00 P 21 21 21 8
ORIGX1 1.000000 0.000000 0.000000 0.00000
ORIGX2 0.000000 1.000000 0.000000 0.00000
ORIGX3 0.000000 0.000000 1.000000 0.00000
SCALE1 0.005818 0.000000 0.000000 0.00000
SCALE2 0.000000 0.005504 0.000000 0.00000
SCALE3 0.000000 0.000000 0.004154 0.00000
ATOM 1 N ALA A 2 90.376 82.583 49.846 1.00 83.86 N
ATOM 2 CA ALA A 2 89.039 82.498 49.188 1.00 83.02 C
ATOM 3 C ALA A 2 88.077 83.515 49.802 1.00 82.91 C
ATOM 4 O ALA A 2 87.646 83.379 50.952 1.00 82.20 O
ATOM 5 CB ALA A 2 88.477 81.082 49.325 1.00 82.39 C
ATOM 6 N THR A 3 87.756 84.547 49.029 1.00 83.08 N
ATOM 7 CA THR A 3 86.846 85.583 49.490 1.00 82.50 C
ATOM 8 C THR A 3 85.451 85.320 48.956 1.00 82.68 C
ATOM 9 O THR A 3 85.279 84.622 47.951 1.00 81.57 O
ATOM 10 CB THR A 3 87.287 86.993 49.027 1.00 81.86 C
ATOM 11 OG1 THR A 3 87.340 87.044 47.592 1.00 80.68 O
ATOM 12 CG2 THR A 3 88.638 87.343 49.621 1.00 80.17 C
ATOM 13 N TYR A 4 84.462 85.880 49.643 1.00 83.10 N
ATOM 14 CA TYR A 4 83.073 85.725 49.253 1.00 83.74 C
ATOM 15 C TYR A 4 82.937 85.946 47.744 1.00 83.85 C
ATOM 16 O TYR A 4 82.301 85.151 47.041 1.00 83.18 O
ATOM 17 CB TYR A 4 82.206 86.720 50.041 1.00 84.54 C
ATOM 18 CG TYR A 4 80.748 86.772 49.621 1.00 84.98 C
ATOM 19 CD1 TYR A 4 79.942 85.635 49.656 1.00 85.12 C
ATOM 20 CD2 TYR A 4 80.186 87.960 49.161 1.00 84.59 C
ATOM 21 CE1 TYR A 4 78.614 85.688 49.236 1.00 84.99 C
ATOM 22 CE2 TYR A 4 78.870 88.020 48.745 1.00 84.20 C
ATOM 23 CZ TYR A 4 78.087 86.888 48.780 1.00 84.61 C
ATOM 24 OH TYR A 4 76.779 86.965 48.351 1.00 85.09 O
ATOM 25 N ALA A 5 83.555 87.012 47.243 1.00 83.52 N
ATOM 26 CA ALA A 5 83.485 87.305 45.818 1.00 83.35 C
ATOM 27 C ALA A 5 83.993 86.120 44.997 1.00 83.43 C
ATOM 28 O ALA A 5 83.254 85.523 44.210 1.00 82.38 O
ATOM 29 CB ALA A 5 84.299 88.546 45.503 1.00 83.74 C
ATOM 30 N GLN A 6 85.261 85.780 45.197 1.00 83.65 N
ATOM 31 CA GLN A 6 85.883 84.679 44.476 1.00 83.60 C
ATOM 32 C GLN A 6 85.032 83.413 44.488 1.00 83.13 C
ATOM 33 O GLN A 6 84.876 82.751 43.458 1.00 83.31 O
ATOM 34 CB GLN A 6 87.264 84.392 45.066 1.00 83.40 C
ATOM 35 CG GLN A 6 88.199 85.576 44.977 1.00 83.70 C
ATOM 36 CD GLN A 6 89.471 85.360 45.749 1.00 83.87 C
ATOM 37 OE1 GLN A 6 89.441 85.062 46.941 1.00 84.57 O
ATOM 38 NE2 GLN A 6 90.603 85.513 45.079 1.00 84.41 N
ATOM 39 N THR A 7 84.473 83.076 45.645 1.00 82.41 N
ATOM 40 CA THR A 7 83.644 81.878 45.750 1.00 81.31 C
ATOM 41 C THR A 7 82.392 81.993 44.889 1.00 80.85 C
ATOM 42 O THR A 7 81.884 80.999 44.371 1.00 80.42 O
ATOM 43 CB THR A 7 83.227 81.617 47.197 1.00 80.28 C
ATOM 44 OG1 THR A 7 82.504 82.748 47.690 1.00 80.15 O
ATOM 45 CG2 THR A 7 84.447 81.384 48.063 1.00 79.41 C
ATOM 46 N LEU A 8 81.898 83.212 44.732 1.00 80.72 N
ATOM 47 CA LEU A 8 80.716 83.427 43.920 1.00 81.23 C
ATOM 48 C LEU A 8 81.024 83.268 42.441 1.00 81.57 C
ATOM 49 O LEU A 8 80.203 82.756 41.688 1.00 81.49 O
ATOM 50 CB LEU A 8 80.138 84.820 44.166 1.00 81.64 C
ATOM 51 CG LEU A 8 79.462 85.076 45.514 1.00 81.34 C
ATOM 52 CD1 LEU A 8 78.866 86.477 45.511 1.00 80.15 C
ATOM 53 CD2 LEU A 8 78.376 84.033 45.761 1.00 80.70 C
ATOM 54 N GLN A 9 82.206 83.714 42.029 1.00 82.32 N
ATOM 55 CA GLN A 9 82.614 83.622 40.631 1.00 82.89 C
ATOM 56 C GLN A 9 83.006 82.200 40.237 1.00 83.19 C
ATOM 57 O GLN A 9 82.755 81.769 39.108 1.00 81.91 O
ATOM 58 CB GLN A 9 83.777 84.573 40.381 1.00 83.86 C
ATOM 59 CG GLN A 9 83.448 85.997 40.773 1.00 86.28 C
ATOM 60 CD GLN A 9 84.646 86.921 40.722 1.00 87.90 C
ATOM 61 OE1 GLN A 9 85.636 86.715 41.431 1.00 89.10 O
ATOM 62 NE2 GLN A 9 84.562 87.953 39.886 1.00 87.80 N
ATOM 63 N ASN A 10 83.607 81.467 41.174 1.00 84.02 N
ATOM 64 CA ASN A 10 84.039 80.093 40.906 1.00 84.62 C
ATOM 65 C ASN A 10 82.940 79.037 40.936 1.00 83.02 C
ATOM 66 O ASN A 10 83.215 77.842 40.813 1.00 82.56 O
ATOM 67 CB ASN A 10 85.165 79.685 41.866 1.00 86.18 C
ATOM 68 CG ASN A 10 86.547 79.892 41.258 1.00 88.42 C
ATOM 69 OD1 ASN A 10 86.883 80.998 40.814 1.00 88.96 O
ATOM 70 ND2 ASN A 10 87.356 78.826 41.229 1.00 89.31 N
ATOM 71 N ILE A 11 81.697 79.467 41.098 1.00 81.33 N
ATOM 72 CA ILE A 11 80.610 78.509 41.118 1.00 80.09 C
ATOM 73 C ILE A 11 80.319 78.048 39.701 1.00 79.16 C
ATOM 74 O ILE A 11 80.182 78.858 38.786 1.00 79.57 O
ATOM 75 CB ILE A 11 79.326 79.101 41.727 1.00 79.37 C
ATOM 76 CG1 ILE A 11 79.512 79.295 43.236 1.00 78.57 C
ATOM 77 CG2 ILE A 11 78.142 78.183 41.431 1.00 78.43 C
ATOM 78 CD1 ILE A 11 78.240 79.682 43.973 1.00 77.75 C
ATOM 79 N PRO A 12 80.233 76.732 39.500 1.00 78.00 N
ATOM 80 CA PRO A 12 79.951 76.207 38.167 1.00 77.90 C
ATOM 81 C PRO A 12 78.742 76.884 37.558 1.00 77.83 C
ATOM 82 O PRO A 12 77.742 77.118 38.228 1.00 78.37 O
ATOM 83 CB PRO A 12 79.726 74.718 38.417 1.00 77.82 C
ATOM 84 CG PRO A 12 79.305 74.665 39.864 1.00 77.99 C
ATOM 85 CD PRO A 12 80.234 75.654 40.498 1.00 77.58 C
ATOM 86 N GLU A 13 78.846 77.205 36.279 1.00 77.93 N
ATOM 87 CA GLU A 13 77.768 77.865 35.564 1.00 78.15 C
ATOM 88 C GLU A 13 76.602 76.909 35.320 1.00 76.62 C
ATOM 89 O GLU A 13 76.758 75.689 35.398 1.00 76.08 O
ATOM 90 CB GLU A 13 78.308 78.404 34.240 1.00 80.81 C
ATOM 91 CG GLU A 13 77.377 79.334 33.504 1.00 83.87 C
ATOM 92 CD GLU A 13 78.116 80.201 32.502 1.00 86.01 C
ATOM 93 OE1 GLU A 13 78.691 79.650 31.532 1.00 86.60 O
ATOM 94 OE2 GLU A 13 78.125 81.439 32.696 1.00 87.41 O
ATOM 95 N THR A 14 75.430 77.468 35.035 1.00 74.85 N
ATOM 96 CA THR A 14 74.245 76.655 34.784 1.00 73.38 C
ATOM 97 C THR A 14 74.027 76.508 33.277 1.00 72.95 C
ATOM 98 O THR A 14 73.817 77.492 32.567 1.00 73.16 O
ATOM 99 CB THR A 14 73.003 77.285 35.451 1.00 72.16 C
ATOM 100 OG1 THR A 14 73.241 77.412 36.859 1.00 71.54 O
ATOM 101 CG2 THR A 14 71.772 76.424 35.227 1.00 70.25 C
ATOM 102 N ASN A 15 74.081 75.270 32.796 1.00 72.31 N
ATOM 103 CA ASN A 15 73.924 74.995 31.369 1.00 71.48 C
ATOM 104 C ASN A 15 72.484 74.807 30.959 1.00 70.25 C
ATOM 105 O ASN A 15 71.710 74.147 31.644 1.00 69.67 O
ATOM 106 CB ASN A 15 74.715 73.742 30.967 1.00 72.58 C
ATOM 107 CG ASN A 15 76.156 73.798 31.408 1.00 73.06 C
ATOM 108 OD1 ASN A 15 76.893 74.726 31.051 1.00 72.18 O
ATOM 109 ND2 ASN A 15 76.571 72.807 32.199 1.00 73.38 N
ATOM 110 N VAL A 16 72.147 75.376 29.812 1.00 70.03 N
ATOM 111 CA VAL A 16 70.804 75.291 29.279 1.00 70.40 C
ATOM 112 C VAL A 16 70.848 74.926 27.802 1.00 71.30 C
ATOM 113 O VAL A 16 71.687 75.418 27.050 1.00 72.33 O
ATOM 114 CB VAL A 16 70.074 76.643 29.413 1.00 69.85 C
ATOM 115 CG1 VAL A 16 68.642 76.514 28.912 1.00 69.47 C
ATOM 116 CG2 VAL A 16 70.120 77.120 30.857 1.00 68.75 C
ATOM 117 N THR A 17 69.946 74.054 27.387 1.00 71.37 N
ATOM 118 CA THR A 17 69.870 73.655 25.996 1.00 71.88 C
ATOM 119 C THR A 17 68.402 73.336 25.716 1.00 72.14 C
ATOM 120 O THR A 17 67.715 72.729 26.541 1.00 72.65 O
ATOM 121 CB THR A 17 70.783 72.427 25.713 1.00 72.03 C
ATOM 122 OG1 THR A 17 70.423 71.346 26.576 1.00 73.16 O
ATOM 123 CG2 THR A 17 72.247 72.776 25.970 1.00 71.75 C
ATOM 124 N THR A 18 67.909 73.763 24.565 1.00 71.73 N
ATOM 125 CA THR A 18 66.510 73.528 24.234 1.00 71.64 C
ATOM 126 C THR A 18 66.351 72.447 23.168 1.00 71.68 C
ATOM 127 O THR A 18 67.129 72.382 22.221 1.00 72.01 O
ATOM 128 CB THR A 18 65.840 74.844 23.743 1.00 71.62 C
ATOM 129 OG1 THR A 18 66.083 75.892 24.696 1.00 69.24 O
ATOM 130 CG2 THR A 18 64.331 74.652 23.564 1.00 69.87 C
ATOM 131 N LEU A 19 65.347 71.593 23.331 1.00 71.50 N
ATOM 132 CA LEU A 19 65.096 70.534 22.365 1.00 71.97 C
ATOM 133 C LEU A 19 64.196 71.098 21.269 1.00 73.53 C
ATOM 134 O LEU A 19 63.728 72.228 21.373 1.00 73.95 O
ATOM 135 CB LEU A 19 64.421 69.342 23.047 1.00 69.32 C
ATOM 136 CG LEU A 19 65.063 68.810 24.335 1.00 67.42 C
ATOM 137 CD1 LEU A 19 64.521 67.407 24.620 1.00 64.74 C
ATOM 138 CD2 LEU A 19 66.587 68.787 24.209 1.00 65.18 C
ATOM 139 N ASP A 20 63.961 70.327 20.214 1.00 75.63 N
ATOM 140 CA ASP A 20 63.112 70.810 19.127 1.00 77.60 C
ATOM 141 C ASP A 20 61.656 70.926 19.567 1.00 77.99 C
ATOM 142 O ASP A 20 60.912 71.777 19.072 1.00 78.19 O
ATOM 143 CB ASP A 20 63.177 69.878 17.908 1.00 79.89 C
ATOM 144 CG ASP A 20 64.587 69.723 17.348 1.00 82.19 C
ATOM 145 OD1 ASP A 20 65.331 70.733 17.252 1.00 81.88 O
ATOM 146 OD2 ASP A 20 64.938 68.577 16.982 1.00 83.06 O
ATOM 147 N ASN A 21 61.250 70.060 20.492 1.00 77.75 N
ATOM 148 CA ASN A 21 59.876 70.061 20.978 1.00 76.78 C
ATOM 149 C ASN A 21 59.586 71.281 21.846 1.00 76.57 C
ATOM 150 O ASN A 21 58.433 71.524 22.224 1.00 76.76 O
ATOM 151 CB ASN A 21 59.579 68.770 21.752 1.00 75.76 C
ATOM 152 CG ASN A 21 60.523 68.554 22.916 1.00 75.29 C
ATOM 153 OD1 ASN A 21 61.429 69.358 23.159 1.00 74.85 O
ATOM 154 ND2 ASN A 21 60.317 67.458 23.645 1.00 74.30 N
ATOM 155 N GLY A 22 60.631 72.046 22.155 1.00 75.07 N
ATOM 156 CA GLY A 22 60.453 73.244 22.953 1.00 75.11 C
ATOM 157 C GLY A 22 60.832 73.136 24.418 1.00 75.24 C
ATOM 158 O GLY A 22 60.881 74.151 25.128 1.00 75.61 O
ATOM 159 N LEU A 23 61.093 71.918 24.887 1.00 74.44 N
ATOM 160 CA LEU A 23 61.466 71.731 26.282 1.00 72.86 C
ATOM 161 C LEU A 23 62.863 72.273 26.531 1.00 71.40 C
ATOM 162 O LEU A 23 63.701 72.283 25.636 1.00 70.85 O
ATOM 163 CB LEU A 23 61.395 70.255 26.662 1.00 72.60 C
ATOM 164 CG LEU A 23 61.762 69.947 28.111 1.00 72.86 C
ATOM 165 CD1 LEU A 23 61.021 68.703 28.545 1.00 73.26 C
ATOM 166 CD2 LEU A 23 63.273 69.775 28.256 1.00 72.99 C
ATOM 167 N ARG A 24 63.098 72.743 27.750 1.00 70.48 N
ATOM 168 CA ARG A 24 64.394 73.290 28.125 1.00 69.86 C
ATOM 169 C ARG A 24 65.064 72.418 29.167 1.00 69.54 C
ATOM 170 O ARG A 24 64.431 72.001 30.137 1.00 70.48 O
ATOM 171 CB ARG A 24 64.231 74.699 28.679 1.00 69.88 C
ATOM 172 CG ARG A 24 64.189 75.774 27.625 1.00 68.88 C
ATOM 173 CD ARG A 24 63.748 77.066 28.246 1.00 68.30 C
ATOM 174 NE ARG A 24 62.372 76.942 28.709 1.00 68.88 N
ATOM 175 CZ ARG A 24 61.710 77.886 29.367 1.00 67.10 C
ATOM 176 NH1 ARG A 24 62.305 79.038 29.648 1.00 66.80 N
ATOM 177 NH2 ARG A 24 60.449 77.675 29.731 1.00 64.48 N
ATOM 178 N VAL A 25 66.346 72.138 28.962 1.00 68.00 N
ATOM 179 CA VAL A 25 67.083 71.303 29.893 1.00 65.71 C
ATOM 180 C VAL A 25 68.216 72.112 30.474 1.00 65.03 C
ATOM 181 O VAL A 25 69.068 72.618 29.746 1.00 64.68 O
ATOM 182 CB VAL A 25 67.640 70.034 29.196 1.00 64.42 C
ATOM 183 CG1 VAL A 25 68.382 69.166 30.205 1.00 63.96 C
ATOM 184 CG2 VAL A 25 66.504 69.244 28.566 1.00 62.29 C
ATOM 185 N ALA A 26 68.209 72.248 31.795 1.00 65.61 N
ATOM 186 CA ALA A 26 69.244 73.008 32.485 1.00 66.40 C
ATOM 187 C ALA A 26 69.731 72.239 33.689 1.00 66.42 C
ATOM 188 O ALA A 26 68.990 71.444 34.267 1.00 66.40 O
ATOM 189 CB ALA A 26 68.710 74.369 32.920 1.00 66.66 C
ATOM 190 N SER A 27 70.978 72.485 34.070 1.00 67.02 N
ATOM 191 CA SER A 27 71.556 71.793 35.209 1.00 68.40 C
ATOM 192 C SER A 27 72.826 72.469 35.674 1.00 68.95 C
ATOM 193 O SER A 27 73.491 73.143 34.894 1.00 68.70 O
ATOM 194 CB SER A 27 71.868 70.352 34.822 1.00 68.89 C
ATOM 195 OG SER A 27 72.677 70.315 33.656 1.00 69.90 O
ATOM 196 N GLU A 28 73.145 72.297 36.954 1.00 70.58 N
ATOM 197 CA GLU A 28 74.357 72.861 37.525 1.00 73.28 C
ATOM 198 C GLU A 28 75.161 71.673 38.006 1.00 75.04 C
ATOM 199 O GLU A 28 74.660 70.848 38.772 1.00 75.14 O
ATOM 200 CB GLU A 28 74.045 73.794 38.691 1.00 73.84 C
ATOM 201 CG GLU A 28 75.298 74.358 39.348 1.00 77.17 C
ATOM 202 CD GLU A 28 75.018 75.505 40.322 1.00 79.70 C
ATOM 203 OE1 GLU A 28 74.571 76.587 39.864 1.00 79.61 O
ATOM 204 OE2 GLU A 28 75.250 75.323 41.545 1.00 79.69 O
ATOM 205 N GLU A 29 76.408 71.595 37.552 1.00 77.07 N
ATOM 206 CA GLU A 29 77.291 70.484 37.883 1.00 79.12 C
ATOM 207 C GLU A 29 78.158 70.645 39.130 1.00 79.13 C
ATOM 208 O GLU A 29 78.737 71.700 39.366 1.00 78.99 O
ATOM 209 CB GLU A 29 78.187 70.188 36.669 1.00 81.04 C
ATOM 210 CG GLU A 29 79.230 69.080 36.862 1.00 81.99 C
ATOM 211 CD GLU A 29 78.975 67.871 35.978 1.00 82.41 C
ATOM 212 OE1 GLU A 29 78.853 68.045 34.746 1.00 81.98 O
ATOM 213 OE2 GLU A 29 78.899 66.745 36.519 1.00 83.23 O
ATOM 214 N SER A 30 78.230 69.580 39.921 1.00 79.42 N
ATOM 215 CA SER A 30 79.052 69.551 41.123 1.00 80.96 C
ATOM 216 C SER A 30 79.714 68.179 41.141 1.00 82.73 C
ATOM 217 O SER A 30 79.570 67.398 40.191 1.00 82.89 O
ATOM 218 CB SER A 30 78.204 69.718 42.382 1.00 80.32 C
ATOM 219 OG SER A 30 77.466 68.540 42.671 1.00 79.34 O
ATOM 220 N SER A 31 80.432 67.878 42.218 1.00 83.63 N
ATOM 221 CA SER A 31 81.100 66.586 42.334 1.00 84.31 C
ATOM 222 C SER A 31 80.418 65.699 43.376 1.00 83.61 C
ATOM 223 O SER A 31 81.081 64.986 44.132 1.00 83.36 O
ATOM 224 CB SER A 31 82.570 66.801 42.698 1.00 85.55 C
ATOM 225 OG SER A 31 82.690 67.684 43.802 1.00 87.47 O
ATOM 226 N GLN A 32 79.086 65.736 43.397 1.00 82.94 N
ATOM 227 CA GLN A 32 78.313 64.949 44.355 1.00 81.88 C
ATOM 228 C GLN A 32 77.733 63.640 43.845 1.00 79.39 C
ATOM 229 O GLN A 32 76.987 63.613 42.869 1.00 78.30 O
ATOM 230 CB GLN A 32 77.183 65.788 44.929 1.00 83.70 C
ATOM 231 CG GLN A 32 77.661 66.895 45.823 1.00 86.28 C
ATOM 232 CD GLN A 32 76.530 67.492 46.601 1.00 87.10 C
ATOM 233 OE1 GLN A 32 75.565 67.989 46.022 1.00 88.34 O
ATOM 234 NE2 GLN A 32 76.629 67.441 47.925 1.00 86.99 N
ATOM 235 N PRO A 33 78.045 62.538 44.541 1.00 77.75 N
ATOM 236 CA PRO A 33 77.591 61.182 44.215 1.00 77.01 C
ATOM 237 C PRO A 33 76.080 61.099 44.201 1.00 76.86 C
ATOM 238 O PRO A 33 75.480 60.165 43.662 1.00 76.62 O
ATOM 239 CB PRO A 33 78.187 60.350 45.339 1.00 77.16 C
ATOM 240 CG PRO A 33 78.180 61.314 46.500 1.00 76.14 C
ATOM 241 CD PRO A 33 78.710 62.565 45.858 1.00 76.44 C
ATOM 242 N THR A 34 75.471 62.099 44.814 1.00 77.18 N
ATOM 243 CA THR A 34 74.028 62.168 44.912 1.00 76.21 C
ATOM 244 C THR A 34 73.526 63.368 44.113 1.00 74.29 C
ATOM 245 O THR A 34 74.241 64.355 43.950 1.00 73.82 O
ATOM 246 CB THR A 34 73.620 62.271 46.403 1.00 76.84 C
ATOM 247 OG1 THR A 34 72.197 62.356 46.502 1.00 78.61 O
ATOM 248 CG2 THR A 34 74.279 63.485 47.068 1.00 75.60 C
ATOM 249 N CYS A 35 72.305 63.275 43.597 1.00 73.33 N
ATOM 250 CA CYS A 35 71.736 64.373 42.809 1.00 72.34 C
ATOM 251 C CYS A 35 70.206 64.467 42.882 1.00 70.89 C
ATOM 252 O CYS A 35 69.532 63.605 43.456 1.00 70.49 O
ATOM 253 CB CYS A 35 72.135 64.227 41.334 1.00 72.22 C
ATOM 254 SG CYS A 35 71.139 62.989 40.414 1.00 69.91 S
ATOM 255 N THR A 36 69.674 65.530 42.290 1.00 68.73 N
ATOM 256 CA THR A 36 68.240 65.741 42.230 1.00 67.40 C
ATOM 257 C THR A 36 67.930 66.178 40.817 1.00 66.51 C
ATOM 258 O THR A 36 68.650 66.995 40.242 1.00 65.92 O
ATOM 259 CB THR A 36 67.763 66.876 43.172 1.00 67.75 C
ATOM 260 OG1 THR A 36 68.095 66.560 44.526 1.00 69.42 O
ATOM 261 CG2 THR A 36 66.259 67.061 43.060 1.00 66.11 C
ATOM 262 N VAL A 37 66.878 65.615 40.242 1.00 66.04 N
ATOM 263 CA VAL A 37 66.463 66.019 38.907 1.00 67.48 C
ATOM 264 C VAL A 37 64.941 65.975 38.887 1.00 66.75 C
ATOM 265 O VAL A 37 64.325 65.130 39.545 1.00 65.31 O
ATOM 266 CB VAL A 37 67.044 65.097 37.761 1.00 68.45 C
ATOM 267 CG1 VAL A 37 68.514 64.839 37.992 1.00 67.89 C
ATOM 268 CG2 VAL A 37 66.274 63.796 37.662 1.00 69.34 C
ATOM 269 N GLY A 38 64.340 66.901 38.148 1.00 66.55 N
ATOM 270 CA GLY A 38 62.893 66.948 38.067 1.00 66.06 C
ATOM 271 C GLY A 38 62.425 67.897 36.990 1.00 64.82 C
ATOM 272 O GLY A 38 63.221 68.636 36.408 1.00 64.23 O
ATOM 273 N VAL A 39 61.129 67.871 36.715 1.00 63.81 N
ATOM 274 CA VAL A 39 60.568 68.740 35.699 1.00 63.55 C
ATOM 275 C VAL A 39 59.657 69.796 36.329 1.00 62.60 C
ATOM 276 O VAL A 39 58.677 69.474 37.007 1.00 62.33 O
ATOM 277 CB VAL A 39 59.794 67.911 34.623 1.00 64.38 C
ATOM 278 CG1 VAL A 39 58.776 67.019 35.274 1.00 65.37 C
ATOM 279 CG2 VAL A 39 59.110 68.839 33.632 1.00 66.04 C
ATOM 280 N TRP A 40 60.016 71.060 36.122 1.00 61.16 N
ATOM 281 CA TRP A 40 59.254 72.187 36.639 1.00 60.03 C
ATOM 282 C TRP A 40 58.310 72.694 35.556 1.00 58.64 C
ATOM 283 O TRP A 40 58.734 73.242 34.548 1.00 57.98 O
ATOM 284 CB TRP A 40 60.206 73.296 37.096 1.00 61.50 C
ATOM 285 CG TRP A 40 60.634 73.153 38.539 1.00 63.30 C
ATOM 286 CD1 TRP A 40 60.130 73.836 39.610 1.00 63.12 C
ATOM 287 CD2 TRP A 40 61.608 72.240 39.071 1.00 63.41 C
ATOM 288 NE1 TRP A 40 60.723 73.406 40.772 1.00 62.63 N
ATOM 289 CE2 TRP A 40 61.635 72.428 40.473 1.00 63.74 C
ATOM 290 CE3 TRP A 40 62.456 71.282 38.503 1.00 63.83 C
ATOM 291 CZ2 TRP A 40 62.480 71.691 41.317 1.00 63.01 C
ATOM 292 CZ3 TRP A 40 63.297 70.547 39.346 1.00 64.29 C
ATOM 293 CH2 TRP A 40 63.299 70.761 40.739 1.00 63.35 C
ATOM 294 N ILE A 41 57.018 72.486 35.774 1.00 58.25 N
ATOM 295 CA ILE A 41 55.998 72.894 34.822 1.00 57.48 C
ATOM 296 C ILE A 41 55.386 74.251 35.179 1.00 58.20 C
ATOM 297 O ILE A 41 55.148 74.556 36.350 1.00 59.45 O
ATOM 298 CB ILE A 41 54.861 71.842 34.754 1.00 55.62 C
ATOM 299 CG1 ILE A 41 55.454 70.448 34.558 1.00 53.45 C
ATOM 300 CG2 ILE A 41 53.914 72.164 33.603 1.00 55.28 C
ATOM 301 CD1 ILE A 41 54.423 69.360 34.453 1.00 51.66 C
ATOM 302 N GLY A 42 55.152 75.070 34.160 1.00 57.98 N
ATOM 303 CA GLY A 42 54.541 76.365 34.376 1.00 56.50 C
ATOM 304 C GLY A 42 53.046 76.145 34.318 1.00 57.50 C
ATOM 305 O GLY A 42 52.391 76.518 33.347 1.00 56.80 O
ATOM 306 N ALA A 43 52.513 75.486 35.344 1.00 58.74 N
ATOM 307 CA ALA A 43 51.078 75.212 35.434 1.00 59.46 C
ATOM 308 C ALA A 43 50.651 75.333 36.894 1.00 60.06 C
ATOM 309 O ALA A 43 51.499 75.358 37.796 1.00 60.95 O
ATOM 310 CB ALA A 43 50.764 73.825 34.906 1.00 59.20 C
ATOM 311 N GLY A 44 49.341 75.414 37.119 1.00 59.34 N
ATOM 312 CA GLY A 44 48.825 75.561 38.469 1.00 57.48 C
ATOM 313 C GLY A 44 47.386 76.048 38.495 1.00 55.87 C
ATOM 314 O GLY A 44 46.761 76.239 37.448 1.00 56.50 O
ATOM 315 N SER A 45 46.861 76.261 39.697 1.00 53.48 N
ATOM 316 CA SER A 45 45.479 76.702 39.875 1.00 49.17 C
ATOM 317 C SER A 45 45.103 77.932 39.045 1.00 46.29 C
ATOM 318 O SER A 45 43.973 78.033 38.553 1.00 43.52 O
ATOM 319 CB SER A 45 45.227 76.978 41.350 1.00 49.11 C
ATOM 320 OG SER A 45 46.211 77.871 41.841 1.00 49.21 O
ATOM 321 N ARG A 46 46.041 78.862 38.875 1.00 43.41 N
ATOM 322 CA ARG A 46 45.730 80.053 38.102 1.00 42.01 C
ATOM 323 C ARG A 46 45.310 79.701 36.676 1.00 44.31 C
ATOM 324 O ARG A 46 44.537 80.432 36.065 1.00 46.46 O
ATOM 325 CB ARG A 46 46.912 81.023 38.075 1.00 37.85 C
ATOM 326 CG ARG A 46 46.572 82.327 37.348 1.00 36.93 C
ATOM 327 CD ARG A 46 47.708 83.368 37.374 1.00 36.74 C
ATOM 328 NE ARG A 46 47.362 84.526 36.546 1.00 37.39 N
ATOM 329 CZ ARG A 46 48.086 85.641 36.446 1.00 38.46 C
ATOM 330 NH1 ARG A 46 49.219 85.774 37.129 1.00 36.21 N
ATOM 331 NH2 ARG A 46 47.678 86.627 35.646 1.00 37.04 N
ATOM 332 N TYR A 47 45.818 78.585 36.153 1.00 44.83 N
ATOM 333 CA TYR A 47 45.488 78.144 34.804 1.00 44.94 C
ATOM 334 C TYR A 47 44.132 77.443 34.762 1.00 47.20 C
ATOM 335 O TYR A 47 43.566 77.242 33.687 1.00 47.04 O
ATOM 336 CB TYR A 47 46.562 77.179 34.262 1.00 43.37 C
ATOM 337 CG TYR A 47 47.916 77.811 34.041 1.00 39.93 C
ATOM 338 CD1 TYR A 47 48.803 78.000 35.101 1.00 38.54 C
ATOM 339 CD2 TYR A 47 48.283 78.282 32.780 1.00 37.77 C
ATOM 340 CE1 TYR A 47 50.023 78.652 34.910 1.00 37.80 C
ATOM 341 CE2 TYR A 47 49.493 78.934 32.579 1.00 36.74 C
ATOM 342 CZ TYR A 47 50.353 79.119 33.644 1.00 37.78 C
ATOM 343 OH TYR A 47 51.518 79.814 33.443 1.00 40.32 O
ATOM 344 N GLU A 48 43.615 77.059 35.925 1.00 49.13 N
ATOM 345 CA GLU A 48 42.336 76.374 35.969 1.00 51.08 C
ATOM 346 C GLU A 48 41.224 77.408 35.942 1.00 52.19 C
ATOM 347 O GLU A 48 41.480 78.607 35.938 1.00 49.69 O
ATOM 348 CB GLU A 48 42.226 75.532 37.240 1.00 53.75 C
ATOM 349 CG GLU A 48 43.502 74.788 37.613 1.00 59.04 C
ATOM 350 CD GLU A 48 43.393 74.061 38.944 1.00 62.93 C
ATOM 351 OE1 GLU A 48 42.807 74.632 39.891 1.00 64.67 O
ATOM 352 OE2 GLU A 48 43.907 72.925 39.051 1.00 66.18 O
ATOM 353 N ASN A 49 39.986 76.930 35.899 1.00 54.90 N
ATOM 354 CA ASN A 49 38.826 77.803 35.908 1.00 56.42 C
ATOM 355 C ASN A 49 37.792 77.251 36.880 1.00 58.98 C
ATOM 356 O ASN A 49 38.063 76.302 37.621 1.00 59.49 O
ATOM 357 CB ASN A 49 38.232 77.916 34.514 1.00 56.29 C
ATOM 358 CG ASN A 49 37.834 76.585 33.944 1.00 57.48 C
ATOM 359 OD1 ASN A 49 38.251 76.238 32.842 1.00 59.30 O
ATOM 360 ND2 ASN A 49 37.012 75.831 34.678 1.00 56.13 N
ATOM 361 N GLU A 50 36.608 77.849 36.873 1.00 62.09 N
ATOM 362 CA GLU A 50 35.523 77.453 37.766 1.00 64.44 C
ATOM 363 C GLU A 50 35.163 75.967 37.731 1.00 63.54 C
ATOM 364 O GLU A 50 34.819 75.388 38.760 1.00 63.21 O
ATOM 365 CB GLU A 50 34.279 78.284 37.448 1.00 68.86 C
ATOM 366 CG GLU A 50 33.106 78.044 38.378 1.00 76.73 C
ATOM 367 CD GLU A 50 31.851 78.800 37.944 1.00 82.22 C
ATOM 368 OE1 GLU A 50 31.913 80.051 37.824 1.00 84.37 O
ATOM 369 OE2 GLU A 50 30.803 78.145 37.723 1.00 84.18 O
ATOM 370 N LYS A 51 35.256 75.345 36.561 1.00 62.57 N
ATOM 371 CA LYS A 51 34.899 73.933 36.429 1.00 62.38 C
ATOM 372 C LYS A 51 35.992 72.914 36.779 1.00 60.62 C
ATOM 373 O LYS A 51 35.695 71.839 37.301 1.00 59.14 O
ATOM 374 CB LYS A 51 34.406 73.674 35.007 1.00 65.12 C
ATOM 375 CG LYS A 51 33.384 74.695 34.526 1.00 68.87 C
ATOM 376 CD LYS A 51 33.114 74.543 33.038 1.00 71.98 C
ATOM 377 CE LYS A 51 32.329 75.727 32.496 1.00 73.91 C
ATOM 378 NZ LYS A 51 32.160 75.630 31.015 1.00 76.41 N
ATOM 379 N ASN A 52 37.250 73.250 36.497 1.00 59.51 N
ATOM 380 CA ASN A 52 38.365 72.342 36.768 1.00 57.89 C
ATOM 381 C ASN A 52 39.320 72.820 37.859 1.00 56.47 C
ATOM 382 O ASN A 52 40.501 72.492 37.840 1.00 55.49 O
ATOM 383 CB ASN A 52 39.162 72.102 35.483 1.00 57.41 C
ATOM 384 CG ASN A 52 39.975 73.310 35.073 1.00 58.11 C
ATOM 385 OD1 ASN A 52 39.588 74.453 35.338 1.00 59.01 O
ATOM 386 ND2 ASN A 52 41.100 73.069 34.409 1.00 56.86 N
ATOM 387 N ASN A 53 38.818 73.604 38.804 1.00 56.28 N
ATOM 388 CA ASN A 53 39.657 74.087 39.897 1.00 54.50 C
ATOM 389 C ASN A 53 39.961 72.877 40.781 1.00 52.97 C
ATOM 390 O ASN A 53 39.055 72.154 41.187 1.00 51.21 O
ATOM 391 CB ASN A 53 38.912 75.152 40.705 1.00 55.46 C
ATOM 392 CG ASN A 53 39.791 75.829 41.752 1.00 55.90 C
ATOM 393 OD1 ASN A 53 39.287 76.487 42.662 1.00 57.85 O
ATOM 394 ND2 ASN A 53 41.104 75.684 41.619 1.00 54.25 N
ATOM 395 N GLY A 54 41.238 72.657 41.070 1.00 52.27 N
ATOM 396 CA GLY A 54 41.617 71.525 41.890 1.00 51.53 C
ATOM 397 C GLY A 54 41.971 70.314 41.045 1.00 51.71 C
ATOM 398 O GLY A 54 42.111 69.197 41.549 1.00 50.80 O
ATOM 399 N ALA A 55 42.092 70.522 39.743 1.00 51.80 N
ATOM 400 CA ALA A 55 42.460 69.434 38.863 1.00 52.14 C
ATOM 401 C ALA A 55 43.984 69.229 38.996 1.00 52.07 C
ATOM 402 O ALA A 55 44.448 68.141 39.361 1.00 52.47 O
ATOM 403 CB ALA A 55 42.070 69.762 37.429 1.00 51.40 C
ATOM 404 N GLY A 56 44.759 70.275 38.726 1.00 49.80 N
ATOM 405 CA GLY A 56 46.197 70.142 38.841 1.00 49.76 C
ATOM 406 C GLY A 56 46.617 69.478 40.144 1.00 50.03 C
ATOM 407 O GLY A 56 47.671 68.832 40.217 1.00 51.07 O
ATOM 408 N TYR A 57 45.794 69.643 41.175 1.00 48.76 N
ATOM 409 CA TYR A 57 46.077 69.072 42.486 1.00 48.00 C
ATOM 410 C TYR A 57 45.706 67.612 42.460 1.00 48.75 C
ATOM 411 O TYR A 57 46.432 66.759 42.969 1.00 50.24 O
ATOM 412 CB TYR A 57 45.248 69.768 43.566 1.00 45.41 C
ATOM 413 CG TYR A 57 45.648 69.398 44.975 1.00 44.39 C
ATOM 414 CD1 TYR A 57 46.919 69.709 45.461 1.00 44.86 C
ATOM 415 CD2 TYR A 57 44.755 68.760 45.836 1.00 43.12 C
ATOM 416 CE1 TYR A 57 47.296 69.400 46.767 1.00 42.24 C
ATOM 417 CE2 TYR A 57 45.121 68.448 47.150 1.00 41.05 C
ATOM 418 CZ TYR A 57 46.398 68.772 47.602 1.00 41.67 C
ATOM 419 OH TYR A 57 46.804 68.455 48.876 1.00 41.96 O
ATOM 420 N PHE A 58 44.552 67.336 41.868 1.00 49.32 N
ATOM 421 CA PHE A 58 44.049 65.981 41.765 1.00 49.09 C
ATOM 422 C PHE A 58 45.090 65.181 40.996 1.00 50.85 C
ATOM 423 O PHE A 58 45.397 64.042 41.340 1.00 50.52 O
ATOM 424 CB PHE A 58 42.707 65.987 41.035 1.00 46.05 C
ATOM 425 CG PHE A 58 41.787 64.892 41.466 1.00 45.49 C
ATOM 426 CD1 PHE A 58 40.452 65.161 41.744 1.00 45.97 C
ATOM 427 CD2 PHE A 58 42.245 63.591 41.586 1.00 45.41 C
ATOM 428 CE1 PHE A 58 39.586 64.152 42.133 1.00 46.71 C
ATOM 429 CE2 PHE A 58 41.386 62.569 41.974 1.00 46.94 C
ATOM 430 CZ PHE A 58 40.053 62.849 42.248 1.00 47.24 C
ATOM 431 N VAL A 59 45.638 65.803 39.957 1.00 52.52 N
ATOM 432 CA VAL A 59 46.667 65.181 39.141 1.00 54.02 C
ATOM 433 C VAL A 59 47.898 64.912 39.997 1.00 55.12 C
ATOM 434 O VAL A 59 48.416 63.800 39.982 1.00 56.51 O
ATOM 435 CB VAL A 59 47.057 66.087 37.951 1.00 53.91 C
ATOM 436 CG1 VAL A 59 48.395 65.663 37.386 1.00 52.92 C
ATOM 437 CG2 VAL A 59 45.975 66.023 36.879 1.00 54.26 C
ATOM 438 N GLU A 60 48.354 65.922 40.740 1.00 55.59 N
ATOM 439 CA GLU A 60 49.521 65.777 41.608 1.00 57.34 C
ATOM 440 C GLU A 60 49.418 64.531 42.483 1.00 57.42 C
ATOM 441 O GLU A 60 50.432 63.998 42.935 1.00 56.86 O
ATOM 442 CB GLU A 60 49.678 66.986 42.528 1.00 60.41 C
ATOM 443 CG GLU A 60 50.992 66.973 43.309 1.00 64.88 C
ATOM 444 CD GLU A 60 50.870 67.539 44.716 1.00 67.07 C
ATOM 445 OE1 GLU A 60 50.205 66.900 45.555 1.00 68.60 O
ATOM 446 OE2 GLU A 60 51.442 68.618 44.988 1.00 69.65 O
ATOM 447 N HIS A 61 48.189 64.084 42.732 1.00 56.80 N
ATOM 448 CA HIS A 61 47.959 62.892 43.535 1.00 58.14 C
ATOM 449 C HIS A 61 48.129 61.593 42.749 1.00 58.83 C
ATOM 450 O HIS A 61 48.483 60.561 43.315 1.00 59.60 O
ATOM 451 CB HIS A 61 46.553 62.914 44.140 1.00 58.16 C
ATOM 452 CG HIS A 61 46.458 63.676 45.424 1.00 57.72 C
ATOM 453 ND1 HIS A 61 45.940 63.123 46.574 1.00 57.46 N
ATOM 454 CD2 HIS A 61 46.812 64.944 45.741 1.00 56.57 C
ATOM 455 CE1 HIS A 61 45.979 64.018 47.545 1.00 57.26 C
ATOM 456 NE2 HIS A 61 46.504 65.130 47.066 1.00 55.80 N
ATOM 457 N LEU A 62 47.867 61.637 41.449 1.00 59.73 N
ATOM 458 CA LEU A 62 47.989 60.442 40.624 1.00 60.84 C
ATOM 459 C LEU A 62 49.354 60.336 39.946 1.00 61.51 C
ATOM 460 O LEU A 62 49.771 59.249 39.548 1.00 61.80 O
ATOM 461 CB LEU A 62 46.872 60.413 39.574 1.00 59.91 C
ATOM 462 CG LEU A 62 45.445 60.302 40.132 1.00 60.55 C
ATOM 463 CD1 LEU A 62 44.436 60.622 39.060 1.00 59.95 C
ATOM 464 CD2 LEU A 62 45.205 58.914 40.673 1.00 61.07 C
ATOM 465 N ALA A 63 50.058 61.457 39.840 1.00 61.29 N
ATOM 466 CA ALA A 63 51.359 61.475 39.197 1.00 63.03 C
ATOM 467 C ALA A 63 52.345 60.477 39.797 1.00 64.87 C
ATOM 468 O ALA A 63 53.435 60.268 39.260 1.00 66.89 O
ATOM 469 CB ALA A 63 51.941 62.866 39.261 1.00 62.31 C
ATOM 470 N PHE A 64 51.973 59.853 40.904 1.00 65.32 N
ATOM 471 CA PHE A 64 52.870 58.900 41.544 1.00 65.65 C
ATOM 472 C PHE A 64 52.253 57.526 41.726 1.00 64.71 C
ATOM 473 O PHE A 64 52.898 56.625 42.245 1.00 64.23 O
ATOM 474 CB PHE A 64 53.306 59.445 42.906 1.00 68.31 C
ATOM 475 CG PHE A 64 54.208 60.644 42.820 1.00 70.01 C
ATOM 476 CD1 PHE A 64 54.254 61.569 43.854 1.00 69.52 C
ATOM 477 CD2 PHE A 64 55.020 60.844 41.703 1.00 71.72 C
ATOM 478 CE1 PHE A 64 55.094 62.682 43.784 1.00 71.10 C
ATOM 479 CE2 PHE A 64 55.859 61.951 41.625 1.00 72.37 C
ATOM 480 CZ PHE A 64 55.898 62.875 42.670 1.00 72.22 C
ATOM 481 N LYS A 65 51.007 57.371 41.296 1.00 64.30 N
ATOM 482 CA LYS A 65 50.305 56.107 41.441 1.00 63.68 C
ATOM 483 C LYS A 65 50.437 55.231 40.201 1.00 64.11 C
ATOM 484 O LYS A 65 49.619 54.335 39.981 1.00 63.43 O
ATOM 485 CB LYS A 65 48.822 56.358 41.738 1.00 64.38 C
ATOM 486 CG LYS A 65 48.539 57.306 42.905 1.00 64.21 C
ATOM 487 CD LYS A 65 48.803 56.688 44.263 1.00 64.30 C
ATOM 488 CE LYS A 65 48.548 57.710 45.362 1.00 66.68 C
ATOM 489 NZ LYS A 65 48.564 57.119 46.736 1.00 68.33 N
ATOM 490 N GLY A 66 51.447 55.499 39.377 1.00 64.72 N
ATOM 491 CA GLY A 66 51.650 54.667 38.204 1.00 66.14 C
ATOM 492 C GLY A 66 51.328 55.180 36.811 1.00 66.38 C
ATOM 493 O GLY A 66 50.402 55.971 36.606 1.00 65.50 O
ATOM 494 N THR A 67 52.101 54.675 35.846 1.00 67.03 N
ATOM 495 CA THR A 67 51.978 55.033 34.433 1.00 66.77 C
ATOM 496 C THR A 67 51.424 53.877 33.584 1.00 67.34 C
ATOM 497 O THR A 67 51.009 52.848 34.109 1.00 66.55 O
ATOM 498 CB THR A 67 53.349 55.435 33.870 1.00 65.55 C
ATOM 499 OG1 THR A 67 54.158 54.265 33.722 1.00 63.61 O
ATOM 500 CG2 THR A 67 54.059 56.395 34.820 1.00 63.57 C
ATOM 501 N LYS A 68 51.407 54.052 32.269 1.00 70.04 N
ATOM 502 CA LYS A 68 50.907 53.000 31.383 1.00 73.40 C
ATOM 503 C LYS A 68 51.955 51.892 31.278 1.00 74.38 C
ATOM 504 O LYS A 68 51.639 50.706 31.417 1.00 74.17 O
ATOM 505 CB LYS A 68 50.624 53.559 29.990 1.00 74.48 C
ATOM 506 CG LYS A 68 49.599 54.670 29.942 1.00 75.67 C
ATOM 507 CD LYS A 68 49.757 55.431 28.641 1.00 77.90 C
ATOM 508 CE LYS A 68 48.835 56.627 28.560 1.00 80.04 C
ATOM 509 NZ LYS A 68 49.238 57.511 27.420 1.00 81.12 N
ATOM 510 N LYS A 69 53.202 52.285 31.025 1.00 74.85 N
ATOM 511 CA LYS A 69 54.284 51.317 30.923 1.00 75.33 C
ATOM 512 C LYS A 69 54.436 50.527 32.223 1.00 74.55 C
ATOM 513 O LYS A 69 54.806 49.353 32.198 1.00 75.76 O
ATOM 514 CB LYS A 69 55.618 52.006 30.608 1.00 77.20 C
ATOM 515 CG LYS A 69 55.722 52.613 29.211 1.00 81.06 C
ATOM 516 CD LYS A 69 57.184 52.910 28.826 1.00 82.84 C
ATOM 517 CE LYS A 69 57.895 53.794 29.862 1.00 84.96 C
ATOM 518 NZ LYS A 69 59.302 54.154 29.496 1.00 83.89 N
ATOM 519 N ARG A 70 54.151 51.157 33.361 1.00 72.49 N
ATOM 520 CA ARG A 70 54.304 50.463 34.635 1.00 70.44 C
ATOM 521 C ARG A 70 53.300 50.811 35.727 1.00 69.91 C
ATOM 522 O ARG A 70 53.376 51.875 36.344 1.00 68.74 O
ATOM 523 CB ARG A 70 55.723 50.680 35.158 1.00 68.56 C
ATOM 524 CG ARG A 70 56.080 52.106 35.415 1.00 66.46 C
ATOM 525 CD ARG A 70 57.574 52.275 35.461 1.00 65.22 C
ATOM 526 NE ARG A 70 58.105 52.564 34.138 1.00 66.53 N
ATOM 527 CZ ARG A 70 59.396 52.740 33.873 1.00 67.67 C
ATOM 528 NH1 ARG A 70 60.288 52.651 34.852 1.00 66.40 N
ATOM 529 NH2 ARG A 70 59.796 53.015 32.631 1.00 66.69 N
ATOM 530 N PRO A 71 52.354 49.897 35.993 1.00 69.96 N
ATOM 531 CA PRO A 71 51.327 50.098 37.019 1.00 70.86 C
ATOM 532 C PRO A 71 51.900 50.463 38.387 1.00 71.50 C
ATOM 533 O PRO A 71 53.103 50.344 38.630 1.00 71.16 O
ATOM 534 CB PRO A 71 50.575 48.766 37.028 1.00 71.08 C
ATOM 535 CG PRO A 71 51.599 47.786 36.537 1.00 70.73 C
ATOM 536 CD PRO A 71 52.257 48.546 35.419 1.00 69.39 C
ATOM 537 N CYS A 72 51.015 50.903 39.274 1.00 72.21 N
ATOM 538 CA CYS A 72 51.376 51.338 40.621 1.00 72.82 C
ATOM 539 C CYS A 72 52.518 50.592 41.324 1.00 72.12 C
ATOM 540 O CYS A 72 53.637 51.106 41.425 1.00 71.09 O
ATOM 541 CB CYS A 72 50.127 51.317 41.510 1.00 73.90 C
ATOM 542 SG CYS A 72 50.234 52.383 42.979 1.00 77.73 S
ATOM 543 N ALA A 73 52.226 49.393 41.821 1.00 71.95 N
ATOM 544 CA ALA A 73 53.213 48.589 42.538 1.00 72.24 C
ATOM 545 C ALA A 73 54.568 48.569 41.840 1.00 72.05 C
ATOM 546 O ALA A 73 55.612 48.795 42.464 1.00 70.69 O
ATOM 547 CB ALA A 73 52.691 47.171 42.714 1.00 72.15 C
ATOM 548 N ALA A 74 54.538 48.304 40.538 1.00 72.76 N
ATOM 549 CA ALA A 74 55.755 48.254 39.735 1.00 72.77 C
ATOM 550 C ALA A 74 56.490 49.587 39.791 1.00 72.65 C
ATOM 551 O ALA A 74 57.698 49.637 40.047 1.00 72.39 O
ATOM 552 CB ALA A 74 55.410 47.905 38.290 1.00 73.16 C
ATOM 553 N PHE A 75 55.750 50.666 39.558 1.00 72.32 N
ATOM 554 CA PHE A 75 56.328 51.998 39.580 1.00 72.24 C
ATOM 555 C PHE A 75 57.001 52.307 40.917 1.00 71.88 C
ATOM 556 O PHE A 75 58.150 52.768 40.969 1.00 69.76 O
ATOM 557 CB PHE A 75 55.248 53.046 39.307 1.00 73.29 C
ATOM 558 CG PHE A 75 55.776 54.452 39.282 1.00 75.20 C
ATOM 559 CD1 PHE A 75 56.555 54.894 38.213 1.00 74.95 C
ATOM 560 CD2 PHE A 75 55.570 55.308 40.362 1.00 75.42 C
ATOM 561 CE1 PHE A 75 57.129 56.160 38.221 1.00 74.56 C
ATOM 562 CE2 PHE A 75 56.142 56.578 40.379 1.00 76.36 C
ATOM 563 CZ PHE A 75 56.926 57.002 39.303 1.00 75.55 C
ATOM 564 N GLU A 76 56.276 52.047 41.997 1.00 72.39 N
ATOM 565 CA GLU A 76 56.785 52.321 43.332 1.00 73.71 C
ATOM 566 C GLU A 76 58.015 51.497 43.681 1.00 73.41 C
ATOM 567 O GLU A 76 59.056 52.044 44.084 1.00 71.17 O
ATOM 568 CB GLU A 76 55.690 52.070 44.368 1.00 75.39 C
ATOM 569 CG GLU A 76 54.473 52.961 44.208 1.00 76.58 C
ATOM 570 CD GLU A 76 53.582 52.928 45.428 1.00 77.48 C
ATOM 571 OE1 GLU A 76 53.030 51.848 45.732 1.00 78.04 O
ATOM 572 OE2 GLU A 76 53.442 53.981 46.085 1.00 78.40 O
ATOM 573 N LYS A 77 57.882 50.179 43.532 1.00 73.13 N
ATOM 574 CA LYS A 77 58.974 49.261 43.831 1.00 72.28 C
ATOM 575 C LYS A 77 60.266 49.708 43.143 1.00 70.07 C
ATOM 576 O LYS A 77 61.311 49.841 43.783 1.00 68.87 O
ATOM 577 CB LYS A 77 58.606 47.842 43.385 1.00 74.23 C
ATOM 578 CG LYS A 77 59.722 46.814 43.591 1.00 76.54 C
ATOM 579 CD LYS A 77 59.310 45.428 43.102 1.00 78.22 C
ATOM 580 CE LYS A 77 60.493 44.452 43.113 1.00 78.57 C
ATOM 581 NZ LYS A 77 60.111 43.084 42.659 1.00 78.01 N
ATOM 582 N GLU A 78 60.181 49.953 41.841 1.00 67.52 N
ATOM 583 CA GLU A 78 61.340 50.372 41.077 1.00 65.87 C
ATOM 584 C GLU A 78 62.046 51.592 41.656 1.00 66.40 C
ATOM 585 O GLU A 78 63.272 51.635 41.728 1.00 64.34 O
ATOM 586 CB GLU A 78 60.935 50.654 39.637 1.00 64.21 C
ATOM 587 CG GLU A 78 62.095 51.117 38.789 1.00 62.50 C
ATOM 588 CD GLU A 78 61.712 51.303 37.351 1.00 61.67 C
ATOM 589 OE1 GLU A 78 62.576 51.777 36.573 1.00 61.85 O
ATOM 590 OE2 GLU A 78 60.551 50.974 37.008 1.00 59.48 O
ATOM 591 N VAL A 79 61.268 52.592 42.057 1.00 68.89 N
ATOM 592 CA VAL A 79 61.829 53.812 42.628 1.00 69.97 C
ATOM 593 C VAL A 79 62.321 53.576 44.049 1.00 70.45 C
ATOM 594 O VAL A 79 63.411 54.015 44.417 1.00 69.13 O
ATOM 595 CB VAL A 79 60.791 54.954 42.658 1.00 70.70 C
ATOM 596 CG1 VAL A 79 61.357 56.142 43.439 1.00 70.35 C
ATOM 597 CG2 VAL A 79 60.417 55.372 41.227 1.00 70.65 C
ATOM 598 N GLU A 80 61.508 52.890 44.847 1.00 71.51 N
ATOM 599 CA GLU A 80 61.883 52.611 46.227 1.00 73.55 C
ATOM 600 C GLU A 80 63.171 51.806 46.273 1.00 73.76 C
ATOM 601 O GLU A 80 64.136 52.191 46.942 1.00 74.11 O
ATOM 602 CB GLU A 80 60.788 51.821 46.948 1.00 74.77 C
ATOM 603 CG GLU A 80 59.561 52.608 47.334 1.00 76.83 C
ATOM 604 CD GLU A 80 58.570 51.767 48.125 1.00 80.21 C
ATOM 605 OE1 GLU A 80 58.971 51.196 49.165 1.00 81.30 O
ATOM 606 OE2 GLU A 80 57.390 51.677 47.713 1.00 82.29 O
ATOM 607 N SER A 81 63.181 50.692 45.546 1.00 73.30 N
ATOM 608 CA SER A 81 64.328 49.797 45.517 1.00 72.87 C
ATOM 609 C SER A 81 65.644 50.409 45.050 1.00 71.94 C
ATOM 610 O SER A 81 66.690 49.778 45.177 1.00 72.11 O
ATOM 611 CB SER A 81 64.004 48.563 44.682 1.00 72.62 C
ATOM 612 OG SER A 81 63.711 48.936 43.359 1.00 76.34 O
ATOM 613 N MET A 82 65.613 51.621 44.509 1.00 71.62 N
ATOM 614 CA MET A 82 66.861 52.251 44.097 1.00 72.00 C
ATOM 615 C MET A 82 67.259 53.373 45.062 1.00 71.82 C
ATOM 616 O MET A 82 68.219 54.118 44.820 1.00 71.53 O
ATOM 617 CB MET A 82 66.773 52.760 42.653 1.00 72.60 C
ATOM 618 CG MET A 82 65.647 53.701 42.349 1.00 76.74 C
ATOM 619 SD MET A 82 65.517 53.936 40.552 1.00 81.80 S
ATOM 620 CE MET A 82 67.022 54.889 40.205 1.00 80.38 C
ATOM 621 N GLY A 83 66.518 53.466 46.167 1.00 71.22 N
ATOM 622 CA GLY A 83 66.785 54.468 47.186 1.00 71.47 C
ATOM 623 C GLY A 83 66.476 55.900 46.791 1.00 71.10 C
ATOM 624 O GLY A 83 66.904 56.842 47.461 1.00 70.45 O
ATOM 625 N ALA A 84 65.726 56.065 45.707 1.00 71.21 N
ATOM 626 CA ALA A 84 65.359 57.386 45.211 1.00 71.18 C
ATOM 627 C ALA A 84 64.119 57.922 45.916 1.00 70.85 C
ATOM 628 O ALA A 84 63.254 57.165 46.351 1.00 70.49 O
ATOM 629 CB ALA A 84 65.119 57.335 43.700 1.00 70.94 C
ATOM 630 N HIS A 85 64.044 59.242 46.009 1.00 70.88 N
ATOM 631 CA HIS A 85 62.932 59.915 46.658 1.00 69.44 C
ATOM 632 C HIS A 85 62.084 60.631 45.638 1.00 68.44 C
ATOM 633 O HIS A 85 62.584 61.431 44.851 1.00 67.76 O
ATOM 634 CB HIS A 85 63.466 60.925 47.663 1.00 69.72 C
ATOM 635 CG HIS A 85 64.152 60.299 48.831 1.00 70.53 C
ATOM 636 ND1 HIS A 85 64.838 61.034 49.772 1.00 70.68 N
ATOM 637 CD2 HIS A 85 64.239 59.007 49.224 1.00 71.06 C
ATOM 638 CE1 HIS A 85 65.319 60.222 50.695 1.00 70.93 C
ATOM 639 NE2 HIS A 85 64.969 58.987 50.387 1.00 71.09 N
ATOM 640 N PHE A 86 60.791 60.350 45.652 1.00 68.50 N
ATOM 641 CA PHE A 86 59.910 61.002 44.709 1.00 68.34 C
ATOM 642 C PHE A 86 58.945 61.978 45.362 1.00 66.87 C
ATOM 643 O PHE A 86 57.995 61.587 46.040 1.00 65.62 O
ATOM 644 CB PHE A 86 59.122 59.981 43.904 1.00 69.76 C
ATOM 645 CG PHE A 86 58.831 60.438 42.516 1.00 74.14 C
ATOM 646 CD1 PHE A 86 59.056 61.768 42.158 1.00 75.67 C
ATOM 647 CD2 PHE A 86 58.364 59.552 41.558 1.00 76.26 C
ATOM 648 CE1 PHE A 86 58.826 62.213 40.865 1.00 77.87 C
ATOM 649 CE2 PHE A 86 58.128 59.982 40.255 1.00 79.39 C
ATOM 650 CZ PHE A 86 58.360 61.319 39.905 1.00 79.68 C
ATOM 651 N ASN A 87 59.197 63.261 45.154 1.00 65.88 N
ATOM 652 CA ASN A 87 58.332 64.271 45.722 1.00 65.94 C
ATOM 653 C ASN A 87 57.873 65.253 44.658 1.00 64.04 C
ATOM 654 O ASN A 87 58.205 65.118 43.485 1.00 63.66 O
ATOM 655 CB ASN A 87 59.045 65.011 46.855 1.00 67.86 C
ATOM 656 CG ASN A 87 58.085 65.804 47.722 1.00 68.97 C
ATOM 657 OD1 ASN A 87 57.174 65.250 48.342 1.00 68.88 O
ATOM 658 ND2 ASN A 87 58.281 67.109 47.763 1.00 71.72 N
ATOM 659 N GLY A 88 57.099 66.240 45.079 1.00 63.07 N
ATOM 660 CA GLY A 88 56.590 67.224 44.143 1.00 61.56 C
ATOM 661 C GLY A 88 55.482 68.070 44.740 1.00 58.88 C
ATOM 662 O GLY A 88 54.970 67.794 45.817 1.00 58.52 O
ATOM 663 N TYR A 89 55.088 69.100 44.015 1.00 57.68 N
ATOM 664 CA TYR A 89 54.071 69.994 44.516 1.00 55.19 C
ATOM 665 C TYR A 89 53.395 70.733 43.379 1.00 56.03 C
ATOM 666 O TYR A 89 53.896 70.778 42.251 1.00 55.30 O
ATOM 667 CB TYR A 89 54.721 71.002 45.452 1.00 50.83 C
ATOM 668 CG TYR A 89 55.646 71.951 44.740 1.00 48.70 C
ATOM 669 CD1 TYR A 89 55.141 73.027 44.017 1.00 49.34 C
ATOM 670 CD2 TYR A 89 57.028 71.770 44.772 1.00 49.39 C
ATOM 671 CE1 TYR A 89 55.983 73.910 43.336 1.00 50.46 C
ATOM 672 CE2 TYR A 89 57.892 72.650 44.096 1.00 50.56 C
ATOM 673 CZ TYR A 89 57.355 73.721 43.379 1.00 51.42 C
ATOM 674 OH TYR A 89 58.171 74.613 42.715 1.00 51.48 O
ATOM 675 N THR A 90 52.255 71.331 43.699 1.00 56.95 N
ATOM 676 CA THR A 90 51.489 72.111 42.743 1.00 56.47 C
ATOM 677 C THR A 90 51.086 73.398 43.472 1.00 55.14 C
ATOM 678 O THR A 90 50.629 73.346 44.605 1.00 55.29 O
ATOM 679 CB THR A 90 50.253 71.289 42.242 1.00 57.64 C
ATOM 680 OG1 THR A 90 49.210 72.172 41.814 1.00 60.13 O
ATOM 681 CG2 THR A 90 49.741 70.368 43.328 1.00 57.58 C
ATOM 682 N SER A 91 51.310 74.550 42.843 1.00 54.66 N
ATOM 683 CA SER A 91 50.957 75.839 43.435 1.00 53.06 C
ATOM 684 C SER A 91 50.027 76.628 42.505 1.00 53.73 C
ATOM 685 O SER A 91 49.317 76.039 41.690 1.00 53.66 O
ATOM 686 CB SER A 91 52.217 76.653 43.746 1.00 52.00 C
ATOM 687 OG SER A 91 52.778 77.219 42.577 1.00 54.92 O
ATOM 688 N ARG A 92 50.032 77.956 42.613 1.00 54.70 N
ATOM 689 CA ARG A 92 49.143 78.778 41.796 1.00 54.34 C
ATOM 690 C ARG A 92 49.608 79.032 40.374 1.00 55.78 C
ATOM 691 O ARG A 92 48.778 79.134 39.456 1.00 56.14 O
ATOM 692 CB ARG A 92 48.858 80.114 42.491 1.00 53.08 C
ATOM 693 CG ARG A 92 47.942 79.967 43.695 1.00 53.79 C
ATOM 694 CD ARG A 92 47.163 81.246 44.033 1.00 51.67 C
ATOM 695 NE ARG A 92 46.136 80.990 45.044 1.00 47.03 N
ATOM 696 CZ ARG A 92 46.399 80.792 46.332 1.00 46.98 C
ATOM 697 NH1 ARG A 92 47.652 80.834 46.757 1.00 43.99 N
ATOM 698 NH2 ARG A 92 45.418 80.534 47.190 1.00 47.61 N
ATOM 699 N GLU A 93 50.923 79.148 40.192 1.00 55.40 N
ATOM 700 CA GLU A 93 51.487 79.378 38.867 1.00 54.73 C
ATOM 701 C GLU A 93 52.583 78.373 38.521 1.00 55.46 C
ATOM 702 O GLU A 93 53.130 78.407 37.406 1.00 57.13 O
ATOM 703 CB GLU A 93 52.088 80.782 38.764 1.00 52.86 C
ATOM 704 CG GLU A 93 51.113 81.884 38.432 1.00 51.39 C
ATOM 705 CD GLU A 93 51.790 83.075 37.752 1.00 51.19 C
ATOM 706 OE1 GLU A 93 52.990 83.345 38.037 1.00 48.91 O
ATOM 707 OE2 GLU A 93 51.107 83.741 36.941 1.00 49.51 O
ATOM 708 N GLN A 94 52.890 77.469 39.449 1.00 53.89 N
ATOM 709 CA GLN A 94 53.981 76.532 39.221 1.00 52.23 C
ATOM 710 C GLN A 94 53.801 75.152 39.806 1.00 51.15 C
ATOM 711 O GLN A 94 53.381 75.014 40.939 1.00 52.54 O
ATOM 712 CB GLN A 94 55.246 77.155 39.787 1.00 51.40 C
ATOM 713 CG GLN A 94 56.491 76.354 39.635 1.00 49.83 C
ATOM 714 CD GLN A 94 57.681 77.165 40.075 1.00 49.87 C
ATOM 715 OE1 GLN A 94 57.829 78.325 39.667 1.00 50.88 O
ATOM 716 NE2 GLN A 94 58.537 76.574 40.907 1.00 46.04 N
ATOM 717 N THR A 95 54.145 74.130 39.035 1.00 50.89 N
ATOM 718 CA THR A 95 54.030 72.749 39.492 1.00 50.31 C
ATOM 719 C THR A 95 55.407 72.105 39.390 1.00 50.33 C
ATOM 720 O THR A 95 56.263 72.594 38.658 1.00 50.92 O
ATOM 721 CB THR A 95 53.049 71.946 38.615 1.00 50.21 C
ATOM 722 OG1 THR A 95 51.780 72.610 38.569 1.00 49.96 O
ATOM 723 CG2 THR A 95 52.853 70.545 39.187 1.00 50.52 C
ATOM 724 N ALA A 96 55.631 71.022 40.129 1.00 50.14 N
ATOM 725 CA ALA A 96 56.919 70.338 40.074 1.00 50.54 C
ATOM 726 C ALA A 96 56.889 68.867 40.517 1.00 51.11 C
ATOM 727 O ALA A 96 56.155 68.473 41.427 1.00 51.03 O
ATOM 728 CB ALA A 96 57.962 71.115 40.900 1.00 47.84 C
ATOM 729 N PHE A 97 57.682 68.050 39.836 1.00 51.93 N
ATOM 730 CA PHE A 97 57.818 66.641 40.172 1.00 52.17 C
ATOM 731 C PHE A 97 59.307 66.377 40.106 1.00 52.99 C
ATOM 732 O PHE A 97 59.917 66.495 39.044 1.00 54.27 O
ATOM 733 CB PHE A 97 57.097 65.768 39.164 1.00 50.43 C
ATOM 734 CG PHE A 97 55.640 66.074 39.036 1.00 50.16 C
ATOM 735 CD1 PHE A 97 55.175 66.884 38.006 1.00 50.16 C
ATOM 736 CD2 PHE A 97 54.730 65.545 39.936 1.00 48.68 C
ATOM 737 CE1 PHE A 97 53.818 67.155 37.873 1.00 50.86 C
ATOM 738 CE2 PHE A 97 53.377 65.811 39.815 1.00 49.15 C
ATOM 739 CZ PHE A 97 52.915 66.613 38.785 1.00 49.71 C
ATOM 740 N TYR A 98 59.907 66.050 41.237 1.00 53.61 N
ATOM 741 CA TYR A 98 61.328 65.807 41.238 1.00 55.68 C
ATOM 742 C TYR A 98 61.764 64.568 42.020 1.00 57.25 C
ATOM 743 O TYR A 98 61.057 64.078 42.907 1.00 56.63 O
ATOM 744 CB TYR A 98 62.045 67.047 41.750 1.00 55.74 C
ATOM 745 CG TYR A 98 61.660 67.434 43.146 1.00 57.36 C
ATOM 746 CD1 TYR A 98 62.102 66.698 44.238 1.00 58.35 C
ATOM 747 CD2 TYR A 98 60.879 68.560 43.381 1.00 58.29 C
ATOM 748 CE1 TYR A 98 61.783 67.080 45.532 1.00 60.22 C
ATOM 749 CE2 TYR A 98 60.552 68.950 44.668 1.00 58.86 C
ATOM 750 CZ TYR A 98 61.010 68.211 45.740 1.00 60.21 C
ATOM 751 OH TYR A 98 60.721 68.618 47.027 1.00 62.92 O
ATOM 752 N ILE A 99 62.945 64.069 41.667 1.00 58.61 N
ATOM 753 CA ILE A 99 63.509 62.886 42.291 1.00 58.42 C
ATOM 754 C ILE A 99 64.917 63.112 42.823 1.00 59.08 C
ATOM 755 O ILE A 99 65.748 63.763 42.186 1.00 59.47 O
ATOM 756 CB ILE A 99 63.538 61.710 41.287 1.00 57.68 C
ATOM 757 CG1 ILE A 99 62.109 61.244 41.000 1.00 58.32 C
ATOM 758 CG2 ILE A 99 64.380 60.575 41.828 1.00 58.16 C
ATOM 759 CD1 ILE A 99 61.992 60.065 40.043 1.00 56.47 C
ATOM 760 N LYS A 100 65.161 62.588 44.018 1.00 60.15 N
ATOM 761 CA LYS A 100 66.473 62.663 44.633 1.00 61.64 C
ATOM 762 C LYS A 100 67.037 61.255 44.472 1.00 63.06 C
ATOM 763 O LYS A 100 66.379 60.273 44.827 1.00 62.75 O
ATOM 764 CB LYS A 100 66.363 63.020 46.114 1.00 61.12 C
ATOM 765 CG LYS A 100 65.869 64.425 46.378 1.00 60.94 C
ATOM 766 CD LYS A 100 65.805 64.721 47.869 1.00 60.79 C
ATOM 767 CE LYS A 100 67.169 64.604 48.539 1.00 60.25 C
ATOM 768 NZ LYS A 100 68.133 65.579 47.975 1.00 61.36 N
ATOM 769 N ALA A 101 68.243 61.154 43.916 1.00 64.63 N
ATOM 770 CA ALA A 101 68.866 59.856 43.706 1.00 64.82 C
ATOM 771 C ALA A 101 70.371 59.956 43.520 1.00 65.50 C
ATOM 772 O ALA A 101 70.968 61.030 43.656 1.00 63.77 O
ATOM 773 CB ALA A 101 68.240 59.174 42.495 1.00 64.67 C
ATOM 774 N LEU A 102 70.972 58.807 43.216 1.00 67.39 N
ATOM 775 CA LEU A 102 72.411 58.692 42.984 1.00 67.52 C
ATOM 776 C LEU A 102 72.693 59.176 41.572 1.00 67.96 C
ATOM 777 O LEU A 102 72.050 58.724 40.623 1.00 67.60 O
ATOM 778 CB LEU A 102 72.842 57.232 43.114 1.00 66.51 C
ATOM 779 CG LEU A 102 72.592 56.576 44.471 1.00 65.48 C
ATOM 780 CD1 LEU A 102 72.652 55.066 44.344 1.00 65.54 C
ATOM 781 CD2 LEU A 102 73.618 57.078 45.458 1.00 64.23 C
ATOM 782 N SER A 103 73.646 60.093 41.433 1.00 68.66 N
ATOM 783 CA SER A 103 73.999 60.629 40.120 1.00 70.37 C
ATOM 784 C SER A 103 74.095 59.481 39.118 1.00 71.16 C
ATOM 785 O SER A 103 73.795 59.627 37.931 1.00 71.26 O
ATOM 786 CB SER A 103 75.339 61.349 40.205 1.00 71.06 C
ATOM 787 OG SER A 103 75.360 62.250 41.298 1.00 73.01 O
ATOM 788 N LYS A 104 74.520 58.337 39.636 1.00 72.21 N
ATOM 789 CA LYS A 104 74.677 57.116 38.874 1.00 72.57 C
ATOM 790 C LYS A 104 73.371 56.702 38.192 1.00 72.30 C
ATOM 791 O LYS A 104 73.374 55.855 37.297 1.00 73.26 O
ATOM 792 CB LYS A 104 75.163 56.009 39.823 1.00 74.43 C
ATOM 793 CG LYS A 104 75.111 54.588 39.259 1.00 76.86 C
ATOM 794 CD LYS A 104 75.758 53.572 40.202 1.00 77.99 C
ATOM 795 CE LYS A 104 75.057 53.502 41.551 1.00 78.08 C
ATOM 796 NZ LYS A 104 75.785 52.595 42.487 1.00 76.57 N
ATOM 797 N ASP A 105 72.251 57.291 38.598 1.00 71.06 N
ATOM 798 CA ASP A 105 70.981 56.910 37.992 1.00 70.16 C
ATOM 799 C ASP A 105 70.261 58.043 37.276 1.00 68.68 C
ATOM 800 O ASP A 105 69.134 57.870 36.805 1.00 67.20 O
ATOM 801 CB ASP A 105 70.060 56.290 39.047 1.00 72.03 C
ATOM 802 CG ASP A 105 70.699 55.108 39.753 1.00 74.03 C
ATOM 803 OD1 ASP A 105 71.430 54.345 39.083 1.00 74.85 O
ATOM 804 OD2 ASP A 105 70.467 54.933 40.970 1.00 75.51 O
ATOM 805 N MET A 106 70.923 59.192 37.181 1.00 67.55 N
ATOM 806 CA MET A 106 70.348 60.351 36.519 1.00 67.20 C
ATOM 807 C MET A 106 69.561 59.970 35.261 1.00 68.21 C
ATOM 808 O MET A 106 68.448 60.452 35.050 1.00 69.03 O
ATOM 809 CB MET A 106 71.453 61.360 36.195 1.00 66.13 C
ATOM 810 CG MET A 106 71.068 62.445 35.200 1.00 66.07 C
ATOM 811 SD MET A 106 71.441 61.980 33.479 1.00 66.64 S
ATOM 812 CE MET A 106 69.881 61.830 32.791 1.00 66.06 C
ATOM 813 N PRO A 107 70.122 59.094 34.411 1.00 69.15 N
ATOM 814 CA PRO A 107 69.415 58.687 33.189 1.00 69.01 C
ATOM 815 C PRO A 107 68.123 57.892 33.393 1.00 68.33 C
ATOM 816 O PRO A 107 67.122 58.173 32.741 1.00 68.76 O
ATOM 817 CB PRO A 107 70.478 57.897 32.418 1.00 69.03 C
ATOM 818 CG PRO A 107 71.378 57.373 33.515 1.00 69.16 C
ATOM 819 CD PRO A 107 71.502 58.573 34.410 1.00 69.23 C
ATOM 820 N LYS A 108 68.137 56.897 34.276 1.00 68.08 N
ATOM 821 CA LYS A 108 66.930 56.102 34.519 1.00 68.42 C
ATOM 822 C LYS A 108 65.840 57.011 35.092 1.00 69.12 C
ATOM 823 O LYS A 108 64.656 56.873 34.770 1.00 69.36 O
ATOM 824 CB LYS A 108 67.227 54.963 35.502 1.00 67.64 C
ATOM 825 CG LYS A 108 65.988 54.305 36.113 1.00 67.15 C
ATOM 826 CD LYS A 108 65.614 52.968 35.477 1.00 66.79 C
ATOM 827 CE LYS A 108 65.164 53.113 34.027 1.00 67.61 C
ATOM 828 NZ LYS A 108 64.745 51.801 33.441 1.00 64.71 N
ATOM 829 N VAL A 109 66.260 57.938 35.949 1.00 68.62 N
ATOM 830 CA VAL A 109 65.357 58.890 36.575 1.00 67.59 C
ATOM 831 C VAL A 109 64.657 59.723 35.498 1.00 67.23 C
ATOM 832 O VAL A 109 63.424 59.807 35.466 1.00 66.88 O
ATOM 833 CB VAL A 109 66.132 59.829 37.529 1.00 67.21 C
ATOM 834 CG1 VAL A 109 65.198 60.881 38.096 1.00 67.14 C
ATOM 835 CG2 VAL A 109 66.767 59.021 38.648 1.00 65.29 C
ATOM 836 N VAL A 110 65.451 60.336 34.622 1.00 65.92 N
ATOM 837 CA VAL A 110 64.910 61.147 33.537 1.00 65.41 C
ATOM 838 C VAL A 110 63.846 60.376 32.769 1.00 65.89 C
ATOM 839 O VAL A 110 62.840 60.943 32.340 1.00 67.09 O
ATOM 840 CB VAL A 110 65.999 61.574 32.545 1.00 64.14 C
ATOM 841 CG1 VAL A 110 65.354 62.179 31.312 1.00 62.80 C
ATOM 842 CG2 VAL A 110 66.938 62.582 33.199 1.00 62.54 C
ATOM 843 N GLU A 111 64.072 59.083 32.591 1.00 65.55 N
ATOM 844 CA GLU A 111 63.108 58.248 31.896 1.00 65.67 C
ATOM 845 C GLU A 111 61.835 58.178 32.737 1.00 64.79 C
ATOM 846 O GLU A 111 60.719 58.289 32.225 1.00 64.71 O
ATOM 847 CB GLU A 111 63.665 56.842 31.722 1.00 67.24 C
ATOM 848 CG GLU A 111 62.707 55.902 31.009 1.00 69.18 C
ATOM 849 CD GLU A 111 63.113 54.460 31.169 1.00 70.49 C
ATOM 850 OE1 GLU A 111 64.328 54.182 31.053 1.00 70.24 O
ATOM 851 OE2 GLU A 111 62.220 53.612 31.407 1.00 71.86 O
ATOM 852 N LEU A 112 62.022 57.982 34.037 1.00 62.51 N
ATOM 853 CA LEU A 112 60.913 57.896 34.965 1.00 60.64 C
ATOM 854 C LEU A 112 60.098 59.188 34.969 1.00 60.35 C
ATOM 855 O LEU A 112 58.864 59.155 34.895 1.00 58.97 O
ATOM 856 CB LEU A 112 61.446 57.593 36.366 1.00 59.33 C
ATOM 857 CG LEU A 112 61.975 56.169 36.530 1.00 58.04 C
ATOM 858 CD1 LEU A 112 62.764 56.061 37.811 1.00 58.58 C
ATOM 859 CD2 LEU A 112 60.817 55.189 36.522 1.00 56.13 C
ATOM 860 N LEU A 113 60.791 60.322 35.055 1.00 59.40 N
ATOM 861 CA LEU A 113 60.115 61.608 35.065 1.00 58.97 C
ATOM 862 C LEU A 113 59.226 61.730 33.843 1.00 59.44 C
ATOM 863 O LEU A 113 58.014 61.932 33.962 1.00 60.14 O
ATOM 864 CB LEU A 113 61.125 62.742 35.069 1.00 57.80 C
ATOM 865 CG LEU A 113 61.919 62.900 36.361 1.00 59.94 C
ATOM 866 CD1 LEU A 113 62.883 64.091 36.221 1.00 60.01 C
ATOM 867 CD2 LEU A 113 60.966 63.099 37.537 1.00 57.39 C
ATOM 868 N ALA A 114 59.838 61.600 32.671 1.00 59.29 N
ATOM 869 CA ALA A 114 59.115 61.692 31.410 1.00 59.27 C
ATOM 870 C ALA A 114 57.891 60.782 31.385 1.00 59.45 C
ATOM 871 O ALA A 114 56.824 61.165 30.902 1.00 59.00 O
ATOM 872 CB ALA A 114 60.034 61.342 30.265 1.00 58.50 C
ATOM 873 N ASP A 115 58.043 59.579 31.913 1.00 59.86 N
ATOM 874 CA ASP A 115 56.945 58.624 31.925 1.00 62.01 C
ATOM 875 C ASP A 115 55.782 59.115 32.802 1.00 62.05 C
ATOM 876 O ASP A 115 54.605 58.877 32.488 1.00 59.92 O
ATOM 877 CB ASP A 115 57.473 57.255 32.399 1.00 63.87 C
ATOM 878 CG ASP A 115 56.447 56.137 32.251 1.00 65.50 C
ATOM 879 OD1 ASP A 115 55.751 56.072 31.205 1.00 65.82 O
ATOM 880 OD2 ASP A 115 56.348 55.310 33.185 1.00 67.08 O
ATOM 881 N VAL A 116 56.125 59.814 33.888 1.00 62.65 N
ATOM 882 CA VAL A 116 55.138 60.351 34.830 1.00 62.11 C
ATOM 883 C VAL A 116 54.353 61.508 34.234 1.00 61.22 C
ATOM 884 O VAL A 116 53.121 61.526 34.289 1.00 60.34 O
ATOM 885 CB VAL A 116 55.812 60.856 36.119 1.00 62.93 C
ATOM 886 CG1 VAL A 116 54.779 61.454 37.048 1.00 63.36 C
ATOM 887 CG2 VAL A 116 56.521 59.717 36.806 1.00 64.04 C
ATOM 888 N VAL A 117 55.075 62.471 33.671 1.00 60.79 N
ATOM 889 CA VAL A 117 54.454 63.636 33.063 1.00 62.08 C
ATOM 890 C VAL A 117 53.729 63.344 31.752 1.00 62.67 C
ATOM 891 O VAL A 117 52.827 64.079 31.372 1.00 63.01 O
ATOM 892 CB VAL A 117 55.493 64.742 32.790 1.00 62.63 C
ATOM 893 CG1 VAL A 117 56.123 65.210 34.094 1.00 61.91 C
ATOM 894 CG2 VAL A 117 56.549 64.226 31.847 1.00 63.10 C
ATOM 895 N GLN A 118 54.112 62.275 31.062 1.00 64.25 N
ATOM 896 CA GLN A 118 53.487 61.942 29.782 1.00 64.76 C
ATOM 897 C GLN A 118 52.463 60.814 29.793 1.00 65.70 C
ATOM 898 O GLN A 118 51.415 60.924 29.155 1.00 66.11 O
ATOM 899 CB GLN A 118 54.554 61.578 28.754 1.00 65.36 C
ATOM 900 CG GLN A 118 55.514 62.689 28.374 1.00 65.87 C
ATOM 901 CD GLN A 118 56.736 62.162 27.630 1.00 65.05 C
ATOM 902 OE1 GLN A 118 57.447 62.914 26.970 1.00 66.02 O
ATOM 903 NE2 GLN A 118 56.986 60.865 27.748 1.00 64.43 N
ATOM 904 N ASN A 119 52.757 59.731 30.507 1.00 66.28 N
ATOM 905 CA ASN A 119 51.857 58.577 30.508 1.00 67.21 C
ATOM 906 C ASN A 119 51.255 58.185 31.838 1.00 66.87 C
ATOM 907 O ASN A 119 51.319 57.020 32.222 1.00 67.36 O
ATOM 908 CB ASN A 119 52.596 57.368 29.934 1.00 68.56 C
ATOM 909 CG ASN A 119 53.376 57.719 28.691 1.00 69.73 C
ATOM 910 OD1 ASN A 119 52.791 57.976 27.632 1.00 70.40 O
ATOM 911 ND2 ASN A 119 54.706 57.760 28.814 1.00 68.71 N
ATOM 912 N CYS A 120 50.662 59.139 32.542 1.00 66.69 N
ATOM 913 CA CYS A 120 50.052 58.824 33.826 1.00 65.06 C
ATOM 914 C CYS A 120 48.853 57.904 33.582 1.00 63.23 C
ATOM 915 O CYS A 120 47.983 58.195 32.767 1.00 62.97 O
ATOM 916 CB CYS A 120 49.619 60.108 34.536 1.00 65.29 C
ATOM 917 SG CYS A 120 48.626 59.813 36.009 1.00 65.03 S
ATOM 918 N ALA A 121 48.823 56.787 34.288 1.00 61.61 N
ATOM 919 CA ALA A 121 47.749 55.817 34.137 1.00 62.27 C
ATOM 920 C ALA A 121 46.347 56.360 34.397 1.00 63.07 C
ATOM 921 O ALA A 121 45.384 55.913 33.771 1.00 63.46 O
ATOM 922 CB ALA A 121 48.008 54.623 35.052 1.00 62.53 C
ATOM 923 N LEU A 122 46.228 57.312 35.321 1.00 63.11 N
ATOM 924 CA LEU A 122 44.929 57.871 35.667 1.00 62.40 C
ATOM 925 C LEU A 122 43.946 56.731 35.850 1.00 62.76 C
ATOM 926 O LEU A 122 42.860 56.722 35.269 1.00 61.68 O
ATOM 927 CB LEU A 122 44.424 58.812 34.574 1.00 62.98 C
ATOM 928 CG LEU A 122 45.206 60.111 34.399 1.00 62.38 C
ATOM 929 CD1 LEU A 122 44.469 61.005 33.422 1.00 60.53 C
ATOM 930 CD2 LEU A 122 45.360 60.798 35.745 1.00 61.50 C
ATOM 931 N GLU A 123 44.345 55.763 36.662 1.00 64.28 N
ATOM 932 CA GLU A 123 43.506 54.613 36.923 1.00 66.38 C
ATOM 933 C GLU A 123 42.122 55.058 37.376 1.00 66.48 C
ATOM 934 O GLU A 123 41.975 55.741 38.382 1.00 66.68 O
ATOM 935 CB GLU A 123 44.160 53.733 37.986 1.00 68.55 C
ATOM 936 CG GLU A 123 43.972 52.248 37.732 1.00 71.51 C
ATOM 937 CD GLU A 123 44.306 51.868 36.295 1.00 72.96 C
ATOM 938 OE1 GLU A 123 43.399 51.917 35.430 1.00 72.85 O
ATOM 939 OE2 GLU A 123 45.485 51.538 36.030 1.00 74.26 O
ATOM 940 N GLU A 124 41.107 54.664 36.622 1.00 67.97 N
ATOM 941 CA GLU A 124 39.731 55.024 36.932 1.00 69.62 C
ATOM 942 C GLU A 124 39.358 54.768 38.388 1.00 68.91 C
ATOM 943 O GLU A 124 38.634 55.555 38.992 1.00 70.09 O
ATOM 944 CB GLU A 124 38.780 54.247 36.023 1.00 72.51 C
ATOM 945 CG GLU A 124 37.367 54.768 36.039 1.00 76.96 C
ATOM 946 CD GLU A 124 37.309 56.222 35.630 1.00 80.55 C
ATOM 947 OE1 GLU A 124 37.890 56.544 34.566 1.00 80.79 O
ATOM 948 OE2 GLU A 124 36.691 57.036 36.366 1.00 83.51 O
ATOM 949 N SER A 125 39.855 53.667 38.943 1.00 67.82 N
ATOM 950 CA SER A 125 39.574 53.282 40.324 1.00 66.39 C
ATOM 951 C SER A 125 40.415 54.048 41.337 1.00 65.86 C
ATOM 952 O SER A 125 39.997 54.252 42.479 1.00 65.81 O
ATOM 953 CB SER A 125 39.824 51.788 40.492 1.00 65.80 C
ATOM 954 OG SER A 125 41.081 51.446 39.935 1.00 66.64 O
ATOM 955 N GLN A 126 41.613 54.447 40.920 1.00 64.92 N
ATOM 956 CA GLN A 126 42.520 55.196 41.783 1.00 63.69 C
ATOM 957 C GLN A 126 41.933 56.592 41.973 1.00 62.59 C
ATOM 958 O GLN A 126 42.005 57.173 43.056 1.00 61.86 O
ATOM 959 CB GLN A 126 43.906 55.295 41.134 1.00 63.86 C
ATOM 960 CG GLN A 126 44.980 55.841 42.051 1.00 65.18 C
ATOM 961 CD GLN A 126 45.358 54.863 43.148 1.00 66.84 C
ATOM 962 OE1 GLN A 126 45.907 53.800 42.874 1.00 70.20 O
ATOM 963 NE2 GLN A 126 45.066 55.215 44.395 1.00 66.99 N
ATOM 964 N ILE A 127 41.350 57.120 40.902 1.00 61.56 N
ATOM 965 CA ILE A 127 40.731 58.433 40.927 1.00 60.48 C
ATOM 966 C ILE A 127 39.670 58.544 42.023 1.00 61.46 C
ATOM 967 O ILE A 127 39.679 59.503 42.796 1.00 62.01 O
ATOM 968 CB ILE A 127 40.108 58.762 39.556 1.00 58.76 C
ATOM 969 CG1 ILE A 127 41.223 59.159 38.591 1.00 58.03 C
ATOM 970 CG2 ILE A 127 39.064 59.864 39.681 1.00 56.81 C
ATOM 971 CD1 ILE A 127 40.747 59.460 37.190 1.00 55.71 C
ATOM 972 N GLU A 128 38.765 57.572 42.101 1.00 61.00 N
ATOM 973 CA GLU A 128 37.726 57.605 43.118 1.00 60.99 C
ATOM 974 C GLU A 128 38.338 57.447 44.500 1.00 61.45 C
ATOM 975 O GLU A 128 37.813 57.949 45.494 1.00 62.19 O
ATOM 976 CB GLU A 128 36.713 56.491 42.884 1.00 61.51 C
ATOM 977 CG GLU A 128 35.996 56.569 41.546 1.00 64.52 C
ATOM 978 CD GLU A 128 35.242 57.876 41.344 1.00 66.86 C
ATOM 979 OE1 GLU A 128 34.336 58.189 42.156 1.00 67.13 O
ATOM 980 OE2 GLU A 128 35.558 58.587 40.361 1.00 68.25 O
ATOM 981 N LYS A 129 39.463 56.752 44.559 1.00 61.53 N
ATOM 982 CA LYS A 129 40.138 56.519 45.823 1.00 61.70 C
ATOM 983 C LYS A 129 40.803 57.802 46.326 1.00 60.89 C
ATOM 984 O LYS A 129 40.673 58.146 47.499 1.00 61.07 O
ATOM 985 CB LYS A 129 41.156 55.375 45.649 1.00 62.67 C
ATOM 986 CG LYS A 129 41.800 54.844 46.923 1.00 63.47 C
ATOM 987 CD LYS A 129 43.112 55.563 47.192 1.00 66.20 C
ATOM 988 CE LYS A 129 43.834 55.029 48.423 1.00 66.75 C
ATOM 989 NZ LYS A 129 45.087 55.806 48.665 1.00 67.40 N
ATOM 990 N GLU A 130 41.490 58.516 45.439 1.00 60.09 N
ATOM 991 CA GLU A 130 42.164 59.759 45.809 1.00 60.15 C
ATOM 992 C GLU A 130 41.161 60.883 46.082 1.00 59.56 C
ATOM 993 O GLU A 130 41.454 61.849 46.795 1.00 59.29 O
ATOM 994 CB GLU A 130 43.113 60.186 44.694 1.00 61.89 C
ATOM 995 CG GLU A 130 44.211 59.184 44.417 1.00 66.70 C
ATOM 996 CD GLU A 130 45.079 58.920 45.635 1.00 69.99 C
ATOM 997 OE1 GLU A 130 45.748 59.860 46.125 1.00 72.18 O
ATOM 998 OE2 GLU A 130 45.092 57.766 46.110 1.00 72.94 O
ATOM 999 N ARG A 131 39.976 60.745 45.504 1.00 57.89 N
ATOM 1000 CA ARG A 131 38.901 61.714 45.661 1.00 54.68 C
ATOM 1001 C ARG A 131 38.578 61.824 47.144 1.00 53.04 C
ATOM 1002 O ARG A 131 38.287 62.901 47.641 1.00 54.07 O
ATOM 1003 CB ARG A 131 37.678 61.229 44.877 1.00 55.06 C
ATOM 1004 CG ARG A 131 36.568 62.230 44.697 1.00 55.37 C
ATOM 1005 CD ARG A 131 35.391 61.579 43.974 1.00 55.76 C
ATOM 1006 NE ARG A 131 35.722 61.161 42.613 1.00 55.66 N
ATOM 1007 CZ ARG A 131 35.792 61.977 41.562 1.00 57.55 C
ATOM 1008 NH1 ARG A 131 35.550 63.279 41.687 1.00 57.21 N
ATOM 1009 NH2 ARG A 131 36.117 61.493 40.373 1.00 57.94 N
ATOM 1010 N GLY A 132 38.645 60.703 47.850 1.00 52.06 N
ATOM 1011 CA GLY A 132 38.355 60.690 49.272 1.00 51.24 C
ATOM 1012 C GLY A 132 39.536 61.148 50.106 1.00 51.42 C
ATOM 1013 O GLY A 132 39.361 61.745 51.171 1.00 52.54 O
ATOM 1014 N VAL A 133 40.742 60.863 49.624 1.00 50.20 N
ATOM 1015 CA VAL A 133 41.972 61.265 50.300 1.00 49.40 C
ATOM 1016 C VAL A 133 42.073 62.783 50.261 1.00 49.57 C
ATOM 1017 O VAL A 133 42.335 63.432 51.277 1.00 49.46 O
ATOM 1018 CB VAL A 133 43.211 60.676 49.592 1.00 49.53 C
ATOM 1019 CG1 VAL A 133 44.472 61.427 50.004 1.00 47.76 C
ATOM 1020 CG2 VAL A 133 43.342 59.206 49.933 1.00 48.63 C
ATOM 1021 N ILE A 134 41.880 63.345 49.073 1.00 49.13 N
ATOM 1022 CA ILE A 134 41.929 64.790 48.911 1.00 47.82 C
ATOM 1023 C ILE A 134 40.889 65.431 49.828 1.00 48.21 C
ATOM 1024 O ILE A 134 41.186 66.419 50.499 1.00 49.16 O
ATOM 1025 CB ILE A 134 41.650 65.204 47.450 1.00 46.10 C
ATOM 1026 CG1 ILE A 134 42.762 64.675 46.549 1.00 44.67 C
ATOM 1027 CG2 ILE A 134 41.564 66.710 47.331 1.00 43.12 C
ATOM 1028 CD1 ILE A 134 42.480 64.836 45.081 1.00 43.92 C
ATOM 1029 N LEU A 135 39.683 64.872 49.882 1.00 46.59 N
ATOM 1030 CA LEU A 135 38.673 65.465 50.748 1.00 47.13 C
ATOM 1031 C LEU A 135 39.109 65.482 52.207 1.00 47.73 C
ATOM 1032 O LEU A 135 38.695 66.359 52.971 1.00 49.14 O
ATOM 1033 CB LEU A 135 37.323 64.752 50.616 1.00 44.17 C
ATOM 1034 CG LEU A 135 36.474 65.067 49.381 1.00 40.79 C
ATOM 1035 CD1 LEU A 135 35.188 64.266 49.456 1.00 39.20 C
ATOM 1036 CD2 LEU A 135 36.181 66.535 49.294 1.00 36.61 C
ATOM 1037 N GLN A 136 39.940 64.526 52.601 1.00 48.28 N
ATOM 1038 CA GLN A 136 40.410 64.499 53.977 1.00 50.00 C
ATOM 1039 C GLN A 136 41.506 65.532 54.151 1.00 48.90 C
ATOM 1040 O GLN A 136 41.626 66.149 55.211 1.00 49.32 O
ATOM 1041 CB GLN A 136 40.945 63.115 54.365 1.00 53.41 C
ATOM 1042 CG GLN A 136 39.876 62.081 54.687 1.00 61.09 C
ATOM 1043 CD GLN A 136 38.988 62.462 55.890 1.00 67.45 C
ATOM 1044 OE1 GLN A 136 39.436 62.438 57.047 1.00 69.78 O
ATOM 1045 NE2 GLN A 136 37.722 62.816 55.613 1.00 68.01 N
ATOM 1046 N GLU A 137 42.306 65.730 53.114 1.00 47.67 N
ATOM 1047 CA GLU A 137 43.379 66.702 53.211 1.00 48.84 C
ATOM 1048 C GLU A 137 42.840 68.125 53.296 1.00 48.11 C
ATOM 1049 O GLU A 137 43.504 69.007 53.826 1.00 46.89 O
ATOM 1050 CB GLU A 137 44.333 66.574 52.029 1.00 50.81 C
ATOM 1051 CG GLU A 137 45.019 65.226 51.928 1.00 54.63 C
ATOM 1052 CD GLU A 137 46.080 65.203 50.837 1.00 57.51 C
ATOM 1053 OE1 GLU A 137 45.825 65.786 49.760 1.00 57.49 O
ATOM 1054 OE2 GLU A 137 47.159 64.598 51.049 1.00 59.27 O
ATOM 1055 N LEU A 138 41.637 68.350 52.772 1.00 48.76 N
ATOM 1056 CA LEU A 138 41.036 69.676 52.831 1.00 48.73 C
ATOM 1057 C LEU A 138 40.588 69.981 54.252 1.00 50.00 C
ATOM 1058 O LEU A 138 40.626 71.126 54.679 1.00 51.67 O
ATOM 1059 CB LEU A 138 39.843 69.794 51.884 1.00 47.36 C
ATOM 1060 CG LEU A 138 40.100 69.920 50.379 1.00 47.03 C
ATOM 1061 CD1 LEU A 138 38.778 70.041 49.661 1.00 46.24 C
ATOM 1062 CD2 LEU A 138 40.954 71.123 50.081 1.00 46.50 C
ATOM 1063 N LYS A 139 40.158 68.961 54.985 1.00 51.33 N
ATOM 1064 CA LYS A 139 39.734 69.155 56.364 1.00 52.43 C
ATOM 1065 C LYS A 139 40.959 69.314 57.257 1.00 52.73 C
ATOM 1066 O LYS A 139 40.913 69.994 58.283 1.00 52.16 O
ATOM 1067 CB LYS A 139 38.895 67.969 56.828 1.00 53.67 C
ATOM 1068 CG LYS A 139 37.672 67.766 55.968 1.00 58.39 C
ATOM 1069 CD LYS A 139 36.898 66.512 56.331 1.00 62.53 C
ATOM 1070 CE LYS A 139 35.751 66.270 55.337 1.00 65.23 C
ATOM 1071 NZ LYS A 139 35.214 64.873 55.429 1.00 67.59 N
ATOM 1072 N GLU A 140 42.063 68.690 56.865 1.00 53.15 N
ATOM 1073 CA GLU A 140 43.273 68.798 57.654 1.00 54.66 C
ATOM 1074 C GLU A 140 43.804 70.216 57.521 1.00 53.67 C
ATOM 1075 O GLU A 140 44.168 70.849 58.506 1.00 54.44 O
ATOM 1076 CB GLU A 140 44.334 67.815 57.161 1.00 59.11 C
ATOM 1077 CG GLU A 140 43.965 66.331 57.251 1.00 64.61 C
ATOM 1078 CD GLU A 140 45.075 65.426 56.704 1.00 67.82 C
ATOM 1079 OE1 GLU A 140 45.525 65.662 55.558 1.00 68.72 O
ATOM 1080 OE2 GLU A 140 45.497 64.481 57.413 1.00 71.02 O
ATOM 1081 N MET A 141 43.827 70.720 56.293 1.00 52.44 N
ATOM 1082 CA MET A 141 44.339 72.055 56.019 1.00 51.47 C
ATOM 1083 C MET A 141 43.438 73.163 56.507 1.00 51.41 C
ATOM 1084 O MET A 141 43.880 74.290 56.663 1.00 52.24 O
ATOM 1085 CB MET A 141 44.576 72.222 54.522 1.00 51.52 C
ATOM 1086 CG MET A 141 45.521 71.176 53.956 1.00 54.38 C
ATOM 1087 SD MET A 141 45.602 71.131 52.154 1.00 56.49 S
ATOM 1088 CE MET A 141 47.074 72.177 51.919 1.00 57.35 C
ATOM 1089 N ASP A 142 42.175 72.842 56.750 1.00 51.38 N
ATOM 1090 CA ASP A 142 41.210 73.830 57.205 1.00 50.41 C
ATOM 1091 C ASP A 142 41.531 74.229 58.629 1.00 50.88 C
ATOM 1092 O ASP A 142 40.993 75.200 59.146 1.00 50.84 O
ATOM 1093 CB ASP A 142 39.803 73.249 57.127 1.00 50.77 C
ATOM 1094 CG ASP A 142 38.768 74.277 56.732 1.00 51.90 C
ATOM 1095 OD1 ASP A 142 39.073 75.123 55.871 1.00 51.39 O
ATOM 1096 OD2 ASP A 142 37.640 74.230 57.264 1.00 54.88 O
ATOM 1097 N ASN A 143 42.415 73.472 59.265 1.00 51.70 N
ATOM 1098 CA ASN A 143 42.799 73.772 60.631 1.00 52.07 C
ATOM 1099 C ASN A 143 44.136 74.471 60.659 1.00 52.45 C
ATOM 1100 O ASN A 143 44.652 74.794 61.718 1.00 53.56 O
ATOM 1101 CB ASN A 143 42.842 72.496 61.465 1.00 51.81 C
ATOM 1102 CG ASN A 143 41.480 71.831 61.564 1.00 53.75 C
ATOM 1103 OD1 ASN A 143 40.508 72.448 61.998 1.00 53.27 O
ATOM 1104 ND2 ASN A 143 41.401 70.568 61.156 1.00 55.06 N
ATOM 1105 N ASP A 144 44.695 74.709 59.482 1.00 53.59 N
ATOM 1106 CA ASP A 144 45.977 75.389 59.375 1.00 54.31 C
ATOM 1107 C ASP A 144 45.706 76.876 59.143 1.00 53.30 C
ATOM 1108 O ASP A 144 45.714 77.347 58.004 1.00 52.71 O
ATOM 1109 CB ASP A 144 46.777 74.815 58.206 1.00 57.94 C
ATOM 1110 CG ASP A 144 48.201 75.345 58.153 1.00 62.32 C
ATOM 1111 OD1 ASP A 144 48.440 76.482 58.623 1.00 65.40 O
ATOM 1112 OD2 ASP A 144 49.083 74.629 57.625 1.00 64.02 O
ATOM 1113 N MET A 145 45.460 77.600 60.232 1.00 52.56 N
ATOM 1114 CA MET A 145 45.166 79.029 60.194 1.00 51.44 C
ATOM 1115 C MET A 145 46.030 79.800 59.220 1.00 50.36 C
ATOM 1116 O MET A 145 45.532 80.581 58.406 1.00 49.35 O
ATOM 1117 CB MET A 145 45.375 79.642 61.569 1.00 54.29 C
ATOM 1118 CG MET A 145 44.660 78.950 62.691 1.00 59.00 C
ATOM 1119 SD MET A 145 42.953 79.350 62.679 1.00 67.00 S
ATOM 1120 CE MET A 145 42.298 78.112 61.405 1.00 62.34 C
ATOM 1121 N THR A 146 47.337 79.602 59.322 1.00 49.26 N
ATOM 1122 CA THR A 146 48.257 80.312 58.451 1.00 49.16 C
ATOM 1123 C THR A 146 47.909 80.131 56.980 1.00 48.51 C
ATOM 1124 O THR A 146 47.944 81.090 56.204 1.00 48.78 O
ATOM 1125 CB THR A 146 49.709 79.873 58.678 1.00 48.87 C
ATOM 1126 OG1 THR A 146 50.075 80.129 60.039 1.00 50.20 O
ATOM 1127 CG2 THR A 146 50.639 80.657 57.768 1.00 47.77 C
ATOM 1128 N ASN A 147 47.559 78.911 56.595 1.00 46.48 N
ATOM 1129 CA ASN A 147 47.207 78.670 55.214 1.00 46.04 C
ATOM 1130 C ASN A 147 45.793 79.083 54.870 1.00 43.22 C
ATOM 1131 O ASN A 147 45.518 79.463 53.736 1.00 43.63 O
ATOM 1132 CB ASN A 147 47.493 77.219 54.850 1.00 51.25 C
ATOM 1133 CG ASN A 147 49.004 76.955 54.744 1.00 57.23 C
ATOM 1134 OD1 ASN A 147 49.736 77.709 54.060 1.00 56.36 O
ATOM 1135 ND2 ASN A 147 49.484 75.902 55.427 1.00 58.02 N
ATOM 1136 N VAL A 148 44.899 79.033 55.849 1.00 40.65 N
ATOM 1137 CA VAL A 148 43.524 79.473 55.636 1.00 37.21 C
ATOM 1138 C VAL A 148 43.605 80.985 55.416 1.00 37.07 C
ATOM 1139 O VAL A 148 42.912 81.549 54.563 1.00 35.79 O
ATOM 1140 CB VAL A 148 42.644 79.215 56.880 1.00 34.70 C
ATOM 1141 CG1 VAL A 148 41.248 79.754 56.655 1.00 33.33 C
ATOM 1142 CG2 VAL A 148 42.591 77.745 57.174 1.00 33.05 C
ATOM 1143 N THR A 149 44.474 81.627 56.195 1.00 36.82 N
ATOM 1144 CA THR A 149 44.652 83.064 56.117 1.00 37.72 C
ATOM 1145 C THR A 149 45.261 83.504 54.796 1.00 38.44 C
ATOM 1146 O THR A 149 44.839 84.517 54.223 1.00 39.09 O
ATOM 1147 CB THR A 149 45.508 83.584 57.277 1.00 38.57 C
ATOM 1148 OG1 THR A 149 44.809 83.386 58.513 1.00 39.36 O
ATOM 1149 CG2 THR A 149 45.777 85.064 57.107 1.00 38.06 C
ATOM 1150 N PHE A 150 46.243 82.763 54.290 1.00 38.21 N
ATOM 1151 CA PHE A 150 46.815 83.157 53.015 1.00 36.45 C
ATOM 1152 C PHE A 150 45.852 82.900 51.868 1.00 35.19 C
ATOM 1153 O PHE A 150 45.809 83.678 50.900 1.00 32.87 O
ATOM 1154 CB PHE A 150 48.142 82.477 52.784 1.00 35.75 C
ATOM 1155 CG PHE A 150 49.267 83.162 53.474 1.00 39.63 C
ATOM 1156 CD1 PHE A 150 49.671 82.759 54.749 1.00 40.14 C
ATOM 1157 CD2 PHE A 150 49.901 84.253 52.877 1.00 40.01 C
ATOM 1158 CE1 PHE A 150 50.691 83.431 55.430 1.00 40.65 C
ATOM 1159 CE2 PHE A 150 50.927 84.934 53.548 1.00 41.82 C
ATOM 1160 CZ PHE A 150 51.321 84.521 54.830 1.00 41.41 C
ATOM 1161 N ASP A 151 45.063 81.835 51.980 1.00 34.02 N
ATOM 1162 CA ASP A 151 44.083 81.548 50.942 1.00 36.17 C
ATOM 1163 C ASP A 151 43.104 82.716 50.892 1.00 36.66 C
ATOM 1164 O ASP A 151 42.847 83.284 49.817 1.00 37.21 O
ATOM 1165 CB ASP A 151 43.341 80.233 51.218 1.00 37.55 C
ATOM 1166 CG ASP A 151 44.136 78.998 50.748 1.00 41.48 C
ATOM 1167 OD1 ASP A 151 44.969 79.142 49.821 1.00 41.65 O
ATOM 1168 OD2 ASP A 151 43.926 77.881 51.282 1.00 42.53 O
ATOM 1169 N TYR A 152 42.585 83.092 52.063 1.00 35.74 N
ATOM 1170 CA TYR A 152 41.655 84.207 52.159 1.00 31.87 C
ATOM 1171 C TYR A 152 42.298 85.467 51.638 1.00 32.52 C
ATOM 1172 O TYR A 152 41.647 86.242 50.938 1.00 33.42 O
ATOM 1173 CB TYR A 152 41.207 84.395 53.598 1.00 29.56 C
ATOM 1174 CG TYR A 152 40.165 83.391 54.036 1.00 27.34 C
ATOM 1175 CD1 TYR A 152 39.842 83.235 55.378 1.00 25.51 C
ATOM 1176 CD2 TYR A 152 39.470 82.628 53.099 1.00 26.35 C
ATOM 1177 CE1 TYR A 152 38.852 82.348 55.777 1.00 27.64 C
ATOM 1178 CE2 TYR A 152 38.475 81.737 53.480 1.00 26.31 C
ATOM 1179 CZ TYR A 152 38.170 81.600 54.820 1.00 28.64 C
ATOM 1180 OH TYR A 152 37.189 80.717 55.199 1.00 29.21 O
ATOM 1181 N LEU A 153 43.580 85.674 51.951 1.00 33.20 N
ATOM 1182 CA LEU A 153 44.275 86.872 51.470 1.00 32.93 C
ATOM 1183 C LEU A 153 44.201 86.945 49.935 1.00 35.14 C
ATOM 1184 O LEU A 153 43.961 88.008 49.367 1.00 35.05 O
ATOM 1185 CB LEU A 153 45.730 86.873 51.925 1.00 30.55 C
ATOM 1186 CG LEU A 153 46.512 88.125 51.509 1.00 31.92 C
ATOM 1187 CD1 LEU A 153 45.865 89.352 52.102 1.00 32.83 C
ATOM 1188 CD2 LEU A 153 47.950 88.029 51.974 1.00 32.20 C
ATOM 1189 N HIS A 154 44.404 85.811 49.265 1.00 35.74 N
ATOM 1190 CA HIS A 154 44.321 85.773 47.810 1.00 35.69 C
ATOM 1191 C HIS A 154 42.849 85.859 47.382 1.00 35.01 C
ATOM 1192 O HIS A 154 42.506 86.495 46.380 1.00 36.16 O
ATOM 1193 CB HIS A 154 44.880 84.462 47.250 1.00 39.04 C
ATOM 1194 CG HIS A 154 46.371 84.374 47.236 1.00 41.99 C
ATOM 1195 ND1 HIS A 154 47.113 84.075 48.358 1.00 44.43 N
ATOM 1196 CD2 HIS A 154 47.258 84.504 46.221 1.00 45.16 C
ATOM 1197 CE1 HIS A 154 48.395 84.024 48.035 1.00 45.45 C
ATOM 1198 NE2 HIS A 154 48.510 84.280 46.744 1.00 46.14 N
ATOM 1199 N ALA A 155 41.980 85.193 48.128 1.00 31.65 N
ATOM 1200 CA ALA A 155 40.578 85.206 47.785 1.00 30.23 C
ATOM 1201 C ALA A 155 40.009 86.634 47.659 1.00 31.58 C
ATOM 1202 O ALA A 155 39.153 86.893 46.791 1.00 32.94 O
ATOM 1203 CB ALA A 155 39.791 84.390 48.807 1.00 26.19 C
ATOM 1204 N THR A 156 40.490 87.560 48.489 1.00 29.83 N
ATOM 1205 CA THR A 156 39.987 88.930 48.446 1.00 30.34 C
ATOM 1206 C THR A 156 40.894 89.883 47.654 1.00 30.91 C
ATOM 1207 O THR A 156 40.401 90.729 46.890 1.00 30.46 O
ATOM 1208 CB THR A 156 39.765 89.513 49.910 1.00 31.89 C
ATOM 1209 OG1 THR A 156 38.933 90.688 49.852 1.00 30.58 O
ATOM 1210 CG2 THR A 156 41.113 89.897 50.575 1.00 26.57 C
ATOM 1211 N ALA A 157 42.206 89.758 47.845 1.00 30.57 N
ATOM 1212 CA ALA A 157 43.168 90.609 47.153 1.00 31.59 C
ATOM 1213 C ALA A 157 43.008 90.488 45.639 1.00 34.23 C
ATOM 1214 O ALA A 157 43.207 91.462 44.903 1.00 34.98 O
ATOM 1215 CB ALA A 157 44.562 90.225 47.542 1.00 31.65 C
ATOM 1216 N PHE A 158 42.653 89.288 45.181 1.00 34.78 N
ATOM 1217 CA PHE A 158 42.457 89.025 43.764 1.00 36.17 C
ATOM 1218 C PHE A 158 41.043 88.534 43.493 1.00 37.75 C
ATOM 1219 O PHE A 158 40.832 87.721 42.593 1.00 39.35 O
ATOM 1220 CB PHE A 158 43.459 87.965 43.267 1.00 35.11 C
ATOM 1221 CG PHE A 158 44.898 88.372 43.412 1.00 33.39 C
ATOM 1222 CD1 PHE A 158 45.749 87.662 44.245 1.00 33.85 C
ATOM 1223 CD2 PHE A 158 45.394 89.489 42.747 1.00 33.33 C
ATOM 1224 CE1 PHE A 158 47.073 88.055 44.422 1.00 31.46 C
ATOM 1225 CE2 PHE A 158 46.715 89.890 42.917 1.00 30.98 C
ATOM 1226 CZ PHE A 158 47.554 89.170 43.757 1.00 31.56 C
ATOM 1227 N GLN A 159 40.074 89.019 44.267 1.00 38.93 N
ATOM 1228 CA GLN A 159 38.678 88.602 44.090 1.00 38.83 C
ATOM 1229 C GLN A 159 38.221 88.800 42.647 1.00 39.31 C
ATOM 1230 O GLN A 159 38.644 89.730 41.963 1.00 40.48 O
ATOM 1231 CB GLN A 159 37.757 89.395 45.013 1.00 37.52 C
ATOM 1232 CG GLN A 159 37.868 90.892 44.799 1.00 38.04 C
ATOM 1233 CD GLN A 159 36.988 91.699 45.716 1.00 35.42 C
ATOM 1234 OE1 GLN A 159 35.882 92.092 45.350 1.00 34.02 O
ATOM 1235 NE2 GLN A 159 37.477 91.947 46.921 1.00 34.54 N
ATOM 1236 N GLY A 160 37.357 87.912 42.185 1.00 39.66 N
ATOM 1237 CA GLY A 160 36.872 88.027 40.831 1.00 39.15 C
ATOM 1238 C GLY A 160 37.801 87.449 39.783 1.00 38.92 C
ATOM 1239 O GLY A 160 37.384 87.221 38.654 1.00 40.49 O
ATOM 1240 N THR A 161 39.057 87.210 40.142 1.00 39.04 N
ATOM 1241 CA THR A 161 40.012 86.677 39.186 1.00 37.67 C
ATOM 1242 C THR A 161 40.448 85.256 39.490 1.00 39.15 C
ATOM 1243 O THR A 161 39.875 84.584 40.351 1.00 38.10 O
ATOM 1244 CB THR A 161 41.265 87.532 39.107 1.00 35.82 C
ATOM 1245 OG1 THR A 161 42.097 87.231 40.225 1.00 35.81 O
ATOM 1246 CG2 THR A 161 40.911 89.004 39.119 1.00 35.65 C
ATOM 1247 N ALA A 162 41.486 84.813 38.773 1.00 42.15 N
ATOM 1248 CA ALA A 162 42.018 83.447 38.884 1.00 40.82 C
ATOM 1249 C ALA A 162 42.908 83.201 40.082 1.00 37.89 C
ATOM 1250 O ALA A 162 42.924 82.095 40.618 1.00 38.06 O
ATOM 1251 CB ALA A 162 42.764 83.067 37.598 1.00 41.26 C
ATOM 1252 N LEU A 163 43.661 84.207 40.498 1.00 34.66 N
ATOM 1253 CA LEU A 163 44.518 84.015 41.651 1.00 35.07 C
ATOM 1254 C LEU A 163 43.702 83.948 42.942 1.00 35.27 C
ATOM 1255 O LEU A 163 44.228 83.661 44.012 1.00 35.48 O
ATOM 1256 CB LEU A 163 45.543 85.136 41.731 1.00 35.47 C
ATOM 1257 CG LEU A 163 46.646 85.031 40.684 1.00 34.27 C
ATOM 1258 CD1 LEU A 163 47.494 86.307 40.654 1.00 30.86 C
ATOM 1259 CD2 LEU A 163 47.486 83.800 41.020 1.00 34.10 C
ATOM 1260 N ALA A 164 42.405 84.207 42.834 1.00 35.68 N
ATOM 1261 CA ALA A 164 41.525 84.176 43.990 1.00 35.91 C
ATOM 1262 C ALA A 164 41.308 82.734 44.436 1.00 38.08 C
ATOM 1263 O ALA A 164 41.142 82.457 45.621 1.00 40.68 O
ATOM 1264 CB ALA A 164 40.197 84.834 43.644 1.00 33.00 C
ATOM 1265 N ARG A 165 41.324 81.810 43.481 1.00 39.49 N
ATOM 1266 CA ARG A 165 41.129 80.400 43.779 1.00 40.45 C
ATOM 1267 C ARG A 165 42.296 79.803 44.567 1.00 42.66 C
ATOM 1268 O ARG A 165 43.432 80.291 44.497 1.00 45.40 O
ATOM 1269 CB ARG A 165 40.937 79.610 42.482 1.00 40.99 C
ATOM 1270 CG ARG A 165 39.857 80.152 41.585 1.00 42.69 C
ATOM 1271 CD ARG A 165 39.164 79.043 40.784 1.00 46.08 C
ATOM 1272 NE ARG A 165 38.061 79.581 39.988 1.00 46.99 N
ATOM 1273 CZ ARG A 165 38.224 80.382 38.935 1.00 48.54 C
ATOM 1274 NH1 ARG A 165 39.449 80.734 38.535 1.00 46.51 N
ATOM 1275 NH2 ARG A 165 37.156 80.856 38.301 1.00 49.02 N
ATOM 1276 N THR A 166 42.004 78.744 45.315 1.00 43.42 N
ATOM 1277 CA THR A 166 43.006 78.051 46.103 1.00 44.95 C
ATOM 1278 C THR A 166 43.642 76.968 45.229 1.00 47.77 C
ATOM 1279 O THR A 166 43.082 76.573 44.193 1.00 50.07 O
ATOM 1280 CB THR A 166 42.364 77.371 47.311 1.00 45.56 C
ATOM 1281 OG1 THR A 166 41.448 76.369 46.853 1.00 46.82 O
ATOM 1282 CG2 THR A 166 41.607 78.391 48.167 1.00 44.95 C
ATOM 1283 N VAL A 167 44.806 76.474 45.637 1.00 48.51 N
ATOM 1284 CA VAL A 167 45.471 75.432 44.865 1.00 47.02 C
ATOM 1285 C VAL A 167 44.737 74.100 44.927 1.00 46.33 C
ATOM 1286 O VAL A 167 44.570 73.437 43.922 1.00 47.17 O
ATOM 1287 CB VAL A 167 46.916 75.215 45.346 1.00 46.58 C
ATOM 1288 CG1 VAL A 167 47.507 73.993 44.655 1.00 47.01 C
ATOM 1289 CG2 VAL A 167 47.751 76.441 45.033 1.00 44.12 C
ATOM 1290 N GLU A 168 44.293 73.709 46.110 1.00 47.36 N
ATOM 1291 CA GLU A 168 43.607 72.436 46.263 1.00 48.37 C
ATOM 1292 C GLU A 168 42.257 72.348 45.552 1.00 49.85 C
ATOM 1293 O GLU A 168 41.809 71.249 45.213 1.00 50.77 O
ATOM 1294 CB GLU A 168 43.410 72.116 47.741 1.00 48.54 C
ATOM 1295 CG GLU A 168 44.686 72.061 48.570 1.00 49.85 C
ATOM 1296 CD GLU A 168 45.380 73.398 48.678 1.00 50.18 C
ATOM 1297 OE1 GLU A 168 44.686 74.397 48.943 1.00 54.01 O
ATOM 1298 OE2 GLU A 168 46.617 73.454 48.510 1.00 51.29 O
ATOM 1299 N GLY A 169 41.595 73.483 45.337 1.00 49.27 N
ATOM 1300 CA GLY A 169 40.307 73.439 44.664 1.00 49.89 C
ATOM 1301 C GLY A 169 39.086 73.403 45.572 1.00 50.93 C
ATOM 1302 O GLY A 169 39.206 73.391 46.787 1.00 51.92 O
ATOM 1303 N THR A 170 37.904 73.370 44.968 1.00 52.36 N
ATOM 1304 CA THR A 170 36.632 73.365 45.684 1.00 52.72 C
ATOM 1305 C THR A 170 36.167 71.978 46.071 1.00 52.43 C
ATOM 1306 O THR A 170 36.667 70.986 45.559 1.00 54.15 O
ATOM 1307 CB THR A 170 35.534 73.976 44.809 1.00 54.11 C
ATOM 1308 OG1 THR A 170 35.956 75.266 44.357 1.00 55.07 O
ATOM 1309 CG2 THR A 170 34.243 74.118 45.586 1.00 56.33 C
ATOM 1310 N THR A 171 35.193 71.911 46.973 1.00 52.03 N
ATOM 1311 CA THR A 171 34.636 70.631 47.396 1.00 50.78 C
ATOM 1312 C THR A 171 33.796 70.055 46.258 1.00 50.68 C
ATOM 1313 O THR A 171 33.804 68.855 46.032 1.00 50.00 O
ATOM 1314 CB THR A 171 33.748 70.777 48.663 1.00 49.74 C
ATOM 1315 OG1 THR A 171 34.576 70.977 49.810 1.00 47.47 O
ATOM 1316 CG2 THR A 171 32.904 69.535 48.880 1.00 48.02 C
ATOM 1317 N GLU A 172 33.072 70.910 45.543 1.00 51.89 N
ATOM 1318 CA GLU A 172 32.249 70.443 44.431 1.00 54.06 C
ATOM 1319 C GLU A 172 33.073 69.895 43.277 1.00 54.11 C
ATOM 1320 O GLU A 172 32.688 68.913 42.638 1.00 54.59 O
ATOM 1321 CB GLU A 172 31.334 71.558 43.921 1.00 55.66 C
ATOM 1322 CG GLU A 172 30.098 71.717 44.771 1.00 60.10 C
ATOM 1323 CD GLU A 172 29.360 70.393 44.970 1.00 62.93 C
ATOM 1324 OE1 GLU A 172 28.771 69.889 43.982 1.00 63.58 O
ATOM 1325 OE2 GLU A 172 29.378 69.854 46.107 1.00 63.32 O
ATOM 1326 N ASN A 173 34.201 70.539 43.006 1.00 54.07 N
ATOM 1327 CA ASN A 173 35.084 70.090 41.946 1.00 54.44 C
ATOM 1328 C ASN A 173 35.661 68.719 42.306 1.00 54.50 C
ATOM 1329 O ASN A 173 35.581 67.766 41.536 1.00 55.16 O
ATOM 1330 CB ASN A 173 36.206 71.108 41.743 1.00 54.13 C
ATOM 1331 CG ASN A 173 35.764 72.290 40.907 1.00 54.94 C
ATOM 1332 OD1 ASN A 173 34.573 72.468 40.650 1.00 54.06 O
ATOM 1333 ND2 ASN A 173 36.719 73.107 40.476 1.00 54.62 N
ATOM 1334 N ILE A 174 36.228 68.618 43.494 1.00 54.13 N
ATOM 1335 CA ILE A 174 36.808 67.369 43.930 1.00 54.15 C
ATOM 1336 C ILE A 174 35.789 66.245 43.938 1.00 54.24 C
ATOM 1337 O ILE A 174 36.135 65.093 43.727 1.00 55.75 O
ATOM 1338 CB ILE A 174 37.435 67.544 45.322 1.00 53.75 C
ATOM 1339 CG1 ILE A 174 38.662 68.440 45.177 1.00 55.07 C
ATOM 1340 CG2 ILE A 174 37.797 66.189 45.938 1.00 50.66 C
ATOM 1341 CD1 ILE A 174 39.230 68.898 46.480 1.00 59.69 C
ATOM 1342 N LYS A 175 34.529 66.576 44.167 1.00 54.73 N
ATOM 1343 CA LYS A 175 33.489 65.558 44.205 1.00 56.00 C
ATOM 1344 C LYS A 175 33.014 65.151 42.821 1.00 57.50 C
ATOM 1345 O LYS A 175 32.375 64.105 42.669 1.00 57.84 O
ATOM 1346 CB LYS A 175 32.283 66.058 44.986 1.00 55.95 C
ATOM 1347 CG LYS A 175 32.492 66.206 46.475 1.00 57.22 C
ATOM 1348 CD LYS A 175 31.246 66.801 47.118 1.00 58.30 C
ATOM 1349 CE LYS A 175 30.006 65.988 46.764 1.00 59.81 C
ATOM 1350 NZ LYS A 175 28.769 66.532 47.364 1.00 61.11 N
ATOM 1351 N HIS A 176 33.328 65.969 41.816 1.00 57.77 N
ATOM 1352 CA HIS A 176 32.876 65.695 40.462 1.00 58.02 C
ATOM 1353 C HIS A 176 33.908 65.769 39.344 1.00 58.38 C
ATOM 1354 O HIS A 176 33.539 65.759 38.172 1.00 58.27 O
ATOM 1355 CB HIS A 176 31.712 66.629 40.135 1.00 59.74 C
ATOM 1356 CG HIS A 176 30.563 66.507 41.088 1.00 62.98 C
ATOM 1357 ND1 HIS A 176 29.787 65.370 41.180 1.00 64.18 N
ATOM 1358 CD2 HIS A 176 30.103 67.352 42.041 1.00 64.15 C
ATOM 1359 CE1 HIS A 176 28.901 65.516 42.151 1.00 63.89 C
ATOM 1360 NE2 HIS A 176 29.072 66.710 42.689 1.00 65.81 N
ATOM 1361 N LEU A 177 35.195 65.843 39.671 1.00 58.58 N
ATOM 1362 CA LEU A 177 36.194 65.902 38.607 1.00 57.93 C
ATOM 1363 C LEU A 177 36.269 64.548 37.916 1.00 59.79 C
ATOM 1364 O LEU A 177 36.362 63.505 38.562 1.00 60.01 O
ATOM 1365 CB LEU A 177 37.559 66.320 39.153 1.00 54.89 C
ATOM 1366 CG LEU A 177 37.737 67.839 39.217 1.00 51.91 C
ATOM 1367 CD1 LEU A 177 39.012 68.208 39.946 1.00 50.84 C
ATOM 1368 CD2 LEU A 177 37.754 68.384 37.804 1.00 50.69 C
ATOM 1369 N THR A 178 36.210 64.582 36.591 1.00 61.75 N
ATOM 1370 CA THR A 178 36.223 63.381 35.769 1.00 62.55 C
ATOM 1371 C THR A 178 37.581 62.926 35.260 1.00 63.35 C
ATOM 1372 O THR A 178 38.495 63.724 35.052 1.00 63.48 O
ATOM 1373 CB THR A 178 35.280 63.568 34.568 1.00 61.89 C
ATOM 1374 OG1 THR A 178 33.930 63.368 34.999 1.00 63.40 O
ATOM 1375 CG2 THR A 178 35.615 62.606 33.442 1.00 64.69 C
ATOM 1376 N ARG A 179 37.690 61.619 35.056 1.00 64.48 N
ATOM 1377 CA ARG A 179 38.905 61.007 34.551 1.00 65.19 C
ATOM 1378 C ARG A 179 39.310 61.776 33.301 1.00 65.14 C
ATOM 1379 O ARG A 179 40.494 61.967 33.022 1.00 64.67 O
ATOM 1380 CB ARG A 179 38.625 59.538 34.231 1.00 66.19 C
ATOM 1381 CG ARG A 179 39.850 58.678 34.023 1.00 69.04 C
ATOM 1382 CD ARG A 179 40.338 58.755 32.603 1.00 72.43 C
ATOM 1383 NE ARG A 179 41.606 58.054 32.433 1.00 75.93 N
ATOM 1384 CZ ARG A 179 42.266 57.973 31.279 1.00 77.58 C
ATOM 1385 NH1 ARG A 179 41.770 58.550 30.186 1.00 77.40 N
ATOM 1386 NH2 ARG A 179 43.429 57.330 31.222 1.00 77.25 N
ATOM 1387 N ALA A 180 38.307 62.246 32.567 1.00 65.78 N
ATOM 1388 CA ALA A 180 38.535 63.008 31.340 1.00 66.36 C
ATOM 1389 C ALA A 180 39.079 64.406 31.619 1.00 66.06 C
ATOM 1390 O ALA A 180 39.898 64.922 30.855 1.00 66.11 O
ATOM 1391 CB ALA A 180 37.235 63.106 30.542 1.00 65.97 C
ATOM 1392 N ASP A 181 38.617 65.009 32.714 1.00 65.38 N
ATOM 1393 CA ASP A 181 39.036 66.352 33.113 1.00 63.79 C
ATOM 1394 C ASP A 181 40.508 66.354 33.480 1.00 62.46 C
ATOM 1395 O ASP A 181 41.262 67.234 33.061 1.00 61.20 O
ATOM 1396 CB ASP A 181 38.217 66.826 34.314 1.00 64.69 C
ATOM 1397 CG ASP A 181 36.726 66.761 34.063 1.00 67.38 C
ATOM 1398 OD1 ASP A 181 36.271 65.774 33.448 1.00 71.08 O
ATOM 1399 OD2 ASP A 181 36.000 67.680 34.488 1.00 67.79 O
ATOM 1400 N LEU A 182 40.916 65.363 34.267 1.00 61.50 N
ATOM 1401 CA LEU A 182 42.308 65.266 34.686 1.00 61.64 C
ATOM 1402 C LEU A 182 43.155 65.056 33.440 1.00 61.69 C
ATOM 1403 O LEU A 182 44.215 65.675 33.271 1.00 61.33 O
ATOM 1404 CB LEU A 182 42.490 64.093 35.645 1.00 61.17 C
ATOM 1405 CG LEU A 182 41.455 64.016 36.767 1.00 60.59 C
ATOM 1406 CD1 LEU A 182 41.710 62.785 37.591 1.00 59.78 C
ATOM 1407 CD2 LEU A 182 41.517 65.261 37.636 1.00 61.70 C
ATOM 1408 N ALA A 183 42.662 64.182 32.565 1.00 60.19 N
ATOM 1409 CA ALA A 183 43.343 63.877 31.313 1.00 59.19 C
ATOM 1410 C ALA A 183 43.493 65.152 30.504 1.00 58.00 C
ATOM 1411 O ALA A 183 44.576 65.472 30.014 1.00 58.20 O
ATOM 1412 CB ALA A 183 42.543 62.862 30.524 1.00 60.24 C
ATOM 1413 N SER A 184 42.389 65.877 30.366 1.00 55.97 N
ATOM 1414 CA SER A 184 42.391 67.124 29.625 1.00 53.88 C
ATOM 1415 C SER A 184 43.398 68.080 30.241 1.00 52.65 C
ATOM 1416 O SER A 184 44.170 68.728 29.531 1.00 51.35 O
ATOM 1417 CB SER A 184 40.996 67.751 29.644 1.00 53.78 C
ATOM 1418 OG SER A 184 41.014 69.047 29.065 1.00 54.97 O
ATOM 1419 N TYR A 185 43.399 68.154 31.568 1.00 52.11 N
ATOM 1420 CA TYR A 185 44.314 69.041 32.257 1.00 52.04 C
ATOM 1421 C TYR A 185 45.732 68.742 31.823 1.00 52.74 C
ATOM 1422 O TYR A 185 46.451 69.626 31.348 1.00 51.37 O
ATOM 1423 CB TYR A 185 44.209 68.868 33.775 1.00 52.02 C
ATOM 1424 CG TYR A 185 45.149 69.790 34.538 1.00 51.79 C
ATOM 1425 CD1 TYR A 185 44.808 71.127 34.806 1.00 49.55 C
ATOM 1426 CD2 TYR A 185 46.413 69.347 34.927 1.00 50.85 C
ATOM 1427 CE1 TYR A 185 45.714 71.993 35.439 1.00 49.03 C
ATOM 1428 CE2 TYR A 185 47.326 70.209 35.557 1.00 49.93 C
ATOM 1429 CZ TYR A 185 46.978 71.521 35.813 1.00 49.24 C
ATOM 1430 OH TYR A 185 47.892 72.334 36.465 1.00 48.19 O
ATOM 1431 N ILE A 186 46.119 67.480 31.977 1.00 54.09 N
ATOM 1432 CA ILE A 186 47.464 67.045 31.639 1.00 55.10 C
ATOM 1433 C ILE A 186 47.884 67.379 30.224 1.00 56.62 C
ATOM 1434 O ILE A 186 48.977 67.903 30.004 1.00 55.94 O
ATOM 1435 CB ILE A 186 47.637 65.535 31.852 1.00 53.30 C
ATOM 1436 CG1 ILE A 186 47.308 65.175 33.302 1.00 51.62 C
ATOM 1437 CG2 ILE A 186 49.070 65.143 31.549 1.00 53.84 C
ATOM 1438 CD1 ILE A 186 47.512 63.729 33.648 1.00 47.67 C
ATOM 1439 N ASP A 187 47.017 67.083 29.265 1.00 59.73 N
ATOM 1440 CA ASP A 187 47.335 67.340 27.864 1.00 63.92 C
ATOM 1441 C ASP A 187 47.418 68.819 27.567 1.00 64.23 C
ATOM 1442 O ASP A 187 48.250 69.265 26.769 1.00 64.58 O
ATOM 1443 CB ASP A 187 46.287 66.713 26.935 1.00 68.03 C
ATOM 1444 CG ASP A 187 46.138 65.212 27.143 1.00 72.98 C
ATOM 1445 OD1 ASP A 187 47.175 64.497 27.173 1.00 74.34 O
ATOM 1446 OD2 ASP A 187 44.977 64.752 27.273 1.00 75.10 O
ATOM 1447 N THR A 188 46.553 69.582 28.220 1.00 63.18 N
ATOM 1448 CA THR A 188 46.515 71.011 27.995 1.00 61.70 C
ATOM 1449 C THR A 188 47.710 71.751 28.568 1.00 61.11 C
ATOM 1450 O THR A 188 48.233 72.668 27.944 1.00 60.50 O
ATOM 1451 CB THR A 188 45.269 71.614 28.613 1.00 61.39 C
ATOM 1452 OG1 THR A 188 44.145 70.765 28.353 1.00 62.77 O
ATOM 1453 CG2 THR A 188 45.020 72.982 28.031 1.00 60.61 C
ATOM 1454 N HIS A 189 48.159 71.333 29.745 1.00 61.39 N
ATOM 1455 CA HIS A 189 49.248 72.031 30.418 1.00 61.72 C
ATOM 1456 C HIS A 189 50.627 71.404 30.475 1.00 62.54 C
ATOM 1457 O HIS A 189 51.619 72.098 30.321 1.00 61.73 O
ATOM 1458 CB HIS A 189 48.793 72.394 31.830 1.00 60.36 C
ATOM 1459 CG HIS A 189 47.524 73.187 31.854 1.00 58.65 C
ATOM 1460 ND1 HIS A 189 47.412 74.425 31.262 1.00 57.84 N
ATOM 1461 CD2 HIS A 189 46.300 72.897 32.351 1.00 59.22 C
ATOM 1462 CE1 HIS A 189 46.175 74.864 31.391 1.00 57.93 C
ATOM 1463 NE2 HIS A 189 45.479 73.956 32.048 1.00 58.79 N
ATOM 1464 N PHE A 190 50.713 70.105 30.713 1.00 65.60 N
ATOM 1465 CA PHE A 190 52.023 69.467 30.766 1.00 66.94 C
ATOM 1466 C PHE A 190 52.581 69.377 29.349 1.00 67.93 C
ATOM 1467 O PHE A 190 52.528 68.322 28.718 1.00 67.52 O
ATOM 1468 CB PHE A 190 51.902 68.079 31.396 1.00 66.69 C
ATOM 1469 CG PHE A 190 51.533 68.105 32.857 1.00 67.79 C
ATOM 1470 CD1 PHE A 190 51.375 66.921 33.569 1.00 67.94 C
ATOM 1471 CD2 PHE A 190 51.362 69.317 33.532 1.00 68.17 C
ATOM 1472 CE1 PHE A 190 51.055 66.942 34.934 1.00 68.07 C
ATOM 1473 CE2 PHE A 190 51.043 69.345 34.893 1.00 67.14 C
ATOM 1474 CZ PHE A 190 50.890 68.156 35.594 1.00 66.48 C
ATOM 1475 N LYS A 191 53.108 70.497 28.856 1.00 69.36 N
ATOM 1476 CA LYS A 191 53.658 70.565 27.507 1.00 71.09 C
ATOM 1477 C LYS A 191 55.089 71.097 27.419 1.00 71.00 C
ATOM 1478 O LYS A 191 55.439 72.115 28.018 1.00 70.48 O
ATOM 1479 CB LYS A 191 52.738 71.399 26.609 1.00 73.93 C
ATOM 1480 CG LYS A 191 51.388 70.736 26.330 1.00 77.94 C
ATOM 1481 CD LYS A 191 50.763 71.250 25.029 1.00 80.87 C
ATOM 1482 CE LYS A 191 49.588 70.375 24.585 1.00 82.85 C
ATOM 1483 NZ LYS A 191 49.043 70.763 23.248 1.00 83.25 N
ATOM 1484 N ALA A 192 55.899 70.386 26.640 1.00 70.83 N
ATOM 1485 CA ALA A 192 57.310 70.692 26.431 1.00 70.77 C
ATOM 1486 C ALA A 192 57.760 72.150 26.571 1.00 70.38 C
ATOM 1487 O ALA A 192 58.596 72.459 27.417 1.00 69.88 O
ATOM 1488 CB ALA A 192 57.751 70.139 25.074 1.00 70.33 C
ATOM 1489 N PRO A 193 57.228 73.064 25.739 1.00 70.79 N
ATOM 1490 CA PRO A 193 57.648 74.466 25.850 1.00 70.98 C
ATOM 1491 C PRO A 193 57.366 75.124 27.210 1.00 70.89 C
ATOM 1492 O PRO A 193 57.994 76.131 27.568 1.00 70.70 O
ATOM 1493 CB PRO A 193 56.912 75.137 24.690 1.00 70.89 C
ATOM 1494 CG PRO A 193 55.669 74.321 24.559 1.00 72.29 C
ATOM 1495 CD PRO A 193 56.188 72.908 24.706 1.00 71.79 C
ATOM 1496 N ARG A 194 56.441 74.542 27.971 1.00 69.89 N
ATOM 1497 CA ARG A 194 56.095 75.066 29.289 1.00 69.19 C
ATOM 1498 C ARG A 194 56.753 74.291 30.430 1.00 67.79 C
ATOM 1499 O ARG A 194 56.441 74.520 31.595 1.00 68.41 O
ATOM 1500 CB ARG A 194 54.573 75.061 29.469 1.00 69.92 C
ATOM 1501 CG ARG A 194 53.856 76.104 28.622 1.00 71.68 C
ATOM 1502 CD ARG A 194 52.357 75.848 28.531 1.00 71.31 C
ATOM 1503 NE ARG A 194 51.741 75.712 29.844 1.00 71.93 N
ATOM 1504 CZ ARG A 194 50.435 75.575 30.037 1.00 71.90 C
ATOM 1505 NH1 ARG A 194 49.613 75.563 28.997 1.00 72.69 N
ATOM 1506 NH2 ARG A 194 49.957 75.424 31.265 1.00 71.39 N
ATOM 1507 N MET A 195 57.662 73.377 30.099 1.00 66.11 N
ATOM 1508 CA MET A 195 58.350 72.583 31.115 1.00 64.41 C
ATOM 1509 C MET A 195 59.849 72.838 31.128 1.00 64.02 C
ATOM 1510 O MET A 195 60.418 73.358 30.167 1.00 64.83 O
ATOM 1511 CB MET A 195 58.107 71.092 30.890 1.00 62.83 C
ATOM 1512 CG MET A 195 56.650 70.707 30.885 1.00 64.49 C
ATOM 1513 SD MET A 195 56.425 68.922 30.898 1.00 67.33 S
ATOM 1514 CE MET A 195 55.660 68.654 29.330 1.00 66.27 C
ATOM 1515 N VAL A 196 60.486 72.466 32.228 1.00 63.16 N
ATOM 1516 CA VAL A 196 61.920 72.636 32.371 1.00 62.84 C
ATOM 1517 C VAL A 196 62.527 71.431 33.075 1.00 63.62 C
ATOM 1518 O VAL A 196 62.148 71.126 34.209 1.00 64.13 O
ATOM 1519 CB VAL A 196 62.257 73.892 33.193 1.00 62.68 C
ATOM 1520 CG1 VAL A 196 63.760 73.970 33.440 1.00 63.32 C
ATOM 1521 CG2 VAL A 196 61.775 75.129 32.462 1.00 61.21 C
ATOM 1522 N LEU A 197 63.446 70.734 32.397 1.00 63.61 N
ATOM 1523 CA LEU A 197 64.121 69.586 32.999 1.00 61.35 C
ATOM 1524 C LEU A 197 65.335 70.175 33.695 1.00 59.83 C
ATOM 1525 O LEU A 197 66.250 70.694 33.056 1.00 57.99 O
ATOM 1526 CB LEU A 197 64.546 68.564 31.942 1.00 61.83 C
ATOM 1527 CG LEU A 197 65.053 67.218 32.502 1.00 62.96 C
ATOM 1528 CD1 LEU A 197 63.992 66.583 33.381 1.00 62.65 C
ATOM 1529 CD2 LEU A 197 65.404 66.269 31.369 1.00 62.72 C
ATOM 1530 N ALA A 198 65.310 70.130 35.019 1.00 59.31 N
ATOM 1531 CA ALA A 198 66.388 70.681 35.812 1.00 60.09 C
ATOM 1532 C ALA A 198 67.055 69.574 36.590 1.00 61.21 C
ATOM 1533 O ALA A 198 66.415 68.572 36.939 1.00 61.69 O
ATOM 1534 CB ALA A 198 65.853 71.734 36.763 1.00 59.46 C
ATOM 1535 N ALA A 199 68.345 69.758 36.861 1.00 61.29 N
ATOM 1536 CA ALA A 199 69.111 68.773 37.603 1.00 60.89 C
ATOM 1537 C ALA A 199 70.319 69.438 38.236 1.00 61.01 C
ATOM 1538 O ALA A 199 70.844 70.419 37.714 1.00 61.21 O
ATOM 1539 CB ALA A 199 69.553 67.652 36.670 1.00 60.35 C
ATOM 1540 N ALA A 200 70.743 68.911 39.376 1.00 61.30 N
ATOM 1541 CA ALA A 200 71.902 69.441 40.069 1.00 63.13 C
ATOM 1542 C ALA A 200 72.573 68.298 40.806 1.00 65.70 C
ATOM 1543 O ALA A 200 71.908 67.351 41.239 1.00 66.43 O
ATOM 1544 CB ALA A 200 71.491 70.521 41.037 1.00 62.99 C
ATOM 1545 N GLY A 201 73.894 68.394 40.935 1.00 67.83 N
ATOM 1546 CA GLY A 201 74.672 67.364 41.601 1.00 69.95 C
ATOM 1547 C GLY A 201 75.812 66.905 40.705 1.00 71.89 C
ATOM 1548 O GLY A 201 76.400 67.712 39.971 1.00 71.96 O
ATOM 1549 N GLY A 202 76.131 65.612 40.763 1.00 72.54 N
ATOM 1550 CA GLY A 202 77.198 65.076 39.932 1.00 72.86 C
ATOM 1551 C GLY A 202 76.620 64.494 38.657 1.00 72.57 C
ATOM 1552 O GLY A 202 76.468 63.283 38.522 1.00 72.11 O
ATOM 1553 N ILE A 203 76.301 65.362 37.707 1.00 73.30 N
ATOM 1554 CA ILE A 203 75.709 64.912 36.461 1.00 74.49 C
ATOM 1555 C ILE A 203 76.260 65.612 35.233 1.00 73.93 C
ATOM 1556 O ILE A 203 76.611 66.793 35.267 1.00 72.05 O
ATOM 1557 CB ILE A 203 74.182 65.121 36.481 1.00 76.54 C
ATOM 1558 CG1 ILE A 203 73.570 64.352 37.650 1.00 78.26 C
ATOM 1559 CG2 ILE A 203 73.566 64.653 35.175 1.00 77.02 C
ATOM 1560 CD1 ILE A 203 72.127 64.720 37.909 1.00 80.59 C
ATOM 1561 N SER A 204 76.322 64.861 34.141 1.00 74.45 N
ATOM 1562 CA SER A 204 76.804 65.394 32.880 1.00 75.24 C
ATOM 1563 C SER A 204 75.650 66.101 32.196 1.00 74.83 C
ATOM 1564 O SER A 204 74.598 65.501 31.955 1.00 73.12 O
ATOM 1565 CB SER A 204 77.314 64.268 31.974 1.00 75.64 C
ATOM 1566 OG SER A 204 77.569 64.750 30.662 1.00 74.33 O
ATOM 1567 N HIS A 205 75.846 67.380 31.893 1.00 74.50 N
ATOM 1568 CA HIS A 205 74.814 68.135 31.223 1.00 74.85 C
ATOM 1569 C HIS A 205 74.475 67.431 29.909 1.00 75.26 C
ATOM 1570 O HIS A 205 73.300 67.249 29.580 1.00 74.84 O
ATOM 1571 CB HIS A 205 75.290 69.561 30.960 1.00 76.10 C
ATOM 1572 CG HIS A 205 74.279 70.406 30.254 1.00 78.32 C
ATOM 1573 ND1 HIS A 205 73.037 70.676 30.787 1.00 79.50 N
ATOM 1574 CD2 HIS A 205 74.301 70.995 29.035 1.00 78.81 C
ATOM 1575 CE1 HIS A 205 72.336 71.390 29.925 1.00 79.79 C
ATOM 1576 NE2 HIS A 205 73.079 71.597 28.853 1.00 79.54 N
ATOM 1577 N LYS A 206 75.509 67.014 29.176 1.00 76.37 N
ATOM 1578 CA LYS A 206 75.317 66.334 27.894 1.00 77.07 C
ATOM 1579 C LYS A 206 74.669 64.956 28.039 1.00 76.85 C
ATOM 1580 O LYS A 206 73.985 64.499 27.129 1.00 76.37 O
ATOM 1581 CB LYS A 206 76.645 66.199 27.126 1.00 78.30 C
ATOM 1582 CG LYS A 206 77.615 65.172 27.705 1.00 80.13 C
ATOM 1583 CD LYS A 206 78.604 64.637 26.662 1.00 79.11 C
ATOM 1584 CE LYS A 206 79.427 63.478 27.244 1.00 79.38 C
ATOM 1585 NZ LYS A 206 80.364 62.841 26.269 1.00 78.36 N
ATOM 1586 N GLU A 207 74.890 64.282 29.164 1.00 77.32 N
ATOM 1587 CA GLU A 207 74.266 62.975 29.372 1.00 78.53 C
ATOM 1588 C GLU A 207 72.808 63.204 29.748 1.00 78.35 C
ATOM 1589 O GLU A 207 71.913 62.427 29.382 1.00 77.08 O
ATOM 1590 CB GLU A 207 74.963 62.213 30.493 1.00 79.21 C
ATOM 1591 CG GLU A 207 76.205 61.492 30.051 1.00 82.54 C
ATOM 1592 CD GLU A 207 76.918 60.826 31.209 1.00 84.38 C
ATOM 1593 OE1 GLU A 207 76.271 60.018 31.912 1.00 84.56 O
ATOM 1594 OE2 GLU A 207 78.123 61.111 31.414 1.00 85.20 O
ATOM 1595 N LEU A 208 72.590 64.284 30.493 1.00 78.29 N
ATOM 1596 CA LEU A 208 71.261 64.669 30.926 1.00 77.63 C
ATOM 1597 C LEU A 208 70.439 64.993 29.692 1.00 77.59 C
ATOM 1598 O LEU A 208 69.358 64.432 29.479 1.00 76.73 O
ATOM 1599 CB LEU A 208 71.333 65.903 31.823 1.00 77.68 C
ATOM 1600 CG LEU A 208 69.986 66.524 32.196 1.00 76.99 C
ATOM 1601 CD1 LEU A 208 69.195 65.566 33.076 1.00 76.04 C
ATOM 1602 CD2 LEU A 208 70.230 67.840 32.909 1.00 77.56 C
ATOM 1603 N VAL A 209 70.965 65.899 28.874 1.00 77.26 N
ATOM 1604 CA VAL A 209 70.274 66.306 27.663 1.00 78.51 C
ATOM 1605 C VAL A 209 70.081 65.143 26.685 1.00 79.53 C
ATOM 1606 O VAL A 209 69.137 65.144 25.889 1.00 79.94 O
ATOM 1607 CB VAL A 209 71.011 67.477 26.972 1.00 77.44 C
ATOM 1608 CG1 VAL A 209 72.424 67.092 26.669 1.00 79.35 C
ATOM 1609 CG2 VAL A 209 70.280 67.874 25.700 1.00 78.33 C
ATOM 1610 N ASP A 210 70.961 64.145 26.751 1.00 80.55 N
ATOM 1611 CA ASP A 210 70.846 62.986 25.868 1.00 81.33 C
ATOM 1612 C ASP A 210 69.646 62.136 26.241 1.00 80.68 C
ATOM 1613 O ASP A 210 68.804 61.834 25.390 1.00 80.27 O
ATOM 1614 CB ASP A 210 72.118 62.138 25.908 1.00 83.86 C
ATOM 1615 CG ASP A 210 73.153 62.601 24.896 1.00 86.13 C
ATOM 1616 OD1 ASP A 210 72.787 62.725 23.706 1.00 86.79 O
ATOM 1617 OD2 ASP A 210 74.322 62.837 25.281 1.00 87.61 O
ATOM 1618 N ALA A 211 69.565 61.753 27.514 1.00 80.25 N
ATOM 1619 CA ALA A 211 68.437 60.958 27.993 1.00 79.47 C
ATOM 1620 C ALA A 211 67.167 61.773 27.773 1.00 79.16 C
ATOM 1621 O ALA A 211 66.089 61.224 27.531 1.00 78.18 O
ATOM 1622 CB ALA A 211 68.608 60.643 29.463 1.00 78.84 C
ATOM 1623 N ALA A 212 67.317 63.093 27.858 1.00 79.21 N
ATOM 1624 CA ALA A 212 66.216 64.020 27.661 1.00 79.28 C
ATOM 1625 C ALA A 212 65.686 63.881 26.241 1.00 80.38 C
ATOM 1626 O ALA A 212 64.478 63.771 26.030 1.00 80.39 O
ATOM 1627 CB ALA A 212 66.686 65.436 27.905 1.00 78.22 C
ATOM 1628 N ARG A 213 66.597 63.886 25.269 1.00 81.57 N
ATOM 1629 CA ARG A 213 66.221 63.749 23.867 1.00 82.27 C
ATOM 1630 C ARG A 213 65.530 62.418 23.639 1.00 83.11 C
ATOM 1631 O ARG A 213 64.560 62.325 22.883 1.00 83.54 O
ATOM 1632 CB ARG A 213 67.455 63.836 22.978 1.00 82.17 C
ATOM 1633 CG ARG A 213 67.861 65.245 22.647 1.00 83.19 C
ATOM 1634 CD ARG A 213 69.292 65.306 22.157 1.00 84.21 C
ATOM 1635 NE ARG A 213 69.693 66.683 21.881 1.00 84.89 N
ATOM 1636 CZ ARG A 213 70.950 67.112 21.892 1.00 85.51 C
ATOM 1637 NH1 ARG A 213 71.939 66.266 22.169 1.00 84.75 N
ATOM 1638 NH2 ARG A 213 71.216 68.387 21.631 1.00 85.46 N
ATOM 1639 N GLN A 214 66.024 61.391 24.319 1.00 83.59 N
ATOM 1640 CA GLN A 214 65.475 60.055 24.178 1.00 84.78 C
ATOM 1641 C GLN A 214 64.065 59.870 24.753 1.00 85.25 C
ATOM 1642 O GLN A 214 63.245 59.162 24.163 1.00 84.95 O
ATOM 1643 CB GLN A 214 66.438 59.044 24.809 1.00 85.63 C
ATOM 1644 CG GLN A 214 66.269 57.616 24.302 1.00 87.39 C
ATOM 1645 CD GLN A 214 67.364 56.687 24.801 1.00 88.27 C
ATOM 1646 OE1 GLN A 214 67.379 56.289 25.967 1.00 88.49 O
ATOM 1647 NE2 GLN A 214 68.297 56.346 23.917 1.00 88.28 N
ATOM 1648 N HIS A 215 63.765 60.510 25.883 1.00 85.89 N
ATOM 1649 CA HIS A 215 62.448 60.338 26.498 1.00 86.14 C
ATOM 1650 C HIS A 215 61.470 61.496 26.387 1.00 86.51 C
ATOM 1651 O HIS A 215 60.259 61.293 26.459 1.00 85.89 O
ATOM 1652 CB HIS A 215 62.610 59.964 27.960 1.00 86.25 C
ATOM 1653 CG HIS A 215 63.569 58.840 28.187 1.00 85.90 C
ATOM 1654 ND1 HIS A 215 64.926 59.037 28.329 1.00 85.20 N
ATOM 1655 CD2 HIS A 215 63.368 57.505 28.285 1.00 85.26 C
ATOM 1656 CE1 HIS A 215 65.520 57.872 28.511 1.00 85.07 C
ATOM 1657 NE2 HIS A 215 64.597 56.926 28.488 1.00 85.32 N
ATOM 1658 N PHE A 216 61.982 62.709 26.250 1.00 87.36 N
ATOM 1659 CA PHE A 216 61.105 63.856 26.098 1.00 88.56 C
ATOM 1660 C PHE A 216 61.112 64.174 24.613 1.00 89.49 C
ATOM 1661 O PHE A 216 61.844 65.040 24.136 1.00 89.50 O
ATOM 1662 CB PHE A 216 61.601 65.039 26.936 1.00 88.68 C
ATOM 1663 CG PHE A 216 61.471 64.823 28.428 1.00 88.67 C
ATOM 1664 CD1 PHE A 216 62.580 64.491 29.203 1.00 88.71 C
ATOM 1665 CD2 PHE A 216 60.230 64.934 29.055 1.00 88.27 C
ATOM 1666 CE1 PHE A 216 62.456 64.273 30.581 1.00 88.55 C
ATOM 1667 CE2 PHE A 216 60.096 64.718 30.427 1.00 88.22 C
ATOM 1668 CZ PHE A 216 61.214 64.386 31.191 1.00 88.17 C
ATOM 1669 N SER A 217 60.290 63.427 23.889 1.00 90.81 N
ATOM 1670 CA SER A 217 60.173 63.553 22.446 1.00 92.36 C
ATOM 1671 C SER A 217 58.881 64.246 22.000 1.00 93.05 C
ATOM 1672 O SER A 217 58.828 65.474 21.901 1.00 92.89 O
ATOM 1673 CB SER A 217 60.262 62.157 21.831 1.00 92.77 C
ATOM 1674 OG SER A 217 59.569 61.216 22.640 1.00 92.29 O
ATOM 1675 N GLY A 218 57.857 63.442 21.726 1.00 93.48 N
ATOM 1676 CA GLY A 218 56.562 63.943 21.289 1.00 95.12 C
ATOM 1677 C GLY A 218 56.462 65.397 20.865 1.00 96.07 C
ATOM 1678 O GLY A 218 55.739 66.177 21.493 1.00 96.49 O
ATOM 1679 N VAL A 219 57.163 65.761 19.792 1.00 96.95 N
ATOM 1680 CA VAL A 219 57.149 67.138 19.295 1.00 97.52 C
ATOM 1681 C VAL A 219 55.765 67.537 18.777 1.00 96.79 C
ATOM 1682 O VAL A 219 54.920 66.687 18.485 1.00 96.10 O
ATOM 1683 CB VAL A 219 58.207 67.353 18.156 1.00 98.77 C
ATOM 1684 CG1 VAL A 219 58.283 68.840 17.768 1.00 98.53 C
ATOM 1685 CG2 VAL A 219 59.584 66.852 18.610 1.00 98.74 C
ATOM 1686 N SER A 220 55.552 68.844 18.669 1.00 96.31 N
ATOM 1687 CA SER A 220 54.291 69.408 18.206 1.00 95.76 C
ATOM 1688 C SER A 220 54.315 69.803 16.724 1.00 95.16 C
ATOM 1689 O SER A 220 55.369 70.123 16.167 1.00 95.46 O
ATOM 1690 CB SER A 220 53.949 70.620 19.070 1.00 96.10 C
ATOM 1691 OG SER A 220 55.116 71.382 19.348 1.00 96.57 O
ATOM 1692 N PHE A 221 53.144 69.781 16.095 1.00 93.51 N
ATOM 1693 CA PHE A 221 53.031 70.125 14.687 1.00 92.38 C
ATOM 1694 C PHE A 221 52.554 71.551 14.456 1.00 91.93 C
ATOM 1695 O PHE A 221 53.217 72.335 13.776 1.00 92.41 O
ATOM 1696 CB PHE A 221 52.077 69.160 13.987 1.00 92.19 C
ATOM 1697 CG PHE A 221 52.481 67.732 14.110 1.00 92.09 C
ATOM 1698 CD1 PHE A 221 52.082 66.982 15.203 1.00 91.83 C
ATOM 1699 CD2 PHE A 221 53.295 67.142 13.150 1.00 92.41 C
ATOM 1700 CE1 PHE A 221 52.488 65.664 15.341 1.00 92.27 C
ATOM 1701 CE2 PHE A 221 53.708 65.825 13.280 1.00 92.23 C
ATOM 1702 CZ PHE A 221 53.303 65.084 14.378 1.00 91.98 C
ATOM 1703 N THR A 222 51.397 71.885 15.014 1.00 90.70 N
ATOM 1704 CA THR A 222 50.838 73.218 14.850 1.00 88.76 C
ATOM 1705 C THR A 222 51.580 74.260 15.670 1.00 87.62 C
ATOM 1706 O THR A 222 52.424 73.926 16.497 1.00 87.10 O
ATOM 1707 CB THR A 222 49.356 73.248 15.246 1.00 89.02 C
ATOM 1708 OG1 THR A 222 49.212 72.772 16.589 1.00 89.04 O
ATOM 1709 CG2 THR A 222 48.539 72.373 14.308 1.00 88.95 C
ATOM 1710 N TYR A 223 51.251 75.524 15.428 1.00 86.59 N
ATOM 1711 CA TYR A 223 51.863 76.648 16.127 1.00 85.76 C
ATOM 1712 C TYR A 223 51.207 76.843 17.501 1.00 85.65 C
ATOM 1713 O TYR A 223 51.834 77.315 18.450 1.00 83.94 O
ATOM 1714 CB TYR A 223 51.703 77.917 15.283 1.00 85.07 C
ATOM 1715 CG TYR A 223 50.259 78.347 15.086 1.00 83.97 C
ATOM 1716 CD1 TYR A 223 49.744 79.458 15.763 1.00 82.80 C
ATOM 1717 CD2 TYR A 223 49.402 77.633 14.241 1.00 82.71 C
ATOM 1718 CE1 TYR A 223 48.410 79.848 15.606 1.00 82.76 C
ATOM 1719 CE2 TYR A 223 48.064 78.010 14.076 1.00 82.51 C
ATOM 1720 CZ TYR A 223 47.572 79.121 14.762 1.00 83.32 C
ATOM 1721 OH TYR A 223 46.251 79.507 14.606 1.00 82.09 O
ATOM 1722 N LYS A 224 49.937 76.472 17.596 1.00 86.12 N
ATOM 1723 CA LYS A 224 49.210 76.604 18.840 1.00 87.86 C
ATOM 1724 C LYS A 224 49.743 75.647 19.896 1.00 89.25 C
ATOM 1725 O LYS A 224 49.455 75.800 21.082 1.00 90.21 O
ATOM 1726 CB LYS A 224 47.722 76.349 18.605 1.00 87.97 C
ATOM 1727 CG LYS A 224 47.017 77.511 17.937 1.00 90.02 C
ATOM 1728 CD LYS A 224 45.543 77.224 17.689 1.00 92.38 C
ATOM 1729 CE LYS A 224 44.844 78.437 17.070 1.00 93.77 C
ATOM 1730 NZ LYS A 224 43.412 78.181 16.723 1.00 94.96 N
ATOM 1731 N GLU A 225 50.528 74.664 19.471 1.00 90.33 N
ATOM 1732 CA GLU A 225 51.078 73.688 20.404 1.00 90.35 C
ATOM 1733 C GLU A 225 52.431 74.079 20.984 1.00 89.46 C
ATOM 1734 O GLU A 225 52.858 73.502 21.981 1.00 90.31 O
ATOM 1735 CB GLU A 225 51.226 72.315 19.739 1.00 91.69 C
ATOM 1736 CG GLU A 225 49.948 71.713 19.192 1.00 94.16 C
ATOM 1737 CD GLU A 225 50.078 70.221 18.934 1.00 96.31 C
ATOM 1738 OE1 GLU A 225 51.090 69.803 18.323 1.00 97.00 O
ATOM 1739 OE2 GLU A 225 49.163 69.469 19.342 1.00 97.49 O
ATOM 1740 N ASP A 226 53.119 75.042 20.382 1.00 87.95 N
ATOM 1741 CA ASP A 226 54.439 75.411 20.892 1.00 87.70 C
ATOM 1742 C ASP A 226 54.546 76.830 21.451 1.00 85.35 C
ATOM 1743 O ASP A 226 55.626 77.293 21.840 1.00 83.26 O
ATOM 1744 CB ASP A 226 55.492 75.172 19.801 1.00 91.52 C
ATOM 1745 CG ASP A 226 55.263 76.021 18.562 1.00 94.22 C
ATOM 1746 OD1 ASP A 226 54.088 76.326 18.249 1.00 95.86 O
ATOM 1747 OD2 ASP A 226 56.264 76.370 17.895 1.00 95.90 O
ATOM 1748 N ALA A 227 53.402 77.501 21.488 1.00 83.64 N
ATOM 1749 CA ALA A 227 53.262 78.855 22.006 1.00 81.49 C
ATOM 1750 C ALA A 227 52.846 78.769 23.471 1.00 79.60 C
ATOM 1751 O ALA A 227 51.939 78.015 23.819 1.00 78.25 O
ATOM 1752 CB ALA A 227 52.198 79.593 21.212 1.00 81.60 C
ATOM 1753 N VAL A 228 53.525 79.531 24.324 1.00 78.50 N
ATOM 1754 CA VAL A 228 53.220 79.568 25.751 1.00 76.99 C
ATOM 1755 C VAL A 228 52.166 80.660 25.973 1.00 75.24 C
ATOM 1756 O VAL A 228 52.463 81.849 25.863 1.00 74.53 O
ATOM 1757 CB VAL A 228 54.487 79.888 26.577 1.00 77.45 C
ATOM 1758 CG1 VAL A 228 55.199 81.119 26.011 1.00 76.71 C
ATOM 1759 CG2 VAL A 228 54.104 80.112 28.028 1.00 78.37 C
ATOM 1760 N PRO A 229 50.923 80.262 26.297 1.00 73.97 N
ATOM 1761 CA PRO A 229 49.803 81.182 26.530 1.00 73.05 C
ATOM 1762 C PRO A 229 50.018 82.210 27.641 1.00 71.37 C
ATOM 1763 O PRO A 229 50.413 81.860 28.754 1.00 71.66 O
ATOM 1764 CB PRO A 229 48.647 80.234 26.840 1.00 73.41 C
ATOM 1765 CG PRO A 229 49.331 79.135 27.587 1.00 74.20 C
ATOM 1766 CD PRO A 229 50.558 78.896 26.719 1.00 74.65 C
ATOM 1767 N ILE A 230 49.771 83.479 27.331 1.00 68.72 N
ATOM 1768 CA ILE A 230 49.916 84.525 28.333 1.00 67.13 C
ATOM 1769 C ILE A 230 48.584 84.556 29.081 1.00 64.23 C
ATOM 1770 O ILE A 230 47.519 84.614 28.461 1.00 62.63 O
ATOM 1771 CB ILE A 230 50.177 85.911 27.697 1.00 68.06 C
ATOM 1772 CG1 ILE A 230 51.302 85.810 26.656 1.00 68.38 C
ATOM 1773 CG2 ILE A 230 50.572 86.907 28.788 1.00 66.43 C
ATOM 1774 CD1 ILE A 230 51.478 87.059 25.789 1.00 66.61 C
ATOM 1775 N LEU A 231 48.647 84.492 30.409 1.00 61.17 N
ATOM 1776 CA LEU A 231 47.434 84.494 31.219 1.00 57.44 C
ATOM 1777 C LEU A 231 46.807 85.874 31.356 1.00 54.75 C
ATOM 1778 O LEU A 231 47.494 86.899 31.318 1.00 53.46 O
ATOM 1779 CB LEU A 231 47.729 83.929 32.615 1.00 56.35 C
ATOM 1780 CG LEU A 231 48.005 82.421 32.727 1.00 56.76 C
ATOM 1781 CD1 LEU A 231 48.225 82.048 34.187 1.00 54.93 C
ATOM 1782 CD2 LEU A 231 46.837 81.623 32.139 1.00 55.08 C
ATOM 1783 N PRO A 232 45.478 85.922 31.489 1.00 52.89 N
ATOM 1784 CA PRO A 232 44.810 87.218 31.641 1.00 52.73 C
ATOM 1785 C PRO A 232 45.138 87.803 33.015 1.00 53.34 C
ATOM 1786 O PRO A 232 45.217 87.070 34.009 1.00 54.56 O
ATOM 1787 CB PRO A 232 43.333 86.872 31.475 1.00 51.39 C
ATOM 1788 CG PRO A 232 43.255 85.458 31.941 1.00 52.82 C
ATOM 1789 CD PRO A 232 44.504 84.829 31.366 1.00 52.10 C
ATOM 1790 N ARG A 233 45.360 89.115 33.063 1.00 53.69 N
ATOM 1791 CA ARG A 233 45.696 89.805 34.309 1.00 53.64 C
ATOM 1792 C ARG A 233 44.699 89.606 35.435 1.00 51.80 C
ATOM 1793 O ARG A 233 43.490 89.519 35.218 1.00 52.41 O
ATOM 1794 CB ARG A 233 45.800 91.308 34.095 1.00 56.01 C
ATOM 1795 CG ARG A 233 46.815 91.758 33.071 1.00 59.34 C
ATOM 1796 CD ARG A 233 47.122 93.202 33.383 1.00 60.44 C
ATOM 1797 NE ARG A 233 47.509 93.294 34.788 1.00 59.14 N
ATOM 1798 CZ ARG A 233 48.719 93.002 35.250 1.00 58.56 C
ATOM 1799 NH1 ARG A 233 49.674 92.612 34.417 1.00 59.81 N
ATOM 1800 NH2 ARG A 233 48.966 93.070 36.550 1.00 59.20 N
ATOM 1801 N CYS A 234 45.226 89.554 36.648 1.00 49.63 N
ATOM 1802 CA CYS A 234 44.396 89.415 37.829 1.00 46.16 C
ATOM 1803 C CYS A 234 44.368 90.775 38.526 1.00 43.04 C
ATOM 1804 O CYS A 234 45.399 91.298 38.960 1.00 41.20 O
ATOM 1805 CB CYS A 234 44.966 88.349 38.750 1.00 46.16 C
ATOM 1806 SG CYS A 234 44.679 86.702 38.134 1.00 48.38 S
ATOM 1807 N ARG A 235 43.179 91.358 38.595 1.00 40.60 N
ATOM 1808 CA ARG A 235 42.990 92.660 39.232 1.00 38.75 C
ATOM 1809 C ARG A 235 43.176 92.629 40.758 1.00 37.32 C
ATOM 1810 O ARG A 235 42.636 91.759 41.459 1.00 36.95 O
ATOM 1811 CB ARG A 235 41.592 93.194 38.889 1.00 36.76 C
ATOM 1812 CG ARG A 235 41.124 94.356 39.748 1.00 33.35 C
ATOM 1813 CD ARG A 235 39.646 94.557 39.589 1.00 29.81 C
ATOM 1814 NE ARG A 235 38.905 93.362 39.984 1.00 29.61 N
ATOM 1815 CZ ARG A 235 37.598 93.196 39.788 1.00 28.60 C
ATOM 1816 NH1 ARG A 235 36.892 94.156 39.196 1.00 28.14 N
ATOM 1817 NH2 ARG A 235 36.990 92.083 40.192 1.00 25.85 N
ATOM 1818 N PHE A 236 43.958 93.572 41.269 1.00 34.96 N
ATOM 1819 CA PHE A 236 44.144 93.638 42.707 1.00 36.32 C
ATOM 1820 C PHE A 236 43.033 94.515 43.291 1.00 37.26 C
ATOM 1821 O PHE A 236 42.578 95.467 42.644 1.00 37.75 O
ATOM 1822 CB PHE A 236 45.479 94.265 43.070 1.00 33.38 C
ATOM 1823 CG PHE A 236 45.709 94.350 44.549 1.00 29.97 C
ATOM 1824 CD1 PHE A 236 46.259 93.287 45.240 1.00 29.10 C
ATOM 1825 CD2 PHE A 236 45.363 95.488 45.251 1.00 29.01 C
ATOM 1826 CE1 PHE A 236 46.468 93.359 46.616 1.00 30.14 C
ATOM 1827 CE2 PHE A 236 45.566 95.570 46.631 1.00 28.55 C
ATOM 1828 CZ PHE A 236 46.122 94.506 47.313 1.00 27.32 C
ATOM 1829 N THR A 237 42.610 94.209 44.513 1.00 36.88 N
ATOM 1830 CA THR A 237 41.560 94.988 45.145 1.00 37.22 C
ATOM 1831 C THR A 237 41.862 95.262 46.609 1.00 36.82 C
ATOM 1832 O THR A 237 42.089 94.333 47.387 1.00 36.53 O
ATOM 1833 CB THR A 237 40.209 94.249 45.042 1.00 37.00 C
ATOM 1834 OG1 THR A 237 39.978 93.888 43.677 1.00 40.92 O
ATOM 1835 CG2 THR A 237 39.073 95.126 45.515 1.00 35.64 C
ATOM 1836 N GLY A 238 41.892 96.541 46.974 1.00 36.92 N
ATOM 1837 CA GLY A 238 42.104 96.899 48.369 1.00 36.16 C
ATOM 1838 C GLY A 238 40.817 96.482 49.076 1.00 36.15 C
ATOM 1839 O GLY A 238 39.743 97.020 48.807 1.00 36.84 O
ATOM 1840 N SER A 239 40.902 95.511 49.970 1.00 34.65 N
ATOM 1841 CA SER A 239 39.703 95.047 50.640 1.00 33.30 C
ATOM 1842 C SER A 239 40.047 94.149 51.817 1.00 32.42 C
ATOM 1843 O SER A 239 41.219 94.006 52.170 1.00 32.75 O
ATOM 1844 CB SER A 239 38.840 94.292 49.641 1.00 33.17 C
ATOM 1845 OG SER A 239 39.541 93.175 49.129 1.00 32.82 O
ATOM 1846 N GLU A 240 39.030 93.547 52.420 1.00 31.23 N
ATOM 1847 CA GLU A 240 39.238 92.674 53.570 1.00 31.78 C
ATOM 1848 C GLU A 240 38.176 91.589 53.670 1.00 32.16 C
ATOM 1849 O GLU A 240 37.029 91.760 53.245 1.00 32.18 O
ATOM 1850 CB GLU A 240 39.193 93.479 54.880 1.00 31.54 C
ATOM 1851 CG GLU A 240 37.854 94.194 55.061 1.00 37.37 C
ATOM 1852 CD GLU A 240 37.545 94.645 56.488 1.00 40.58 C
ATOM 1853 OE1 GLU A 240 38.422 95.258 57.146 1.00 41.69 O
ATOM 1854 OE2 GLU A 240 36.396 94.397 56.939 1.00 43.26 O
ATOM 1855 N ILE A 241 38.574 90.473 54.260 1.00 32.29 N
ATOM 1856 CA ILE A 241 37.673 89.369 54.509 1.00 33.64 C
ATOM 1857 C ILE A 241 37.940 89.059 55.982 1.00 33.51 C
ATOM 1858 O ILE A 241 39.094 88.901 56.391 1.00 33.19 O
ATOM 1859 CB ILE A 241 37.999 88.177 53.597 1.00 36.62 C
ATOM 1860 CG1 ILE A 241 37.204 86.954 54.023 1.00 38.23 C
ATOM 1861 CG2 ILE A 241 39.477 87.867 53.642 1.00 39.23 C
ATOM 1862 CD1 ILE A 241 37.198 85.870 52.955 1.00 38.04 C
ATOM 1863 N ARG A 242 36.878 89.049 56.791 1.00 33.81 N
ATOM 1864 CA ARG A 242 36.988 88.789 58.231 1.00 30.67 C
ATOM 1865 C ARG A 242 36.201 87.555 58.593 1.00 31.28 C
ATOM 1866 O ARG A 242 34.978 87.534 58.501 1.00 33.77 O
ATOM 1867 CB ARG A 242 36.464 89.983 59.035 1.00 29.23 C
ATOM 1868 CG ARG A 242 37.338 91.212 58.943 1.00 26.34 C
ATOM 1869 CD ARG A 242 36.731 92.422 59.600 1.00 26.02 C
ATOM 1870 NE ARG A 242 37.578 93.606 59.419 1.00 30.94 N
ATOM 1871 CZ ARG A 242 38.325 94.186 60.369 1.00 34.83 C
ATOM 1872 NH1 ARG A 242 38.361 93.708 61.620 1.00 36.72 N
ATOM 1873 NH2 ARG A 242 39.044 95.261 60.068 1.00 34.30 N
ATOM 1874 N ALA A 243 36.914 86.514 58.989 1.00 33.01 N
ATOM 1875 CA ALA A 243 36.288 85.253 59.374 1.00 33.63 C
ATOM 1876 C ALA A 243 36.479 85.149 60.875 1.00 33.61 C
ATOM 1877 O ALA A 243 37.547 84.800 61.360 1.00 34.35 O
ATOM 1878 CB ALA A 243 36.959 84.089 58.659 1.00 31.70 C
ATOM 1879 N ARG A 244 35.426 85.457 61.608 1.00 34.22 N
ATOM 1880 CA ARG A 244 35.502 85.446 63.049 1.00 34.88 C
ATOM 1881 C ARG A 244 35.035 84.187 63.763 1.00 35.73 C
ATOM 1882 O ARG A 244 33.979 83.624 63.462 1.00 36.83 O
ATOM 1883 CB ARG A 244 34.736 86.651 63.591 1.00 33.05 C
ATOM 1884 CG ARG A 244 34.750 86.740 65.088 1.00 33.31 C
ATOM 1885 CD ARG A 244 34.285 88.061 65.551 1.00 31.79 C
ATOM 1886 NE ARG A 244 34.151 88.087 66.995 1.00 33.01 N
ATOM 1887 CZ ARG A 244 33.651 89.117 67.663 1.00 34.49 C
ATOM 1888 NH1 ARG A 244 33.243 90.201 67.005 1.00 33.31 N
ATOM 1889 NH2 ARG A 244 33.556 89.059 68.982 1.00 32.54 N
ATOM 1890 N ASP A 245 35.844 83.754 64.721 1.00 36.71 N
ATOM 1891 CA ASP A 245 35.525 82.597 65.542 1.00 38.67 C
ATOM 1892 C ASP A 245 36.271 82.793 66.850 1.00 38.39 C
ATOM 1893 O ASP A 245 37.456 82.478 66.961 1.00 37.11 O
ATOM 1894 CB ASP A 245 35.969 81.299 64.884 1.00 40.53 C
ATOM 1895 CG ASP A 245 35.480 80.086 65.635 1.00 45.03 C
ATOM 1896 OD1 ASP A 245 34.671 80.271 66.577 1.00 46.21 O
ATOM 1897 OD2 ASP A 245 35.893 78.957 65.281 1.00 46.87 O
ATOM 1898 N ASP A 246 35.571 83.350 67.828 1.00 38.37 N
ATOM 1899 CA ASP A 246 36.168 83.610 69.120 1.00 38.44 C
ATOM 1900 C ASP A 246 36.548 82.319 69.848 1.00 38.24 C
ATOM 1901 O ASP A 246 37.229 82.357 70.875 1.00 38.25 O
ATOM 1902 CB ASP A 246 35.218 84.449 69.973 1.00 39.09 C
ATOM 1903 CG ASP A 246 34.929 85.816 69.361 1.00 41.15 C
ATOM 1904 OD1 ASP A 246 35.784 86.349 68.603 1.00 41.21 O
ATOM 1905 OD2 ASP A 246 33.845 86.363 69.664 1.00 40.18 O
ATOM 1906 N ALA A 247 36.125 81.179 69.306 1.00 37.13 N
ATOM 1907 CA ALA A 247 36.449 79.885 69.905 1.00 35.79 C
ATOM 1908 C ALA A 247 37.886 79.488 69.590 1.00 35.41 C
ATOM 1909 O ALA A 247 38.412 78.574 70.204 1.00 36.53 O
ATOM 1910 CB ALA A 247 35.500 78.804 69.409 1.00 33.79 C
ATOM 1911 N LEU A 248 38.509 80.148 68.618 1.00 34.79 N
ATOM 1912 CA LEU A 248 39.898 79.859 68.276 1.00 35.39 C
ATOM 1913 C LEU A 248 40.786 80.559 69.306 1.00 37.54 C
ATOM 1914 O LEU A 248 40.495 81.673 69.749 1.00 39.61 O
ATOM 1915 CB LEU A 248 40.219 80.340 66.861 1.00 33.94 C
ATOM 1916 CG LEU A 248 39.481 79.557 65.754 1.00 34.14 C
ATOM 1917 CD1 LEU A 248 39.906 80.053 64.396 1.00 31.22 C
ATOM 1918 CD2 LEU A 248 39.771 78.070 65.857 1.00 29.60 C
ATOM 1919 N PRO A 249 41.882 79.909 69.712 1.00 37.64 N
ATOM 1920 CA PRO A 249 42.806 80.462 70.706 1.00 35.78 C
ATOM 1921 C PRO A 249 43.573 81.719 70.328 1.00 35.48 C
ATOM 1922 O PRO A 249 43.710 82.614 71.145 1.00 38.73 O
ATOM 1923 CB PRO A 249 43.726 79.283 71.014 1.00 34.48 C
ATOM 1924 CG PRO A 249 43.803 78.578 69.718 1.00 37.96 C
ATOM 1925 CD PRO A 249 42.360 78.609 69.210 1.00 38.26 C
ATOM 1926 N VAL A 250 44.083 81.794 69.106 1.00 35.59 N
ATOM 1927 CA VAL A 250 44.836 82.973 68.666 1.00 33.54 C
ATOM 1928 C VAL A 250 44.220 83.510 67.385 1.00 34.63 C
ATOM 1929 O VAL A 250 43.392 82.859 66.756 1.00 34.38 O
ATOM 1930 CB VAL A 250 46.322 82.633 68.362 1.00 31.83 C
ATOM 1931 CG1 VAL A 250 47.031 82.192 69.609 1.00 29.60 C
ATOM 1932 CG2 VAL A 250 46.397 81.541 67.330 1.00 28.52 C
ATOM 1933 N ALA A 251 44.634 84.697 66.983 1.00 35.93 N
ATOM 1934 CA ALA A 251 44.099 85.280 65.760 1.00 36.79 C
ATOM 1935 C ALA A 251 45.207 85.452 64.727 1.00 37.76 C
ATOM 1936 O ALA A 251 46.354 85.776 65.070 1.00 37.09 O
ATOM 1937 CB ALA A 251 43.449 86.640 66.057 1.00 35.11 C
ATOM 1938 N HIS A 252 44.868 85.215 63.466 1.00 37.27 N
ATOM 1939 CA HIS A 252 45.826 85.398 62.395 1.00 37.73 C
ATOM 1940 C HIS A 252 45.397 86.604 61.571 1.00 36.84 C
ATOM 1941 O HIS A 252 44.227 86.773 61.255 1.00 37.71 O
ATOM 1942 CB HIS A 252 45.893 84.165 61.489 1.00 39.32 C
ATOM 1943 CG HIS A 252 46.576 82.989 62.113 1.00 40.80 C
ATOM 1944 ND1 HIS A 252 47.628 82.336 61.505 1.00 41.28 N
ATOM 1945 CD2 HIS A 252 46.337 82.327 63.271 1.00 39.74 C
ATOM 1946 CE1 HIS A 252 48.008 81.323 62.263 1.00 40.67 C
ATOM 1947 NE2 HIS A 252 47.240 81.294 63.339 1.00 40.63 N
ATOM 1948 N VAL A 253 46.356 87.443 61.225 1.00 35.77 N
ATOM 1949 CA VAL A 253 46.078 88.615 60.423 1.00 35.06 C
ATOM 1950 C VAL A 253 47.137 88.703 59.317 1.00 36.30 C
ATOM 1951 O VAL A 253 48.317 88.455 59.552 1.00 37.51 O
ATOM 1952 CB VAL A 253 46.135 89.898 61.294 1.00 33.76 C
ATOM 1953 CG1 VAL A 253 45.951 91.134 60.439 1.00 32.31 C
ATOM 1954 CG2 VAL A 253 45.069 89.847 62.361 1.00 32.87 C
ATOM 1955 N ALA A 254 46.704 89.046 58.111 1.00 36.42 N
ATOM 1956 CA ALA A 254 47.607 89.198 56.982 1.00 35.52 C
ATOM 1957 C ALA A 254 47.189 90.440 56.219 1.00 35.80 C
ATOM 1958 O ALA A 254 46.036 90.587 55.835 1.00 36.32 O
ATOM 1959 CB ALA A 254 47.524 87.983 56.071 1.00 36.81 C
ATOM 1960 N LEU A 255 48.135 91.334 55.996 1.00 36.60 N
ATOM 1961 CA LEU A 255 47.864 92.563 55.270 1.00 37.84 C
ATOM 1962 C LEU A 255 48.839 92.628 54.104 1.00 38.12 C
ATOM 1963 O LEU A 255 50.000 92.273 54.262 1.00 40.40 O
ATOM 1964 CB LEU A 255 48.100 93.762 56.190 1.00 37.32 C
ATOM 1965 CG LEU A 255 47.555 95.083 55.652 1.00 36.21 C
ATOM 1966 CD1 LEU A 255 46.018 95.089 55.782 1.00 36.42 C
ATOM 1967 CD2 LEU A 255 48.170 96.230 56.416 1.00 34.41 C
ATOM 1968 N ALA A 256 48.394 93.090 52.941 1.00 38.84 N
ATOM 1969 CA ALA A 256 49.298 93.165 51.793 1.00 38.20 C
ATOM 1970 C ALA A 256 48.878 94.119 50.692 1.00 38.29 C
ATOM 1971 O ALA A 256 47.699 94.394 50.495 1.00 40.98 O
ATOM 1972 CB ALA A 256 49.493 91.778 51.199 1.00 36.67 C
ATOM 1973 N VAL A 257 49.870 94.608 49.961 1.00 38.83 N
ATOM 1974 CA VAL A 257 49.658 95.510 48.836 1.00 38.11 C
ATOM 1975 C VAL A 257 50.039 94.722 47.583 1.00 39.07 C
ATOM 1976 O VAL A 257 50.643 93.665 47.712 1.00 37.48 O
ATOM 1977 CB VAL A 257 50.550 96.748 48.969 1.00 35.71 C
ATOM 1978 CG1 VAL A 257 50.057 97.602 50.094 1.00 32.32 C
ATOM 1979 CG2 VAL A 257 51.987 96.330 49.225 1.00 34.33 C
ATOM 1980 N GLU A 258 49.690 95.207 46.387 1.00 42.31 N
ATOM 1981 CA GLU A 258 50.043 94.474 45.161 1.00 45.70 C
ATOM 1982 C GLU A 258 51.557 94.562 44.911 1.00 47.00 C
ATOM 1983 O GLU A 258 52.173 95.618 45.106 1.00 46.88 O
ATOM 1984 CB GLU A 258 49.293 95.015 43.933 1.00 46.84 C
ATOM 1985 CG GLU A 258 49.387 94.092 42.705 1.00 52.31 C
ATOM 1986 CD GLU A 258 48.824 94.697 41.401 1.00 58.20 C
ATOM 1987 OE1 GLU A 258 47.686 95.229 41.398 1.00 60.60 O
ATOM 1988 OE2 GLU A 258 49.522 94.626 40.358 1.00 62.51 O
ATOM 1989 N GLY A 259 52.151 93.440 44.504 1.00 48.16 N
ATOM 1990 CA GLY A 259 53.579 93.396 44.228 1.00 48.05 C
ATOM 1991 C GLY A 259 53.823 93.551 42.740 1.00 48.77 C
ATOM 1992 O GLY A 259 52.886 93.435 41.956 1.00 49.68 O
ATOM 1993 N PRO A 260 55.066 93.799 42.314 1.00 49.54 N
ATOM 1994 CA PRO A 260 55.390 93.973 40.893 1.00 51.40 C
ATOM 1995 C PRO A 260 55.323 92.751 39.972 1.00 52.72 C
ATOM 1996 O PRO A 260 54.798 92.838 38.861 1.00 54.42 O
ATOM 1997 CB PRO A 260 56.791 94.582 40.935 1.00 51.12 C
ATOM 1998 CG PRO A 260 57.377 93.952 42.147 1.00 50.95 C
ATOM 1999 CD PRO A 260 56.252 94.027 43.154 1.00 49.22 C
ATOM 2000 N GLY A 261 55.832 91.610 40.412 1.00 52.65 N
ATOM 2001 CA GLY A 261 55.820 90.458 39.524 1.00 52.05 C
ATOM 2002 C GLY A 261 57.267 90.088 39.250 1.00 50.75 C
ATOM 2003 O GLY A 261 58.133 90.961 39.200 1.00 51.62 O
ATOM 2004 N TRP A 262 57.532 88.799 39.081 1.00 49.01 N
ATOM 2005 CA TRP A 262 58.890 88.291 38.860 1.00 46.62 C
ATOM 2006 C TRP A 262 59.929 89.193 38.183 1.00 47.40 C
ATOM 2007 O TRP A 262 60.860 89.699 38.839 1.00 47.52 O
ATOM 2008 CB TRP A 262 58.818 86.949 38.120 1.00 40.50 C
ATOM 2009 CG TRP A 262 58.311 85.850 39.001 1.00 34.27 C
ATOM 2010 CD1 TRP A 262 57.198 85.076 38.802 1.00 31.38 C
ATOM 2011 CD2 TRP A 262 58.873 85.433 40.252 1.00 30.70 C
ATOM 2012 NE1 TRP A 262 57.030 84.204 39.857 1.00 29.53 N
ATOM 2013 CE2 TRP A 262 58.043 84.403 40.761 1.00 29.28 C
ATOM 2014 CE3 TRP A 262 59.997 85.833 40.996 1.00 28.28 C
ATOM 2015 CZ2 TRP A 262 58.300 83.766 41.985 1.00 28.58 C
ATOM 2016 CZ3 TRP A 262 60.255 85.197 42.218 1.00 29.20 C
ATOM 2017 CH2 TRP A 262 59.407 84.173 42.698 1.00 28.54 C
ATOM 2018 N ALA A 263 59.761 89.393 36.881 1.00 46.17 N
ATOM 2019 CA ALA A 263 60.697 90.178 36.092 1.00 48.51 C
ATOM 2020 C ALA A 263 61.135 91.556 36.601 1.00 50.06 C
ATOM 2021 O ALA A 263 62.180 92.060 36.186 1.00 52.53 O
ATOM 2022 CB ALA A 263 60.170 90.304 34.663 1.00 47.83 C
ATOM 2023 N ASP A 264 60.372 92.168 37.495 1.00 50.47 N
ATOM 2024 CA ASP A 264 60.726 93.503 37.980 1.00 49.93 C
ATOM 2025 C ASP A 264 61.910 93.524 38.963 1.00 50.63 C
ATOM 2026 O ASP A 264 61.920 92.824 39.978 1.00 50.67 O
ATOM 2027 CB ASP A 264 59.494 94.158 38.629 1.00 49.83 C
ATOM 2028 CG ASP A 264 59.543 95.682 38.602 1.00 48.85 C
ATOM 2029 OD1 ASP A 264 60.590 96.268 38.970 1.00 49.64 O
ATOM 2030 OD2 ASP A 264 58.521 96.296 38.221 1.00 47.25 O
ATOM 2031 N PRO A 265 62.927 94.339 38.661 1.00 50.78 N
ATOM 2032 CA PRO A 265 64.138 94.502 39.472 1.00 50.88 C
ATOM 2033 C PRO A 265 63.867 95.035 40.879 1.00 51.47 C
ATOM 2034 O PRO A 265 64.646 94.775 41.809 1.00 51.61 O
ATOM 2035 CB PRO A 265 64.960 95.482 38.656 1.00 50.41 C
ATOM 2036 CG PRO A 265 64.569 95.137 37.254 1.00 51.36 C
ATOM 2037 CD PRO A 265 63.084 94.996 37.354 1.00 50.22 C
ATOM 2038 N ASP A 266 62.780 95.795 41.030 1.00 50.97 N
ATOM 2039 CA ASP A 266 62.422 96.361 42.334 1.00 50.43 C
ATOM 2040 C ASP A 266 62.328 95.271 43.408 1.00 49.74 C
ATOM 2041 O ASP A 266 62.534 95.530 44.600 1.00 47.53 O
ATOM 2042 CB ASP A 266 61.086 97.111 42.257 1.00 51.07 C
ATOM 2043 CG ASP A 266 61.210 98.478 41.602 1.00 52.11 C
ATOM 2044 OD1 ASP A 266 62.331 99.034 41.590 1.00 53.73 O
ATOM 2045 OD2 ASP A 266 60.181 99.006 41.121 1.00 51.10 O
ATOM 2046 N ASN A 267 62.024 94.049 42.973 1.00 49.03 N
ATOM 2047 CA ASN A 267 61.902 92.929 43.890 1.00 48.32 C
ATOM 2048 C ASN A 267 63.132 92.751 44.770 1.00 48.79 C
ATOM 2049 O ASN A 267 63.030 92.276 45.905 1.00 50.22 O
ATOM 2050 CB ASN A 267 61.624 91.646 43.120 1.00 46.51 C
ATOM 2051 CG ASN A 267 60.173 91.503 42.752 1.00 48.22 C
ATOM 2052 OD1 ASN A 267 59.315 91.563 43.626 1.00 51.30 O
ATOM 2053 ND2 ASN A 267 59.881 91.305 41.459 1.00 45.33 N
ATOM 2054 N VAL A 268 64.297 93.132 44.264 1.00 48.48 N
ATOM 2055 CA VAL A 268 65.505 92.980 45.062 1.00 48.08 C
ATOM 2056 C VAL A 268 65.405 93.945 46.224 1.00 47.02 C
ATOM 2057 O VAL A 268 65.801 93.627 47.344 1.00 46.80 O
ATOM 2058 CB VAL A 268 66.797 93.287 44.241 1.00 48.44 C
ATOM 2059 CG1 VAL A 268 68.034 93.137 45.126 1.00 44.03 C
ATOM 2060 CG2 VAL A 268 66.889 92.337 43.048 1.00 49.28 C
ATOM 2061 N VAL A 269 64.852 95.122 45.953 1.00 45.63 N
ATOM 2062 CA VAL A 269 64.715 96.128 46.992 1.00 45.52 C
ATOM 2063 C VAL A 269 63.657 95.732 48.015 1.00 44.72 C
ATOM 2064 O VAL A 269 63.871 95.879 49.218 1.00 44.30 O
ATOM 2065 CB VAL A 269 64.348 97.498 46.405 1.00 44.16 C
ATOM 2066 CG1 VAL A 269 64.461 98.562 47.482 1.00 44.27 C
ATOM 2067 CG2 VAL A 269 65.254 97.818 45.254 1.00 43.84 C
ATOM 2068 N LEU A 270 62.520 95.232 47.539 1.00 43.92 N
ATOM 2069 CA LEU A 270 61.457 94.816 48.443 1.00 43.89 C
ATOM 2070 C LEU A 270 61.972 93.749 49.405 1.00 44.85 C
ATOM 2071 O LEU A 270 61.655 93.784 50.600 1.00 44.29 O
ATOM 2072 CB LEU A 270 60.260 94.285 47.655 1.00 42.40 C
ATOM 2073 CG LEU A 270 59.578 95.315 46.754 1.00 41.65 C
ATOM 2074 CD1 LEU A 270 58.357 94.702 46.116 1.00 41.57 C
ATOM 2075 CD2 LEU A 270 59.185 96.522 47.569 1.00 42.73 C
ATOM 2076 N HIS A 271 62.770 92.812 48.883 1.00 46.19 N
ATOM 2077 CA HIS A 271 63.348 91.735 49.698 1.00 46.60 C
ATOM 2078 C HIS A 271 64.341 92.281 50.718 1.00 45.76 C
ATOM 2079 O HIS A 271 64.541 91.692 51.779 1.00 44.51 O
ATOM 2080 CB HIS A 271 64.037 90.685 48.815 1.00 48.86 C
ATOM 2081 CG HIS A 271 63.088 89.739 48.142 1.00 50.97 C
ATOM 2082 ND1 HIS A 271 62.203 88.947 48.843 1.00 51.52 N
ATOM 2083 CD2 HIS A 271 62.884 89.460 46.831 1.00 51.28 C
ATOM 2084 CE1 HIS A 271 61.494 88.224 47.993 1.00 51.77 C
ATOM 2085 NE2 HIS A 271 61.887 88.515 46.766 1.00 50.88 N
ATOM 2086 N VAL A 272 64.971 93.400 50.395 1.00 45.32 N
ATOM 2087 CA VAL A 272 65.898 94.002 51.329 1.00 47.24 C
ATOM 2088 C VAL A 272 65.046 94.623 52.413 1.00 48.58 C
ATOM 2089 O VAL A 272 65.318 94.459 53.608 1.00 49.42 O
ATOM 2090 CB VAL A 272 66.723 95.106 50.685 1.00 47.75 C
ATOM 2091 CG1 VAL A 272 67.535 95.825 51.756 1.00 47.78 C
ATOM 2092 CG2 VAL A 272 67.643 94.514 49.630 1.00 47.90 C
ATOM 2093 N ALA A 273 64.013 95.343 51.974 1.00 49.38 N
ATOM 2094 CA ALA A 273 63.052 96.002 52.867 1.00 48.80 C
ATOM 2095 C ALA A 273 62.462 94.981 53.839 1.00 48.37 C
ATOM 2096 O ALA A 273 62.484 95.179 55.060 1.00 47.43 O
ATOM 2097 CB ALA A 273 61.938 96.641 52.049 1.00 49.08 C
ATOM 2098 N ASN A 274 61.932 93.888 53.302 1.00 46.72 N
ATOM 2099 CA ASN A 274 61.384 92.872 54.178 1.00 48.69 C
ATOM 2100 C ASN A 274 62.445 92.390 55.150 1.00 48.86 C
ATOM 2101 O ASN A 274 62.133 92.008 56.272 1.00 47.99 O
ATOM 2102 CB ASN A 274 60.853 91.695 53.375 1.00 49.27 C
ATOM 2103 CG ASN A 274 59.427 91.898 52.942 1.00 50.26 C
ATOM 2104 OD1 ASN A 274 58.855 91.062 52.240 1.00 53.10 O
ATOM 2105 ND2 ASN A 274 58.834 93.010 53.365 1.00 49.86 N
ATOM 2106 N ALA A 275 63.702 92.422 54.715 1.00 50.59 N
ATOM 2107 CA ALA A 275 64.821 91.989 55.551 1.00 49.97 C
ATOM 2108 C ALA A 275 64.994 92.907 56.755 1.00 49.97 C
ATOM 2109 O ALA A 275 65.396 92.452 57.831 1.00 49.71 O
ATOM 2110 CB ALA A 275 66.094 91.953 54.741 1.00 49.31 C
ATOM 2111 N ILE A 276 64.689 94.193 56.583 1.00 48.76 N
ATOM 2112 CA ILE A 276 64.815 95.130 57.694 1.00 48.51 C
ATOM 2113 C ILE A 276 63.799 94.794 58.785 1.00 48.62 C
ATOM 2114 O ILE A 276 64.148 94.701 59.954 1.00 49.50 O
ATOM 2115 CB ILE A 276 64.599 96.580 57.245 1.00 47.49 C
ATOM 2116 CG1 ILE A 276 65.487 96.890 56.040 1.00 46.74 C
ATOM 2117 CG2 ILE A 276 64.952 97.522 58.385 1.00 45.19 C
ATOM 2118 CD1 ILE A 276 65.380 98.323 55.556 1.00 47.56 C
ATOM 2119 N ILE A 277 62.546 94.599 58.389 1.00 49.84 N
ATOM 2120 CA ILE A 277 61.464 94.255 59.315 1.00 49.32 C
ATOM 2121 C ILE A 277 61.623 92.816 59.771 1.00 48.60 C
ATOM 2122 O ILE A 277 61.270 92.449 60.891 1.00 48.82 O
ATOM 2123 CB ILE A 277 60.091 94.410 58.630 1.00 50.39 C
ATOM 2124 CG1 ILE A 277 59.767 95.904 58.470 1.00 50.82 C
ATOM 2125 CG2 ILE A 277 59.023 93.670 59.422 1.00 50.25 C
ATOM 2126 CD1 ILE A 277 58.502 96.199 57.695 1.00 52.23 C
ATOM 2127 N GLY A 278 62.144 91.994 58.875 1.00 47.24 N
ATOM 2128 CA GLY A 278 62.375 90.603 59.203 1.00 46.05 C
ATOM 2129 C GLY A 278 61.191 89.756 59.622 1.00 44.06 C
ATOM 2130 O GLY A 278 60.149 89.748 58.969 1.00 43.08 O
ATOM 2131 N ARG A 279 61.377 89.014 60.707 1.00 42.98 N
ATOM 2132 CA ARG A 279 60.351 88.125 61.221 1.00 43.43 C
ATOM 2133 C ARG A 279 60.656 87.754 62.664 1.00 43.40 C
ATOM 2134 O ARG A 279 61.681 88.150 63.216 1.00 45.89 O
ATOM 2135 CB ARG A 279 60.259 86.865 60.369 1.00 43.82 C
ATOM 2136 CG ARG A 279 61.572 86.158 60.237 1.00 47.99 C
ATOM 2137 CD ARG A 279 61.430 84.787 59.631 1.00 50.51 C
ATOM 2138 NE ARG A 279 62.620 84.018 59.963 1.00 55.61 N
ATOM 2139 CZ ARG A 279 62.692 82.693 59.967 1.00 57.85 C
ATOM 2140 NH1 ARG A 279 61.624 81.960 59.647 1.00 56.97 N
ATOM 2141 NH2 ARG A 279 63.838 82.105 60.310 1.00 59.34 N
ATOM 2142 N TYR A 280 59.778 86.974 63.276 1.00 42.11 N
ATOM 2143 CA TYR A 280 59.972 86.635 64.669 1.00 41.50 C
ATOM 2144 C TYR A 280 58.985 85.601 65.172 1.00 41.02 C
ATOM 2145 O TYR A 280 57.956 85.360 64.565 1.00 41.76 O
ATOM 2146 CB TYR A 280 59.827 87.915 65.498 1.00 40.40 C
ATOM 2147 CG TYR A 280 59.663 87.688 66.978 1.00 42.36 C
ATOM 2148 CD1 TYR A 280 60.770 87.605 67.812 1.00 42.50 C
ATOM 2149 CD2 TYR A 280 58.395 87.530 67.544 1.00 42.83 C
ATOM 2150 CE1 TYR A 280 60.625 87.374 69.171 1.00 44.41 C
ATOM 2151 CE2 TYR A 280 58.237 87.293 68.909 1.00 42.83 C
ATOM 2152 CZ TYR A 280 59.360 87.216 69.716 1.00 44.26 C
ATOM 2153 OH TYR A 280 59.240 86.960 71.066 1.00 44.81 O
ATOM 2154 N ASP A 281 59.322 84.979 66.288 1.00 41.79 N
ATOM 2155 CA ASP A 281 58.439 84.023 66.927 1.00 44.46 C
ATOM 2156 C ASP A 281 58.973 83.845 68.342 1.00 44.93 C
ATOM 2157 O ASP A 281 60.149 84.080 68.598 1.00 46.04 O
ATOM 2158 CB ASP A 281 58.354 82.710 66.131 1.00 46.42 C
ATOM 2159 CG ASP A 281 59.211 81.611 66.699 1.00 50.13 C
ATOM 2160 OD1 ASP A 281 59.072 81.304 67.901 1.00 53.48 O
ATOM 2161 OD2 ASP A 281 60.008 81.027 65.935 1.00 50.97 O
ATOM 2162 N ARG A 282 58.097 83.469 69.264 1.00 45.46 N
ATOM 2163 CA ARG A 282 58.457 83.315 70.661 1.00 46.47 C
ATOM 2164 C ARG A 282 59.603 82.392 71.054 1.00 47.55 C
ATOM 2165 O ARG A 282 59.768 82.091 72.234 1.00 49.85 O
ATOM 2166 CB ARG A 282 57.227 82.922 71.460 1.00 47.31 C
ATOM 2167 CG ARG A 282 56.281 84.067 71.740 1.00 50.22 C
ATOM 2168 CD ARG A 282 55.195 83.576 72.662 1.00 53.43 C
ATOM 2169 NE ARG A 282 54.614 82.335 72.142 1.00 56.81 N
ATOM 2170 CZ ARG A 282 53.811 81.539 72.841 1.00 56.73 C
ATOM 2171 NH1 ARG A 282 53.504 81.858 74.096 1.00 55.63 N
ATOM 2172 NH2 ARG A 282 53.309 80.438 72.282 1.00 55.43 N
ATOM 2173 N THR A 283 60.400 81.932 70.102 1.00 47.85 N
ATOM 2174 CA THR A 283 61.520 81.074 70.465 1.00 46.23 C
ATOM 2175 C THR A 283 62.840 81.619 69.916 1.00 46.47 C
ATOM 2176 O THR A 283 63.838 80.895 69.826 1.00 48.11 O
ATOM 2177 CB THR A 283 61.303 79.626 69.995 1.00 43.55 C
ATOM 2178 OG1 THR A 283 61.331 79.573 68.568 1.00 45.78 O
ATOM 2179 CG2 THR A 283 59.973 79.113 70.481 1.00 42.08 C
ATOM 2180 N PHE A 284 62.833 82.896 69.538 1.00 44.70 N
ATOM 2181 CA PHE A 284 64.040 83.565 69.050 1.00 43.53 C
ATOM 2182 C PHE A 284 64.835 83.988 70.285 1.00 45.49 C
ATOM 2183 O PHE A 284 64.570 85.046 70.860 1.00 47.08 O
ATOM 2184 CB PHE A 284 63.674 84.815 68.245 1.00 37.75 C
ATOM 2185 CG PHE A 284 63.220 84.523 66.854 1.00 33.03 C
ATOM 2186 CD1 PHE A 284 62.455 83.394 66.580 1.00 28.71 C
ATOM 2187 CD2 PHE A 284 63.570 85.369 65.809 1.00 30.62 C
ATOM 2188 CE1 PHE A 284 62.054 83.115 65.283 1.00 27.70 C
ATOM 2189 CE2 PHE A 284 63.170 85.094 64.500 1.00 30.04 C
ATOM 2190 CZ PHE A 284 62.411 83.963 64.238 1.00 28.64 C
ATOM 2191 N GLY A 285 65.796 83.171 70.706 1.00 45.44 N
ATOM 2192 CA GLY A 285 66.572 83.522 71.882 1.00 45.93 C
ATOM 2193 C GLY A 285 66.975 84.988 71.927 1.00 45.85 C
ATOM 2194 O GLY A 285 67.006 85.605 72.995 1.00 45.76 O
ATOM 2195 N GLY A 286 67.291 85.545 70.764 1.00 45.98 N
ATOM 2196 CA GLY A 286 67.696 86.936 70.689 1.00 48.89 C
ATOM 2197 C GLY A 286 66.899 87.841 71.604 1.00 50.74 C
ATOM 2198 O GLY A 286 67.458 88.749 72.228 1.00 52.79 O
ATOM 2199 N GLY A 287 65.590 87.599 71.664 1.00 51.38 N
ATOM 2200 CA GLY A 287 64.699 88.371 72.516 1.00 49.19 C
ATOM 2201 C GLY A 287 64.620 89.859 72.250 1.00 48.83 C
ATOM 2202 O GLY A 287 64.578 90.311 71.106 1.00 48.14 O
ATOM 2203 N LYS A 288 64.615 90.620 73.335 1.00 49.31 N
ATOM 2204 CA LYS A 288 64.515 92.066 73.267 1.00 50.51 C
ATOM 2205 C LYS A 288 65.699 92.779 72.636 1.00 50.04 C
ATOM 2206 O LYS A 288 65.743 94.011 72.619 1.00 50.22 O
ATOM 2207 CB LYS A 288 64.274 92.633 74.664 1.00 52.96 C
ATOM 2208 CG LYS A 288 65.313 92.223 75.707 1.00 55.97 C
ATOM 2209 CD LYS A 288 64.986 92.829 77.077 1.00 58.29 C
ATOM 2210 CE LYS A 288 65.850 92.245 78.200 1.00 59.92 C
ATOM 2211 NZ LYS A 288 67.300 92.578 78.062 1.00 61.05 N
ATOM 2212 N HIS A 289 66.658 92.037 72.104 1.00 49.37 N
ATOM 2213 CA HIS A 289 67.800 92.709 71.499 1.00 49.29 C
ATOM 2214 C HIS A 289 67.865 92.566 69.999 1.00 49.38 C
ATOM 2215 O HIS A 289 68.781 93.081 69.357 1.00 48.83 O
ATOM 2216 CB HIS A 289 69.087 92.222 72.141 1.00 47.74 C
ATOM 2217 CG HIS A 289 69.205 92.603 73.581 1.00 44.99 C
ATOM 2218 ND1 HIS A 289 69.127 91.680 74.603 1.00 44.41 N
ATOM 2219 CD2 HIS A 289 69.353 93.812 74.172 1.00 42.82 C
ATOM 2220 CE1 HIS A 289 69.223 92.305 75.764 1.00 44.15 C
ATOM 2221 NE2 HIS A 289 69.361 93.599 75.530 1.00 45.29 N
ATOM 2222 N LEU A 290 66.872 91.873 69.453 1.00 49.23 N
ATOM 2223 CA LEU A 290 66.775 91.653 68.031 1.00 49.27 C
ATOM 2224 C LEU A 290 66.868 92.974 67.287 1.00 50.91 C
ATOM 2225 O LEU A 290 66.361 93.992 67.749 1.00 49.70 O
ATOM 2226 CB LEU A 290 65.464 90.954 67.730 1.00 48.16 C
ATOM 2227 CG LEU A 290 65.417 89.532 68.282 1.00 49.07 C
ATOM 2228 CD1 LEU A 290 64.001 88.992 68.185 1.00 50.88 C
ATOM 2229 CD2 LEU A 290 66.386 88.646 67.502 1.00 48.39 C
ATOM 2230 N SER A 291 67.533 92.949 66.134 1.00 54.93 N
ATOM 2231 CA SER A 291 67.728 94.146 65.312 1.00 57.49 C
ATOM 2232 C SER A 291 66.418 94.664 64.728 1.00 58.36 C
ATOM 2233 O SER A 291 66.221 95.879 64.631 1.00 59.09 O
ATOM 2234 CB SER A 291 68.730 93.875 64.172 1.00 57.38 C
ATOM 2235 OG SER A 291 70.010 93.504 64.666 1.00 58.19 O
ATOM 2236 N SER A 292 65.524 93.752 64.341 1.00 58.38 N
ATOM 2237 CA SER A 292 64.236 94.168 63.784 1.00 57.63 C
ATOM 2238 C SER A 292 63.439 94.911 64.846 1.00 56.04 C
ATOM 2239 O SER A 292 63.031 94.332 65.860 1.00 55.21 O
ATOM 2240 CB SER A 292 63.420 92.971 63.299 1.00 58.67 C
ATOM 2241 OG SER A 292 62.136 93.403 62.882 1.00 60.86 O
ATOM 2242 N ARG A 293 63.219 96.198 64.612 1.00 54.07 N
ATOM 2243 CA ARG A 293 62.482 97.005 65.567 1.00 52.74 C
ATOM 2244 C ARG A 293 61.149 96.356 65.957 1.00 51.51 C
ATOM 2245 O ARG A 293 60.859 96.195 67.151 1.00 50.96 O
ATOM 2246 CB ARG A 293 62.276 98.405 64.996 1.00 52.39 C
ATOM 2247 CG ARG A 293 63.590 99.160 64.804 1.00 54.90 C
ATOM 2248 CD ARG A 293 63.377 100.550 64.257 1.00 55.06 C
ATOM 2249 NE ARG A 293 62.161 101.093 64.826 1.00 60.05 N
ATOM 2250 CZ ARG A 293 62.000 102.351 65.210 1.00 63.46 C
ATOM 2251 NH1 ARG A 293 63.003 103.226 65.085 1.00 63.32 N
ATOM 2252 NH2 ARG A 293 60.826 102.727 65.723 1.00 63.40 N
ATOM 2253 N LEU A 294 60.359 95.957 64.958 1.00 48.20 N
ATOM 2254 CA LEU A 294 59.074 95.336 65.220 1.00 44.58 C
ATOM 2255 C LEU A 294 59.259 94.138 66.119 1.00 45.65 C
ATOM 2256 O LEU A 294 58.483 93.926 67.050 1.00 47.49 O
ATOM 2257 CB LEU A 294 58.401 94.898 63.920 1.00 43.14 C
ATOM 2258 CG LEU A 294 57.057 94.163 64.074 1.00 39.26 C
ATOM 2259 CD1 LEU A 294 56.064 95.050 64.810 1.00 37.29 C
ATOM 2260 CD2 LEU A 294 56.529 93.753 62.707 1.00 34.90 C
ATOM 2261 N ALA A 295 60.283 93.339 65.836 1.00 45.71 N
ATOM 2262 CA ALA A 295 60.551 92.163 66.651 1.00 43.85 C
ATOM 2263 C ALA A 295 60.845 92.610 68.078 1.00 43.22 C
ATOM 2264 O ALA A 295 60.358 92.012 69.029 1.00 43.33 O
ATOM 2265 CB ALA A 295 61.709 91.400 66.091 1.00 41.89 C
ATOM 2266 N ALA A 296 61.622 93.678 68.228 1.00 43.58 N
ATOM 2267 CA ALA A 296 61.952 94.181 69.558 1.00 44.82 C
ATOM 2268 C ALA A 296 60.685 94.569 70.344 1.00 46.50 C
ATOM 2269 O ALA A 296 60.506 94.159 71.504 1.00 47.28 O
ATOM 2270 CB ALA A 296 62.868 95.358 69.435 1.00 44.96 C
ATOM 2271 N LEU A 297 59.814 95.354 69.704 1.00 45.91 N
ATOM 2272 CA LEU A 297 58.547 95.794 70.297 1.00 44.03 C
ATOM 2273 C LEU A 297 57.648 94.597 70.632 1.00 44.35 C
ATOM 2274 O LEU A 297 56.960 94.574 71.660 1.00 43.50 O
ATOM 2275 CB LEU A 297 57.807 96.701 69.319 1.00 42.22 C
ATOM 2276 CG LEU A 297 58.434 98.062 69.063 1.00 40.74 C
ATOM 2277 CD1 LEU A 297 57.742 98.769 67.911 1.00 39.03 C
ATOM 2278 CD2 LEU A 297 58.348 98.864 70.337 1.00 39.65 C
ATOM 2279 N ALA A 298 57.638 93.612 69.744 1.00 43.74 N
ATOM 2280 CA ALA A 298 56.838 92.431 69.971 1.00 44.63 C
ATOM 2281 C ALA A 298 57.264 91.817 71.303 1.00 45.67 C
ATOM 2282 O ALA A 298 56.434 91.451 72.134 1.00 45.54 O
ATOM 2283 CB ALA A 298 57.045 91.448 68.847 1.00 44.59 C
ATOM 2284 N VAL A 299 58.569 91.734 71.519 1.00 46.62 N
ATOM 2285 CA VAL A 299 59.077 91.154 72.753 1.00 47.80 C
ATOM 2286 C VAL A 299 58.754 92.014 73.973 1.00 48.96 C
ATOM 2287 O VAL A 299 58.260 91.511 74.991 1.00 47.59 O
ATOM 2288 CB VAL A 299 60.606 90.935 72.667 1.00 46.73 C
ATOM 2289 CG1 VAL A 299 61.136 90.410 73.993 1.00 43.02 C
ATOM 2290 CG2 VAL A 299 60.914 89.950 71.550 1.00 44.04 C
ATOM 2291 N GLU A 300 59.020 93.312 73.862 1.00 50.64 N
ATOM 2292 CA GLU A 300 58.777 94.229 74.969 1.00 54.47 C
ATOM 2293 C GLU A 300 57.315 94.318 75.361 1.00 54.31 C
ATOM 2294 O GLU A 300 56.981 94.331 76.543 1.00 54.13 O
ATOM 2295 CB GLU A 300 59.299 95.631 74.627 1.00 58.28 C
ATOM 2296 CG GLU A 300 60.798 95.665 74.339 1.00 68.03 C
ATOM 2297 CD GLU A 300 61.658 95.320 75.569 1.00 73.68 C
ATOM 2298 OE1 GLU A 300 61.362 94.302 76.243 1.00 76.06 O
ATOM 2299 OE2 GLU A 300 62.635 96.062 75.861 1.00 76.22 O
ATOM 2300 N HIS A 301 56.440 94.360 74.367 1.00 54.16 N
ATOM 2301 CA HIS A 301 55.026 94.493 74.648 1.00 53.65 C
ATOM 2302 C HIS A 301 54.233 93.218 74.481 1.00 53.78 C
ATOM 2303 O HIS A 301 53.013 93.221 74.653 1.00 54.37 O
ATOM 2304 CB HIS A 301 54.443 95.590 73.771 1.00 54.43 C
ATOM 2305 CG HIS A 301 55.146 96.902 73.921 1.00 54.78 C
ATOM 2306 ND1 HIS A 301 55.153 97.609 75.104 1.00 53.45 N
ATOM 2307 CD2 HIS A 301 55.897 97.617 73.049 1.00 54.86 C
ATOM 2308 CE1 HIS A 301 55.878 98.703 74.953 1.00 54.28 C
ATOM 2309 NE2 HIS A 301 56.342 98.732 73.716 1.00 54.41 N
ATOM 2310 N LYS A 302 54.919 92.130 74.144 1.00 52.82 N
ATOM 2311 CA LYS A 302 54.255 90.845 73.973 1.00 50.85 C
ATOM 2312 C LYS A 302 53.103 91.007 72.984 1.00 50.03 C
ATOM 2313 O LYS A 302 51.968 90.597 73.231 1.00 49.66 O
ATOM 2314 CB LYS A 302 53.776 90.355 75.339 1.00 49.90 C
ATOM 2315 CG LYS A 302 54.921 90.316 76.319 1.00 52.35 C
ATOM 2316 CD LYS A 302 54.575 89.736 77.665 1.00 55.38 C
ATOM 2317 CE LYS A 302 55.841 89.672 78.533 1.00 57.57 C
ATOM 2318 NZ LYS A 302 55.611 89.078 79.883 1.00 60.39 N
ATOM 2319 N LEU A 303 53.433 91.613 71.849 1.00 48.90 N
ATOM 2320 CA LEU A 303 52.475 91.885 70.794 1.00 48.77 C
ATOM 2321 C LEU A 303 51.988 90.680 70.015 1.00 50.10 C
ATOM 2322 O LEU A 303 50.858 90.695 69.527 1.00 52.13 O
ATOM 2323 CB LEU A 303 53.053 92.901 69.814 1.00 45.65 C
ATOM 2324 CG LEU A 303 53.381 94.243 70.467 1.00 44.28 C
ATOM 2325 CD1 LEU A 303 53.985 95.171 69.427 1.00 43.46 C
ATOM 2326 CD2 LEU A 303 52.123 94.854 71.080 1.00 40.13 C
ATOM 2327 N CYS A 304 52.813 89.641 69.887 1.00 49.29 N
ATOM 2328 CA CYS A 304 52.388 88.463 69.128 1.00 48.38 C
ATOM 2329 C CYS A 304 53.166 87.215 69.461 1.00 48.28 C
ATOM 2330 O CYS A 304 54.149 87.258 70.191 1.00 49.91 O
ATOM 2331 CB CYS A 304 52.542 88.713 67.637 1.00 47.61 C
ATOM 2332 SG CYS A 304 54.253 89.044 67.186 1.00 46.14 S
ATOM 2333 N HIS A 305 52.705 86.103 68.903 1.00 47.39 N
ATOM 2334 CA HIS A 305 53.327 84.798 69.082 1.00 45.91 C
ATOM 2335 C HIS A 305 54.376 84.666 67.985 1.00 44.92 C
ATOM 2336 O HIS A 305 55.372 83.962 68.133 1.00 44.50 O
ATOM 2337 CB HIS A 305 52.278 83.690 68.917 1.00 45.30 C
ATOM 2338 CG HIS A 305 51.303 83.609 70.044 1.00 45.27 C
ATOM 2339 ND1 HIS A 305 51.506 82.811 71.145 1.00 47.13 N
ATOM 2340 CD2 HIS A 305 50.139 84.260 70.266 1.00 46.91 C
ATOM 2341 CE1 HIS A 305 50.513 82.971 71.999 1.00 45.51 C
ATOM 2342 NE2 HIS A 305 49.669 83.846 71.489 1.00 45.99 N
ATOM 2343 N SER A 306 54.129 85.361 66.879 1.00 43.79 N
ATOM 2344 CA SER A 306 55.015 85.334 65.728 1.00 42.23 C
ATOM 2345 C SER A 306 54.525 86.309 64.685 1.00 42.21 C
ATOM 2346 O SER A 306 53.379 86.740 64.716 1.00 43.33 O
ATOM 2347 CB SER A 306 55.028 83.946 65.104 1.00 40.88 C
ATOM 2348 OG SER A 306 53.738 83.599 64.624 1.00 40.10 O
ATOM 2349 N PHE A 307 55.410 86.671 63.772 1.00 42.56 N
ATOM 2350 CA PHE A 307 55.050 87.548 62.683 1.00 43.88 C
ATOM 2351 C PHE A 307 56.060 87.297 61.584 1.00 44.80 C
ATOM 2352 O PHE A 307 57.144 86.797 61.842 1.00 45.27 O
ATOM 2353 CB PHE A 307 55.042 89.005 63.126 1.00 44.65 C
ATOM 2354 CG PHE A 307 56.373 89.681 63.049 1.00 45.01 C
ATOM 2355 CD1 PHE A 307 56.948 89.979 61.814 1.00 43.71 C
ATOM 2356 CD2 PHE A 307 57.013 90.097 64.210 1.00 44.13 C
ATOM 2357 CE1 PHE A 307 58.130 90.686 61.741 1.00 43.70 C
ATOM 2358 CE2 PHE A 307 58.197 90.805 64.144 1.00 44.01 C
ATOM 2359 CZ PHE A 307 58.757 91.101 62.906 1.00 44.00 C
ATOM 2360 N GLN A 308 55.711 87.644 60.356 1.00 46.05 N
ATOM 2361 CA GLN A 308 56.602 87.390 59.243 1.00 47.29 C
ATOM 2362 C GLN A 308 56.252 88.270 58.078 1.00 47.08 C
ATOM 2363 O GLN A 308 55.083 88.540 57.840 1.00 46.73 O
ATOM 2364 CB GLN A 308 56.467 85.938 58.793 1.00 47.51 C
ATOM 2365 CG GLN A 308 55.030 85.555 58.481 1.00 48.47 C
ATOM 2366 CD GLN A 308 54.917 84.272 57.682 1.00 50.49 C
ATOM 2367 OE1 GLN A 308 53.829 83.703 57.545 1.00 49.67 O
ATOM 2368 NE2 GLN A 308 56.040 83.813 57.134 1.00 52.58 N
ATOM 2369 N THR A 309 57.268 88.713 57.348 1.00 46.99 N
ATOM 2370 CA THR A 309 57.025 89.539 56.182 1.00 46.89 C
ATOM 2371 C THR A 309 57.121 88.619 54.982 1.00 46.03 C
ATOM 2372 O THR A 309 57.608 87.494 55.096 1.00 46.15 O
ATOM 2373 CB THR A 309 58.074 90.624 56.017 1.00 46.42 C
ATOM 2374 OG1 THR A 309 59.349 90.007 55.841 1.00 47.50 O
ATOM 2375 CG2 THR A 309 58.102 91.527 57.224 1.00 46.14 C
ATOM 2376 N PHE A 310 56.642 89.084 53.839 1.00 44.31 N
ATOM 2377 CA PHE A 310 56.719 88.277 52.641 1.00 45.49 C
ATOM 2378 C PHE A 310 56.589 89.128 51.392 1.00 45.56 C
ATOM 2379 O PHE A 310 56.044 90.231 51.435 1.00 46.41 O
ATOM 2380 CB PHE A 310 55.645 87.174 52.642 1.00 44.41 C
ATOM 2381 CG PHE A 310 54.241 87.684 52.787 1.00 45.94 C
ATOM 2382 CD1 PHE A 310 53.640 87.752 54.040 1.00 45.39 C
ATOM 2383 CD2 PHE A 310 53.535 88.144 51.673 1.00 45.65 C
ATOM 2384 CE1 PHE A 310 52.363 88.276 54.185 1.00 46.85 C
ATOM 2385 CE2 PHE A 310 52.259 88.670 51.804 1.00 44.85 C
ATOM 2386 CZ PHE A 310 51.670 88.739 53.064 1.00 46.66 C
ATOM 2387 N ASN A 311 57.134 88.618 50.290 1.00 45.76 N
ATOM 2388 CA ASN A 311 57.060 89.283 48.995 1.00 45.11 C
ATOM 2389 C ASN A 311 56.830 88.211 47.945 1.00 44.17 C
ATOM 2390 O ASN A 311 57.708 87.888 47.154 1.00 44.39 O
ATOM 2391 CB ASN A 311 58.335 90.052 48.679 1.00 46.23 C
ATOM 2392 CG ASN A 311 58.324 90.631 47.269 1.00 50.30 C
ATOM 2393 OD1 ASN A 311 57.270 91.030 46.753 1.00 48.90 O
ATOM 2394 ND2 ASN A 311 59.502 90.692 46.639 1.00 53.17 N
ATOM 2395 N THR A 312 55.631 87.651 47.964 1.00 42.88 N
ATOM 2396 CA THR A 312 55.249 86.612 47.035 1.00 42.62 C
ATOM 2397 C THR A 312 55.094 87.154 45.616 1.00 44.23 C
ATOM 2398 O THR A 312 54.318 88.082 45.372 1.00 45.40 O
ATOM 2399 CB THR A 312 53.935 85.960 47.494 1.00 41.31 C
ATOM 2400 OG1 THR A 312 54.186 85.201 48.682 1.00 39.90 O
ATOM 2401 CG2 THR A 312 53.352 85.057 46.411 1.00 38.96 C
ATOM 2402 N SER A 313 55.841 86.569 44.682 1.00 44.73 N
ATOM 2403 CA SER A 313 55.786 86.992 43.285 1.00 44.75 C
ATOM 2404 C SER A 313 55.007 86.056 42.376 1.00 42.93 C
ATOM 2405 O SER A 313 54.679 84.938 42.736 1.00 43.41 O
ATOM 2406 CB SER A 313 57.196 87.158 42.725 1.00 44.68 C
ATOM 2407 OG SER A 313 57.953 88.055 43.524 1.00 47.87 O
ATOM 2408 N TYR A 314 54.708 86.550 41.189 1.00 42.54 N
ATOM 2409 CA TYR A 314 53.989 85.797 40.170 1.00 42.36 C
ATOM 2410 C TYR A 314 54.407 86.424 38.843 1.00 41.81 C
ATOM 2411 O TYR A 314 55.186 87.382 38.815 1.00 41.10 O
ATOM 2412 CB TYR A 314 52.469 85.920 40.332 1.00 42.72 C
ATOM 2413 CG TYR A 314 51.880 85.176 41.509 1.00 44.46 C
ATOM 2414 CD1 TYR A 314 51.113 85.847 42.472 1.00 45.80 C
ATOM 2415 CD2 TYR A 314 52.071 83.806 41.663 1.00 42.67 C
ATOM 2416 CE1 TYR A 314 50.556 85.169 43.563 1.00 44.17 C
ATOM 2417 CE2 TYR A 314 51.517 83.120 42.748 1.00 43.86 C
ATOM 2418 CZ TYR A 314 50.761 83.809 43.697 1.00 44.91 C
ATOM 2419 OH TYR A 314 50.217 83.149 44.783 1.00 46.01 O
ATOM 2420 N SER A 315 53.890 85.896 37.746 1.00 40.67 N
ATOM 2421 CA SER A 315 54.256 86.428 36.447 1.00 41.06 C
ATOM 2422 C SER A 315 54.071 87.923 36.298 1.00 42.77 C
ATOM 2423 O SER A 315 55.024 88.635 36.007 1.00 44.62 O
ATOM 2424 CB SER A 315 53.477 85.722 35.347 1.00 38.86 C
ATOM 2425 OG SER A 315 52.106 85.643 35.661 1.00 37.46 O
ATOM 2426 N ASP A 316 52.848 88.390 36.544 1.00 45.07 N
ATOM 2427 CA ASP A 316 52.462 89.794 36.373 1.00 44.73 C
ATOM 2428 C ASP A 316 52.024 90.545 37.620 1.00 45.56 C
ATOM 2429 O ASP A 316 51.599 91.693 37.529 1.00 44.59 O
ATOM 2430 CB ASP A 316 51.320 89.850 35.374 1.00 43.67 C
ATOM 2431 CG ASP A 316 50.206 88.879 35.729 1.00 45.70 C
ATOM 2432 OD1 ASP A 316 50.401 88.057 36.654 1.00 44.55 O
ATOM 2433 OD2 ASP A 316 49.135 88.921 35.083 1.00 49.49 O
ATOM 2434 N THR A 317 52.119 89.915 38.781 1.00 46.75 N
ATOM 2435 CA THR A 317 51.686 90.575 40.010 1.00 47.25 C
ATOM 2436 C THR A 317 52.284 89.892 41.232 1.00 46.49 C
ATOM 2437 O THR A 317 53.126 89.015 41.106 1.00 48.03 O
ATOM 2438 CB THR A 317 50.123 90.571 40.103 1.00 48.36 C
ATOM 2439 OG1 THR A 317 49.709 91.186 41.325 1.00 50.21 O
ATOM 2440 CG2 THR A 317 49.566 89.156 40.036 1.00 47.67 C
ATOM 2441 N GLY A 318 51.857 90.295 42.419 1.00 45.00 N
ATOM 2442 CA GLY A 318 52.387 89.677 43.616 1.00 42.24 C
ATOM 2443 C GLY A 318 51.788 90.275 44.868 1.00 41.31 C
ATOM 2444 O GLY A 318 51.045 91.259 44.812 1.00 40.23 O
ATOM 2445 N LEU A 319 52.108 89.670 46.004 1.00 39.29 N
ATOM 2446 CA LEU A 319 51.611 90.139 47.278 1.00 37.11 C
ATOM 2447 C LEU A 319 52.753 90.468 48.217 1.00 37.31 C
ATOM 2448 O LEU A 319 53.513 89.603 48.618 1.00 37.93 O
ATOM 2449 CB LEU A 319 50.696 89.087 47.908 1.00 34.54 C
ATOM 2450 CG LEU A 319 49.361 88.894 47.186 1.00 34.11 C
ATOM 2451 CD1 LEU A 319 48.499 87.930 47.970 1.00 34.34 C
ATOM 2452 CD2 LEU A 319 48.635 90.230 47.055 1.00 33.47 C
ATOM 2453 N PHE A 320 52.878 91.739 48.552 1.00 38.85 N
ATOM 2454 CA PHE A 320 53.914 92.196 49.466 1.00 40.85 C
ATOM 2455 C PHE A 320 53.215 92.537 50.785 1.00 41.10 C
ATOM 2456 O PHE A 320 52.381 93.436 50.827 1.00 42.53 O
ATOM 2457 CB PHE A 320 54.589 93.452 48.894 1.00 42.13 C
ATOM 2458 CG PHE A 320 55.638 94.047 49.792 1.00 43.20 C
ATOM 2459 CD1 PHE A 320 56.913 93.516 49.838 1.00 43.04 C
ATOM 2460 CD2 PHE A 320 55.337 95.128 50.614 1.00 44.75 C
ATOM 2461 CE1 PHE A 320 57.875 94.050 50.690 1.00 45.06 C
ATOM 2462 CE2 PHE A 320 56.296 95.668 51.473 1.00 45.03 C
ATOM 2463 CZ PHE A 320 57.564 95.130 51.513 1.00 44.68 C
ATOM 2464 N GLY A 321 53.539 91.832 51.859 1.00 40.38 N
ATOM 2465 CA GLY A 321 52.884 92.138 53.113 1.00 40.91 C
ATOM 2466 C GLY A 321 53.489 91.472 54.325 1.00 40.97 C
ATOM 2467 O GLY A 321 54.685 91.196 54.356 1.00 41.64 O
ATOM 2468 N PHE A 322 52.658 91.242 55.337 1.00 40.38 N
ATOM 2469 CA PHE A 322 53.102 90.594 56.559 1.00 40.00 C
ATOM 2470 C PHE A 322 51.950 89.812 57.176 1.00 39.36 C
ATOM 2471 O PHE A 322 50.797 90.010 56.819 1.00 40.35 O
ATOM 2472 CB PHE A 322 53.667 91.618 57.553 1.00 39.14 C
ATOM 2473 CG PHE A 322 52.688 92.678 57.968 1.00 39.87 C
ATOM 2474 CD1 PHE A 322 51.649 92.387 58.847 1.00 38.71 C
ATOM 2475 CD2 PHE A 322 52.811 93.981 57.482 1.00 40.74 C
ATOM 2476 CE1 PHE A 322 50.746 93.372 59.242 1.00 38.08 C
ATOM 2477 CE2 PHE A 322 51.909 94.985 57.870 1.00 40.17 C
ATOM 2478 CZ PHE A 322 50.877 94.679 58.752 1.00 39.63 C
ATOM 2479 N HIS A 323 52.278 88.910 58.088 1.00 38.32 N
ATOM 2480 CA HIS A 323 51.290 88.079 58.747 1.00 37.37 C
ATOM 2481 C HIS A 323 51.728 87.884 60.178 1.00 36.75 C
ATOM 2482 O HIS A 323 52.905 87.717 60.438 1.00 37.23 O
ATOM 2483 CB HIS A 323 51.183 86.726 58.023 1.00 37.44 C
ATOM 2484 CG HIS A 323 50.617 85.615 58.861 1.00 40.10 C
ATOM 2485 ND1 HIS A 323 51.407 84.655 59.462 1.00 41.86 N
ATOM 2486 CD2 HIS A 323 49.339 85.292 59.175 1.00 41.62 C
ATOM 2487 CE1 HIS A 323 50.641 83.789 60.103 1.00 39.28 C
ATOM 2488 NE2 HIS A 323 49.382 84.152 59.946 1.00 40.01 N
ATOM 2489 N PHE A 324 50.788 87.937 61.111 1.00 36.49 N
ATOM 2490 CA PHE A 324 51.130 87.721 62.504 1.00 36.30 C
ATOM 2491 C PHE A 324 50.053 86.918 63.203 1.00 37.27 C
ATOM 2492 O PHE A 324 48.932 86.787 62.693 1.00 38.88 O
ATOM 2493 CB PHE A 324 51.392 89.046 63.232 1.00 34.86 C
ATOM 2494 CG PHE A 324 50.211 89.985 63.279 1.00 36.49 C
ATOM 2495 CD1 PHE A 324 49.155 89.772 64.158 1.00 35.08 C
ATOM 2496 CD2 PHE A 324 50.200 91.143 62.503 1.00 37.71 C
ATOM 2497 CE1 PHE A 324 48.121 90.702 64.266 1.00 33.77 C
ATOM 2498 CE2 PHE A 324 49.168 92.077 62.609 1.00 36.13 C
ATOM 2499 CZ PHE A 324 48.133 91.854 63.492 1.00 34.20 C
ATOM 2500 N VAL A 325 50.424 86.345 64.346 1.00 35.68 N
ATOM 2501 CA VAL A 325 49.527 85.545 65.155 1.00 35.59 C
ATOM 2502 C VAL A 325 49.570 86.189 66.528 1.00 37.53 C
ATOM 2503 O VAL A 325 50.633 86.366 67.103 1.00 39.12 O
ATOM 2504 CB VAL A 325 50.016 84.095 65.244 1.00 34.73 C
ATOM 2505 CG1 VAL A 325 49.024 83.249 66.026 1.00 32.71 C
ATOM 2506 CG2 VAL A 325 50.205 83.536 63.850 1.00 33.15 C
ATOM 2507 N ALA A 326 48.416 86.547 67.065 1.00 38.48 N
ATOM 2508 CA ALA A 326 48.405 87.195 68.355 1.00 38.20 C
ATOM 2509 C ALA A 326 47.203 86.791 69.166 1.00 38.84 C
ATOM 2510 O ALA A 326 46.280 86.186 68.635 1.00 38.63 O
ATOM 2511 CB ALA A 326 48.411 88.694 68.156 1.00 37.96 C
ATOM 2512 N ASP A 327 47.239 87.115 70.458 1.00 41.26 N
ATOM 2513 CA ASP A 327 46.140 86.837 71.369 1.00 42.53 C
ATOM 2514 C ASP A 327 45.072 87.849 71.009 1.00 41.84 C
ATOM 2515 O ASP A 327 45.373 88.965 70.565 1.00 41.20 O
ATOM 2516 CB ASP A 327 46.561 87.068 72.807 1.00 47.62 C
ATOM 2517 CG ASP A 327 47.772 86.271 73.177 1.00 55.06 C
ATOM 2518 OD1 ASP A 327 47.658 85.027 73.255 1.00 58.98 O
ATOM 2519 OD2 ASP A 327 48.847 86.886 73.374 1.00 60.00 O
ATOM 2520 N PRO A 328 43.803 87.490 71.221 1.00 40.19 N
ATOM 2521 CA PRO A 328 42.740 88.430 70.883 1.00 39.21 C
ATOM 2522 C PRO A 328 42.944 89.832 71.412 1.00 39.73 C
ATOM 2523 O PRO A 328 42.547 90.794 70.762 1.00 43.29 O
ATOM 2524 CB PRO A 328 41.487 87.753 71.429 1.00 37.50 C
ATOM 2525 CG PRO A 328 42.005 86.805 72.446 1.00 38.54 C
ATOM 2526 CD PRO A 328 43.263 86.285 71.864 1.00 37.78 C
ATOM 2527 N LEU A 329 43.596 89.966 72.562 1.00 38.74 N
ATOM 2528 CA LEU A 329 43.786 91.295 73.146 1.00 36.72 C
ATOM 2529 C LEU A 329 45.020 92.078 72.792 1.00 35.23 C
ATOM 2530 O LEU A 329 45.246 93.134 73.366 1.00 33.57 O
ATOM 2531 CB LEU A 329 43.670 91.235 74.670 1.00 34.35 C
ATOM 2532 CG LEU A 329 42.258 90.873 75.111 1.00 33.58 C
ATOM 2533 CD1 LEU A 329 42.175 90.822 76.599 1.00 30.92 C
ATOM 2534 CD2 LEU A 329 41.288 91.891 74.542 1.00 33.43 C
ATOM 2535 N SER A 330 45.823 91.597 71.855 1.00 35.95 N
ATOM 2536 CA SER A 330 47.003 92.374 71.493 1.00 38.57 C
ATOM 2537 C SER A 330 47.092 92.641 69.994 1.00 38.63 C
ATOM 2538 O SER A 330 48.091 93.167 69.499 1.00 38.92 O
ATOM 2539 CB SER A 330 48.278 91.689 71.989 1.00 38.60 C
ATOM 2540 OG SER A 330 48.481 90.444 71.352 1.00 44.13 O
ATOM 2541 N ILE A 331 46.030 92.301 69.281 1.00 38.73 N
ATOM 2542 CA ILE A 331 45.998 92.492 67.846 1.00 40.92 C
ATOM 2543 C ILE A 331 46.176 93.950 67.434 1.00 43.65 C
ATOM 2544 O ILE A 331 46.965 94.262 66.538 1.00 43.61 O
ATOM 2545 CB ILE A 331 44.674 92.050 67.263 1.00 40.10 C
ATOM 2546 CG1 ILE A 331 44.426 90.589 67.567 1.00 40.21 C
ATOM 2547 CG2 ILE A 331 44.671 92.297 65.769 1.00 42.22 C
ATOM 2548 CD1 ILE A 331 43.034 90.145 67.138 1.00 44.46 C
ATOM 2549 N ASP A 332 45.417 94.835 68.076 1.00 45.13 N
ATOM 2550 CA ASP A 332 45.460 96.246 67.737 1.00 45.93 C
ATOM 2551 C ASP A 332 46.842 96.881 67.861 1.00 45.92 C
ATOM 2552 O ASP A 332 47.269 97.612 66.968 1.00 44.52 O
ATOM 2553 CB ASP A 332 44.456 97.028 68.581 1.00 47.92 C
ATOM 2554 CG ASP A 332 44.162 98.399 67.992 1.00 52.39 C
ATOM 2555 OD1 ASP A 332 43.649 98.442 66.839 1.00 55.34 O
ATOM 2556 OD2 ASP A 332 44.449 99.421 68.665 1.00 51.99 O
ATOM 2557 N ASP A 333 47.544 96.617 68.963 1.00 46.59 N
ATOM 2558 CA ASP A 333 48.886 97.182 69.136 1.00 46.33 C
ATOM 2559 C ASP A 333 49.869 96.592 68.115 1.00 44.42 C
ATOM 2560 O ASP A 333 50.725 97.301 67.580 1.00 42.09 O
ATOM 2561 CB ASP A 333 49.386 96.945 70.561 1.00 49.09 C
ATOM 2562 CG ASP A 333 48.637 97.789 71.587 1.00 51.72 C
ATOM 2563 OD1 ASP A 333 48.513 99.014 71.346 1.00 52.63 O
ATOM 2564 OD2 ASP A 333 48.182 97.240 72.624 1.00 51.40 O
ATOM 2565 N MET A 334 49.726 95.296 67.837 1.00 41.75 N
ATOM 2566 CA MET A 334 50.575 94.634 66.863 1.00 39.61 C
ATOM 2567 C MET A 334 50.403 95.290 65.500 1.00 39.71 C
ATOM 2568 O MET A 334 51.381 95.706 64.877 1.00 41.23 O
ATOM 2569 CB MET A 334 50.218 93.154 66.767 1.00 39.46 C
ATOM 2570 CG MET A 334 51.157 92.337 65.881 1.00 41.78 C
ATOM 2571 SD MET A 334 52.967 92.482 66.305 1.00 43.40 S
ATOM 2572 CE MET A 334 53.702 92.342 64.651 1.00 37.87 C
ATOM 2573 N MET A 335 49.154 95.378 65.039 1.00 39.30 N
ATOM 2574 CA MET A 335 48.841 95.986 63.749 1.00 37.06 C
ATOM 2575 C MET A 335 49.339 97.414 63.729 1.00 36.35 C
ATOM 2576 O MET A 335 49.808 97.903 62.705 1.00 36.63 O
ATOM 2577 CB MET A 335 47.339 95.973 63.496 1.00 35.97 C
ATOM 2578 CG MET A 335 46.940 96.623 62.190 1.00 37.72 C
ATOM 2579 SD MET A 335 47.571 95.748 60.731 1.00 45.64 S
ATOM 2580 CE MET A 335 46.212 94.662 60.289 1.00 41.57 C
ATOM 2581 N PHE A 336 49.248 98.075 64.876 1.00 35.87 N
ATOM 2582 CA PHE A 336 49.689 99.460 65.002 1.00 36.68 C
ATOM 2583 C PHE A 336 51.184 99.591 64.729 1.00 37.26 C
ATOM 2584 O PHE A 336 51.617 100.440 63.950 1.00 36.12 O
ATOM 2585 CB PHE A 336 49.390 99.974 66.411 1.00 36.76 C
ATOM 2586 CG PHE A 336 49.915 101.356 66.672 1.00 37.80 C
ATOM 2587 CD1 PHE A 336 49.214 102.482 66.233 1.00 37.88 C
ATOM 2588 CD2 PHE A 336 51.143 101.536 67.318 1.00 38.41 C
ATOM 2589 CE1 PHE A 336 49.723 103.764 66.428 1.00 34.69 C
ATOM 2590 CE2 PHE A 336 51.661 102.808 67.513 1.00 36.39 C
ATOM 2591 CZ PHE A 336 50.947 103.924 67.065 1.00 36.29 C
ATOM 2592 N CYS A 337 51.965 98.750 65.402 1.00 38.48 N
ATOM 2593 CA CYS A 337 53.407 98.745 65.255 1.00 39.58 C
ATOM 2594 C CYS A 337 53.800 98.223 63.874 1.00 40.67 C
ATOM 2595 O CYS A 337 54.688 98.782 63.226 1.00 42.32 O
ATOM 2596 CB CYS A 337 54.036 97.876 66.343 1.00 39.80 C
ATOM 2597 SG CYS A 337 53.701 98.437 68.041 1.00 43.87 S
ATOM 2598 N ALA A 338 53.141 97.159 63.418 1.00 39.10 N
ATOM 2599 CA ALA A 338 53.461 96.614 62.112 1.00 39.78 C
ATOM 2600 C ALA A 338 53.302 97.704 61.058 1.00 41.32 C
ATOM 2601 O ALA A 338 54.241 97.980 60.305 1.00 42.82 O
ATOM 2602 CB ALA A 338 52.574 95.425 61.796 1.00 38.60 C
ATOM 2603 N GLN A 339 52.133 98.344 61.010 1.00 41.57 N
ATOM 2604 CA GLN A 339 51.923 99.395 60.027 1.00 40.21 C
ATOM 2605 C GLN A 339 52.899 100.523 60.269 1.00 40.02 C
ATOM 2606 O GLN A 339 53.345 101.174 59.322 1.00 41.60 O
ATOM 2607 CB GLN A 339 50.499 99.935 60.083 1.00 41.59 C
ATOM 2608 CG GLN A 339 49.456 98.955 59.609 1.00 43.25 C
ATOM 2609 CD GLN A 339 48.119 99.617 59.333 1.00 43.55 C
ATOM 2610 OE1 GLN A 339 47.975 100.374 58.380 1.00 42.32 O
ATOM 2611 NE2 GLN A 339 47.134 99.333 60.172 1.00 46.25 N
ATOM 2612 N GLY A 340 53.238 100.749 61.535 1.00 38.40 N
ATOM 2613 CA GLY A 340 54.172 101.809 61.866 1.00 39.41 C
ATOM 2614 C GLY A 340 55.505 101.607 61.183 1.00 41.22 C
ATOM 2615 O GLY A 340 56.074 102.542 60.610 1.00 39.16 O
ATOM 2616 N GLU A 341 55.989 100.367 61.232 1.00 42.48 N
ATOM 2617 CA GLU A 341 57.256 100.011 60.635 1.00 43.34 C
ATOM 2618 C GLU A 341 57.233 100.162 59.123 1.00 45.56 C
ATOM 2619 O GLU A 341 58.224 100.594 58.506 1.00 46.74 O
ATOM 2620 CB GLU A 341 57.625 98.593 61.036 1.00 44.27 C
ATOM 2621 CG GLU A 341 58.006 98.485 62.498 1.00 48.52 C
ATOM 2622 CD GLU A 341 58.927 99.615 62.945 1.00 50.72 C
ATOM 2623 OE1 GLU A 341 59.953 99.847 62.270 1.00 51.23 O
ATOM 2624 OE2 GLU A 341 58.625 100.271 63.971 1.00 53.15 O
ATOM 2625 N TRP A 342 56.111 99.797 58.518 1.00 45.30 N
ATOM 2626 CA TRP A 342 55.967 99.947 57.084 1.00 45.87 C
ATOM 2627 C TRP A 342 56.111 101.421 56.724 1.00 46.47 C
ATOM 2628 O TRP A 342 56.676 101.773 55.692 1.00 46.32 O
ATOM 2629 CB TRP A 342 54.600 99.469 56.662 1.00 47.50 C
ATOM 2630 CG TRP A 342 54.606 98.160 56.007 1.00 47.47 C
ATOM 2631 CD1 TRP A 342 55.599 97.243 56.024 1.00 44.51 C
ATOM 2632 CD2 TRP A 342 53.532 97.588 55.266 1.00 48.00 C
ATOM 2633 NE1 TRP A 342 55.215 96.126 55.340 1.00 44.17 N
ATOM 2634 CE2 TRP A 342 53.947 96.308 54.862 1.00 46.74 C
ATOM 2635 CE3 TRP A 342 52.252 98.033 54.909 1.00 49.37 C
ATOM 2636 CZ2 TRP A 342 53.127 95.454 54.111 1.00 49.59 C
ATOM 2637 CZ3 TRP A 342 51.432 97.188 54.161 1.00 50.27 C
ATOM 2638 CH2 TRP A 342 51.875 95.911 53.771 1.00 50.28 C
ATOM 2639 N MET A 343 55.574 102.288 57.573 1.00 47.37 N
ATOM 2640 CA MET A 343 55.681 103.712 57.327 1.00 47.88 C
ATOM 2641 C MET A 343 57.131 104.119 57.455 1.00 48.58 C
ATOM 2642 O MET A 343 57.644 104.863 56.630 1.00 49.21 O
ATOM 2643 CB MET A 343 54.807 104.495 58.303 1.00 47.16 C
ATOM 2644 CG MET A 343 53.339 104.421 57.943 1.00 46.28 C
ATOM 2645 SD MET A 343 53.029 104.970 56.234 1.00 48.53 S
ATOM 2646 CE MET A 343 52.734 103.401 55.370 1.00 44.46 C
ATOM 2647 N ARG A 344 57.801 103.608 58.477 1.00 50.74 N
ATOM 2648 CA ARG A 344 59.206 103.916 58.669 1.00 52.80 C
ATOM 2649 C ARG A 344 60.004 103.556 57.412 1.00 51.48 C
ATOM 2650 O ARG A 344 60.843 104.330 56.960 1.00 49.92 O
ATOM 2651 CB ARG A 344 59.739 103.149 59.868 1.00 56.75 C
ATOM 2652 CG ARG A 344 61.116 103.584 60.310 1.00 65.04 C
ATOM 2653 CD ARG A 344 61.357 103.239 61.778 1.00 71.13 C
ATOM 2654 NE ARG A 344 60.680 104.147 62.720 1.00 76.60 N
ATOM 2655 CZ ARG A 344 59.356 104.271 62.878 1.00 78.14 C
ATOM 2656 NH1 ARG A 344 58.512 103.549 62.153 1.00 78.25 N
ATOM 2657 NH2 ARG A 344 58.871 105.108 63.793 1.00 78.24 N
ATOM 2658 N LEU A 345 59.737 102.385 56.846 1.00 50.72 N
ATOM 2659 CA LEU A 345 60.433 101.973 55.632 1.00 52.13 C
ATOM 2660 C LEU A 345 60.403 103.057 54.562 1.00 52.73 C
ATOM 2661 O LEU A 345 61.441 103.535 54.113 1.00 53.56 O
ATOM 2662 CB LEU A 345 59.801 100.715 55.032 1.00 52.08 C
ATOM 2663 CG LEU A 345 60.144 99.349 55.618 1.00 52.05 C
ATOM 2664 CD1 LEU A 345 59.448 98.274 54.798 1.00 49.97 C
ATOM 2665 CD2 LEU A 345 61.644 99.146 55.608 1.00 52.07 C
ATOM 2666 N CYS A 346 59.199 103.421 54.144 1.00 53.26 N
ATOM 2667 CA CYS A 346 59.005 104.430 53.116 1.00 53.41 C
ATOM 2668 C CYS A 346 59.581 105.782 53.493 1.00 54.09 C
ATOM 2669 O CYS A 346 60.018 106.544 52.622 1.00 54.76 O
ATOM 2670 CB CYS A 346 57.511 104.640 52.845 1.00 52.55 C
ATOM 2671 SG CYS A 346 56.520 103.182 52.495 1.00 53.37 S
ATOM 2672 N THR A 347 59.595 106.079 54.788 1.00 54.27 N
ATOM 2673 CA THR A 347 60.021 107.394 55.228 1.00 55.36 C
ATOM 2674 C THR A 347 61.352 107.629 55.931 1.00 56.24 C
ATOM 2675 O THR A 347 62.008 108.635 55.680 1.00 55.64 O
ATOM 2676 CB THR A 347 58.905 108.030 56.095 1.00 53.93 C
ATOM 2677 OG1 THR A 347 59.342 109.301 56.569 1.00 56.55 O
ATOM 2678 CG2 THR A 347 58.601 107.185 57.297 1.00 54.19 C
ATOM 2679 N SER A 348 61.772 106.729 56.801 1.00 58.68 N
ATOM 2680 CA SER A 348 63.015 106.987 57.511 1.00 61.73 C
ATOM 2681 C SER A 348 64.083 105.892 57.565 1.00 63.29 C
ATOM 2682 O SER A 348 64.873 105.847 58.517 1.00 63.12 O
ATOM 2683 CB SER A 348 62.669 107.451 58.924 1.00 62.67 C
ATOM 2684 OG SER A 348 61.529 106.762 59.410 1.00 61.57 O
ATOM 2685 N THR A 349 64.123 105.037 56.540 1.00 64.31 N
ATOM 2686 CA THR A 349 65.105 103.957 56.466 1.00 64.97 C
ATOM 2687 C THR A 349 66.506 104.540 56.569 1.00 65.85 C
ATOM 2688 O THR A 349 66.774 105.634 56.076 1.00 66.42 O
ATOM 2689 CB THR A 349 64.982 103.173 55.150 1.00 65.07 C
ATOM 2690 OG1 THR A 349 63.690 102.561 55.083 1.00 67.06 O
ATOM 2691 CG2 THR A 349 66.038 102.084 55.073 1.00 65.92 C
ATOM 2692 N THR A 350 67.389 103.789 57.218 1.00 67.16 N
ATOM 2693 CA THR A 350 68.774 104.183 57.455 1.00 67.40 C
ATOM 2694 C THR A 350 69.776 103.368 56.637 1.00 68.11 C
ATOM 2695 O THR A 350 69.475 102.248 56.210 1.00 68.23 O
ATOM 2696 CB THR A 350 69.102 104.003 58.943 1.00 66.77 C
ATOM 2697 OG1 THR A 350 68.322 104.932 59.697 1.00 66.29 O
ATOM 2698 CG2 THR A 350 70.583 104.224 59.218 1.00 69.13 C
ATOM 2699 N GLU A 351 70.965 103.932 56.414 1.00 67.55 N
ATOM 2700 CA GLU A 351 71.988 103.205 55.680 1.00 65.97 C
ATOM 2701 C GLU A 351 72.368 101.970 56.492 1.00 65.00 C
ATOM 2702 O GLU A 351 72.556 100.895 55.930 1.00 63.62 O
ATOM 2703 CB GLU A 351 73.216 104.083 55.428 1.00 66.48 C
ATOM 2704 CG GLU A 351 73.044 105.131 54.318 1.00 67.70 C
ATOM 2705 CD GLU A 351 72.502 104.555 53.002 1.00 69.18 C
ATOM 2706 OE1 GLU A 351 72.665 103.336 52.744 1.00 69.47 O
ATOM 2707 OE2 GLU A 351 71.921 105.334 52.212 1.00 69.40 O
ATOM 2708 N SER A 352 72.456 102.126 57.814 1.00 65.09 N
ATOM 2709 CA SER A 352 72.794 101.015 58.706 1.00 65.54 C
ATOM 2710 C SER A 352 71.777 99.913 58.519 1.00 66.65 C
ATOM 2711 O SER A 352 72.125 98.739 58.369 1.00 66.64 O
ATOM 2712 CB SER A 352 72.745 101.443 60.172 1.00 64.87 C
ATOM 2713 OG SER A 352 73.504 102.609 60.395 1.00 68.71 O
ATOM 2714 N GLU A 353 70.506 100.307 58.542 1.00 68.38 N
ATOM 2715 CA GLU A 353 69.407 99.364 58.391 1.00 68.70 C
ATOM 2716 C GLU A 353 69.563 98.495 57.154 1.00 68.69 C
ATOM 2717 O GLU A 353 69.430 97.271 57.233 1.00 69.53 O
ATOM 2718 CB GLU A 353 68.055 100.097 58.330 1.00 68.44 C
ATOM 2719 CG GLU A 353 67.636 100.770 59.630 1.00 70.06 C
ATOM 2720 CD GLU A 353 66.157 101.144 59.664 1.00 70.98 C
ATOM 2721 OE1 GLU A 353 65.692 101.882 58.767 1.00 70.16 O
ATOM 2722 OE2 GLU A 353 65.456 100.700 60.600 1.00 73.57 O
ATOM 2723 N VAL A 354 69.843 99.122 56.016 1.00 68.09 N
ATOM 2724 CA VAL A 354 69.989 98.378 54.778 1.00 68.93 C
ATOM 2725 C VAL A 354 71.283 97.579 54.755 1.00 69.18 C
ATOM 2726 O VAL A 354 71.329 96.484 54.202 1.00 69.58 O
ATOM 2727 CB VAL A 354 69.935 99.306 53.550 1.00 69.71 C
ATOM 2728 CG1 VAL A 354 68.724 100.221 53.652 1.00 70.29 C
ATOM 2729 CG2 VAL A 354 71.215 100.114 53.442 1.00 71.96 C
ATOM 2730 N LYS A 355 72.336 98.117 55.359 1.00 69.78 N
ATOM 2731 CA LYS A 355 73.612 97.409 55.389 1.00 68.95 C
ATOM 2732 C LYS A 355 73.345 96.028 55.967 1.00 67.17 C
ATOM 2733 O LYS A 355 73.736 95.007 55.400 1.00 68.15 O
ATOM 2734 CB LYS A 355 74.624 98.140 56.277 1.00 70.30 C
ATOM 2735 CG LYS A 355 76.025 97.556 56.214 1.00 73.10 C
ATOM 2736 CD LYS A 355 76.820 97.875 57.473 1.00 74.85 C
ATOM 2737 CE LYS A 355 78.282 97.441 57.346 1.00 74.63 C
ATOM 2738 NZ LYS A 355 79.034 98.294 56.374 1.00 74.21 N
ATOM 2739 N ARG A 356 72.650 96.010 57.094 1.00 64.26 N
ATOM 2740 CA ARG A 356 72.333 94.765 57.767 1.00 61.68 C
ATOM 2741 C ARG A 356 71.396 93.904 56.932 1.00 60.88 C
ATOM 2742 O ARG A 356 71.668 92.730 56.680 1.00 60.56 O
ATOM 2743 CB ARG A 356 71.691 95.068 59.111 1.00 60.15 C
ATOM 2744 CG ARG A 356 71.547 93.877 59.993 1.00 60.28 C
ATOM 2745 CD ARG A 356 70.619 94.193 61.141 1.00 65.71 C
ATOM 2746 NE ARG A 356 69.219 94.240 60.707 1.00 68.57 N
ATOM 2747 CZ ARG A 356 68.413 95.295 60.845 1.00 68.71 C
ATOM 2748 NH1 ARG A 356 68.865 96.414 61.413 1.00 66.77 N
ATOM 2749 NH2 ARG A 356 67.154 95.224 60.411 1.00 67.07 N
ATOM 2750 N ALA A 357 70.287 94.498 56.504 1.00 60.61 N
ATOM 2751 CA ALA A 357 69.290 93.797 55.707 1.00 59.09 C
ATOM 2752 C ALA A 357 69.907 93.142 54.480 1.00 59.26 C
ATOM 2753 O ALA A 357 69.503 92.045 54.089 1.00 59.39 O
ATOM 2754 CB ALA A 357 68.203 94.761 55.288 1.00 59.81 C
ATOM 2755 N LYS A 358 70.885 93.818 53.876 1.00 59.34 N
ATOM 2756 CA LYS A 358 71.566 93.305 52.690 1.00 58.11 C
ATOM 2757 C LYS A 358 72.361 92.055 53.040 1.00 57.80 C
ATOM 2758 O LYS A 358 72.273 91.048 52.341 1.00 57.49 O
ATOM 2759 CB LYS A 358 72.478 94.382 52.094 1.00 58.65 C
ATOM 2760 CG LYS A 358 71.715 95.521 51.416 1.00 58.62 C
ATOM 2761 CD LYS A 358 72.592 96.748 51.179 1.00 59.14 C
ATOM 2762 CE LYS A 358 73.667 96.486 50.137 1.00 60.26 C
ATOM 2763 NZ LYS A 358 74.483 97.708 49.903 1.00 61.03 N
ATOM 2764 N ASN A 359 73.127 92.108 54.123 1.00 57.59 N
ATOM 2765 CA ASN A 359 73.889 90.939 54.527 1.00 58.66 C
ATOM 2766 C ASN A 359 72.915 89.806 54.775 1.00 58.53 C
ATOM 2767 O ASN A 359 73.073 88.704 54.243 1.00 57.96 O
ATOM 2768 CB ASN A 359 74.694 91.219 55.796 1.00 60.43 C
ATOM 2769 CG ASN A 359 75.903 92.098 55.530 1.00 62.78 C
ATOM 2770 OD1 ASN A 359 76.639 91.893 54.551 1.00 62.43 O
ATOM 2771 ND2 ASN A 359 76.124 93.076 56.405 1.00 64.19 N
ATOM 2772 N HIS A 360 71.897 90.091 55.579 1.00 59.13 N
ATOM 2773 CA HIS A 360 70.882 89.097 55.894 1.00 58.64 C
ATOM 2774 C HIS A 360 70.298 88.484 54.625 1.00 57.20 C
ATOM 2775 O HIS A 360 70.098 87.278 54.546 1.00 55.53 O
ATOM 2776 CB HIS A 360 69.748 89.718 56.705 1.00 59.79 C
ATOM 2777 CG HIS A 360 68.673 88.739 57.058 1.00 62.02 C
ATOM 2778 ND1 HIS A 360 68.851 87.745 57.997 1.00 63.16 N
ATOM 2779 CD2 HIS A 360 67.437 88.548 56.540 1.00 62.68 C
ATOM 2780 CE1 HIS A 360 67.773 86.983 58.040 1.00 62.66 C
ATOM 2781 NE2 HIS A 360 66.900 87.448 57.166 1.00 62.60 N
ATOM 2782 N LEU A 361 70.019 89.326 53.638 1.00 57.49 N
ATOM 2783 CA LEU A 361 69.457 88.866 52.375 1.00 58.08 C
ATOM 2784 C LEU A 361 70.422 87.960 51.613 1.00 58.86 C
ATOM 2785 O LEU A 361 70.007 86.942 51.062 1.00 59.73 O
ATOM 2786 CB LEU A 361 69.072 90.059 51.497 1.00 56.31 C
ATOM 2787 CG LEU A 361 68.292 89.669 50.242 1.00 55.43 C
ATOM 2788 CD1 LEU A 361 67.053 88.894 50.650 1.00 54.82 C
ATOM 2789 CD2 LEU A 361 67.908 90.908 49.459 1.00 54.83 C
ATOM 2790 N ARG A 362 71.704 88.326 51.580 1.00 59.81 N
ATOM 2791 CA ARG A 362 72.712 87.514 50.886 1.00 59.86 C
ATOM 2792 C ARG A 362 72.721 86.102 51.455 1.00 60.42 C
ATOM 2793 O ARG A 362 72.498 85.129 50.730 1.00 59.56 O
ATOM 2794 CB ARG A 362 74.117 88.115 51.035 1.00 58.63 C
ATOM 2795 CG ARG A 362 74.306 89.470 50.380 1.00 56.95 C
ATOM 2796 CD ARG A 362 75.755 89.914 50.455 1.00 55.95 C
ATOM 2797 NE ARG A 362 75.968 91.216 49.821 1.00 56.38 N
ATOM 2798 CZ ARG A 362 75.929 92.384 50.461 1.00 55.62 C
ATOM 2799 NH1 ARG A 362 75.689 92.424 51.766 1.00 56.54 N
ATOM 2800 NH2 ARG A 362 76.125 93.514 49.794 1.00 54.60 N
ATOM 2801 N SER A 363 72.967 85.997 52.759 1.00 61.54 N
ATOM 2802 CA SER A 363 73.013 84.696 53.418 1.00 63.42 C
ATOM 2803 C SER A 363 71.709 83.926 53.277 1.00 63.84 C
ATOM 2804 O SER A 363 71.674 82.707 53.443 1.00 65.02 O
ATOM 2805 CB SER A 363 73.360 84.861 54.895 1.00 63.40 C
ATOM 2806 OG SER A 363 72.375 85.616 55.558 1.00 66.49 O
ATOM 2807 N ALA A 364 70.638 84.639 52.959 1.00 64.92 N
ATOM 2808 CA ALA A 364 69.341 84.005 52.782 1.00 65.16 C
ATOM 2809 C ALA A 364 69.263 83.384 51.396 1.00 64.98 C
ATOM 2810 O ALA A 364 68.711 82.297 51.228 1.00 64.97 O
ATOM 2811 CB ALA A 364 68.235 85.025 52.955 1.00 66.47 C
ATOM 2812 N MET A 365 69.810 84.079 50.402 1.00 64.88 N
ATOM 2813 CA MET A 365 69.790 83.565 49.044 1.00 66.00 C
ATOM 2814 C MET A 365 70.752 82.387 48.946 1.00 66.63 C
ATOM 2815 O MET A 365 70.505 81.428 48.213 1.00 66.70 O
ATOM 2816 CB MET A 365 70.190 84.650 48.054 1.00 66.74 C
ATOM 2817 CG MET A 365 71.632 85.086 48.152 1.00 69.86 C
ATOM 2818 SD MET A 365 72.030 86.395 46.954 1.00 74.78 S
ATOM 2819 CE MET A 365 73.825 86.661 47.272 1.00 73.53 C
ATOM 2820 N VAL A 366 71.848 82.463 49.696 1.00 66.41 N
ATOM 2821 CA VAL A 366 72.837 81.391 49.706 1.00 65.49 C
ATOM 2822 C VAL A 366 72.247 80.156 50.380 1.00 64.71 C
ATOM 2823 O VAL A 366 72.569 79.029 50.024 1.00 64.74 O
ATOM 2824 CB VAL A 366 74.123 81.828 50.450 1.00 65.52 C
ATOM 2825 CG1 VAL A 366 75.015 80.631 50.701 1.00 63.48 C
ATOM 2826 CG2 VAL A 366 74.868 82.872 49.623 1.00 63.76 C
ATOM 2827 N ALA A 367 71.366 80.373 51.345 1.00 64.64 N
ATOM 2828 CA ALA A 367 70.734 79.268 52.053 1.00 65.81 C
ATOM 2829 C ALA A 367 69.730 78.508 51.182 1.00 66.15 C
ATOM 2830 O ALA A 367 69.480 77.323 51.397 1.00 65.93 O
ATOM 2831 CB ALA A 367 70.048 79.786 53.307 1.00 64.75 C
ATOM 2832 N GLN A 368 69.155 79.190 50.201 1.00 67.49 N
ATOM 2833 CA GLN A 368 68.176 78.560 49.320 1.00 69.78 C
ATOM 2834 C GLN A 368 68.851 77.719 48.244 1.00 70.41 C
ATOM 2835 O GLN A 368 68.226 77.305 47.260 1.00 70.45 O
ATOM 2836 CB GLN A 368 67.302 79.617 48.651 1.00 71.00 C
ATOM 2837 CG GLN A 368 66.642 80.596 49.602 1.00 71.48 C
ATOM 2838 CD GLN A 368 65.454 81.281 48.960 1.00 71.36 C
ATOM 2839 OE1 GLN A 368 65.508 81.673 47.792 1.00 71.27 O
ATOM 2840 NE2 GLN A 368 64.374 81.431 49.719 1.00 69.76 N
ATOM 2841 N LEU A 369 70.142 77.488 48.436 1.00 70.99 N
ATOM 2842 CA LEU A 369 70.942 76.690 47.517 1.00 70.64 C
ATOM 2843 C LEU A 369 71.757 75.759 48.405 1.00 70.98 C
ATOM 2844 O LEU A 369 72.960 75.575 48.206 1.00 71.66 O
ATOM 2845 CB LEU A 369 71.875 77.594 46.710 1.00 68.82 C
ATOM 2846 CG LEU A 369 71.231 78.635 45.802 1.00 66.24 C
ATOM 2847 CD1 LEU A 369 72.305 79.546 45.264 1.00 66.30 C
ATOM 2848 CD2 LEU A 369 70.491 77.955 44.671 1.00 65.69 C
ATOM 2849 N ASP A 370 71.085 75.180 49.394 1.00 70.80 N
ATOM 2850 CA ASP A 370 71.742 74.292 50.337 1.00 70.77 C
ATOM 2851 C ASP A 370 71.344 72.833 50.153 1.00 69.30 C
ATOM 2852 O ASP A 370 70.660 72.249 50.991 1.00 69.52 O
ATOM 2853 CB ASP A 370 71.426 74.742 51.759 1.00 72.37 C
ATOM 2854 CG ASP A 370 72.489 74.324 52.741 1.00 74.98 C
ATOM 2855 OD1 ASP A 370 73.668 74.720 52.541 1.00 76.12 O
ATOM 2856 OD2 ASP A 370 72.144 73.606 53.706 1.00 75.10 O
ATOM 2857 N GLY A 371 71.794 72.244 49.053 1.00 67.78 N
ATOM 2858 CA GLY A 371 71.469 70.862 48.768 1.00 66.27 C
ATOM 2859 C GLY A 371 71.157 70.763 47.298 1.00 65.06 C
ATOM 2860 O GLY A 371 71.077 71.788 46.625 1.00 63.55 O
ATOM 2861 N THR A 372 70.977 69.551 46.785 1.00 65.23 N
ATOM 2862 CA THR A 372 70.691 69.416 45.367 1.00 65.72 C
ATOM 2863 C THR A 372 69.255 69.766 45.053 1.00 64.64 C
ATOM 2864 O THR A 372 68.971 70.351 44.007 1.00 65.44 O
ATOM 2865 CB THR A 372 70.997 67.990 44.821 1.00 66.48 C
ATOM 2866 OG1 THR A 372 70.363 66.999 45.638 1.00 67.85 O
ATOM 2867 CG2 THR A 372 72.496 67.749 44.786 1.00 67.43 C
ATOM 2868 N THR A 373 68.341 69.429 45.952 1.00 63.40 N
ATOM 2869 CA THR A 373 66.951 69.745 45.677 1.00 62.45 C
ATOM 2870 C THR A 373 66.716 71.254 45.703 1.00 61.61 C
ATOM 2871 O THR A 373 66.129 71.814 44.773 1.00 61.47 O
ATOM 2872 CB THR A 373 66.018 69.042 46.655 1.00 62.15 C
ATOM 2873 OG1 THR A 373 66.395 67.663 46.746 1.00 63.65 O
ATOM 2874 CG2 THR A 373 64.586 69.113 46.150 1.00 60.58 C
ATOM 2875 N PRO A 374 67.176 71.943 46.758 1.00 60.38 N
ATOM 2876 CA PRO A 374 66.939 73.388 46.742 1.00 60.05 C
ATOM 2877 C PRO A 374 67.540 74.098 45.522 1.00 59.83 C
ATOM 2878 O PRO A 374 66.929 75.011 44.966 1.00 60.72 O
ATOM 2879 CB PRO A 374 67.534 73.861 48.076 1.00 59.06 C
ATOM 2880 CG PRO A 374 68.474 72.774 48.466 1.00 59.75 C
ATOM 2881 CD PRO A 374 67.767 71.520 48.036 1.00 60.19 C
ATOM 2882 N VAL A 375 68.728 73.671 45.103 1.00 59.56 N
ATOM 2883 CA VAL A 375 69.393 74.272 43.948 1.00 57.67 C
ATOM 2884 C VAL A 375 68.616 73.934 42.680 1.00 57.92 C
ATOM 2885 O VAL A 375 68.432 74.766 41.787 1.00 57.08 O
ATOM 2886 CB VAL A 375 70.838 73.743 43.794 1.00 55.93 C
ATOM 2887 CG1 VAL A 375 71.463 74.293 42.514 1.00 52.62 C
ATOM 2888 CG2 VAL A 375 71.664 74.139 45.006 1.00 55.08 C
ATOM 2889 N CYS A 376 68.163 72.696 42.601 1.00 57.73 N
ATOM 2890 CA CYS A 376 67.413 72.270 41.444 1.00 59.32 C
ATOM 2891 C CYS A 376 66.144 73.128 41.349 1.00 59.19 C
ATOM 2892 O CYS A 376 65.766 73.569 40.261 1.00 60.14 O
ATOM 2893 CB CYS A 376 67.078 70.783 41.579 1.00 60.66 C
ATOM 2894 SG CYS A 376 66.690 69.990 40.016 1.00 63.97 S
ATOM 2895 N GLU A 377 65.499 73.367 42.495 1.00 58.58 N
ATOM 2896 CA GLU A 377 64.288 74.196 42.572 1.00 55.14 C
ATOM 2897 C GLU A 377 64.576 75.594 42.027 1.00 53.44 C
ATOM 2898 O GLU A 377 63.768 76.152 41.300 1.00 51.80 O
ATOM 2899 CB GLU A 377 63.806 74.298 44.021 1.00 54.32 C
ATOM 2900 CG GLU A 377 62.635 75.253 44.252 1.00 56.38 C
ATOM 2901 CD GLU A 377 61.294 74.779 43.653 1.00 59.00 C
ATOM 2902 OE1 GLU A 377 60.843 73.639 43.947 1.00 58.83 O
ATOM 2903 OE2 GLU A 377 60.679 75.565 42.896 1.00 58.71 O
ATOM 2904 N THR A 378 65.729 76.155 42.376 1.00 53.13 N
ATOM 2905 CA THR A 378 66.097 77.480 41.888 1.00 54.83 C
ATOM 2906 C THR A 378 66.146 77.476 40.360 1.00 57.17 C
ATOM 2907 O THR A 378 65.525 78.318 39.699 1.00 58.05 O
ATOM 2908 CB THR A 378 67.469 77.927 42.425 1.00 53.63 C
ATOM 2909 OG1 THR A 378 67.380 78.154 43.834 1.00 54.04 O
ATOM 2910 CG2 THR A 378 67.911 79.207 41.755 1.00 52.61 C
ATOM 2911 N ILE A 379 66.886 76.524 39.802 1.00 58.38 N
ATOM 2912 CA ILE A 379 67.005 76.416 38.360 1.00 58.94 C
ATOM 2913 C ILE A 379 65.614 76.354 37.727 1.00 58.92 C
ATOM 2914 O ILE A 379 65.261 77.213 36.909 1.00 59.98 O
ATOM 2915 CB ILE A 379 67.826 75.158 37.966 1.00 60.28 C
ATOM 2916 CG1 ILE A 379 69.252 75.290 38.510 1.00 60.84 C
ATOM 2917 CG2 ILE A 379 67.860 74.990 36.441 1.00 59.90 C
ATOM 2918 CD1 ILE A 379 70.110 74.048 38.326 1.00 61.32 C
ATOM 2919 N GLY A 380 64.822 75.357 38.115 1.00 57.35 N
ATOM 2920 CA GLY A 380 63.488 75.219 37.551 1.00 56.65 C
ATOM 2921 C GLY A 380 62.694 76.516 37.567 1.00 56.33 C
ATOM 2922 O GLY A 380 62.175 76.975 36.540 1.00 56.08 O
ATOM 2923 N SER A 381 62.612 77.111 38.754 1.00 55.09 N
ATOM 2924 CA SER A 381 61.891 78.351 38.967 1.00 51.79 C
ATOM 2925 C SER A 381 62.468 79.485 38.148 1.00 52.12 C
ATOM 2926 O SER A 381 61.733 80.190 37.465 1.00 50.55 O
ATOM 2927 CB SER A 381 61.920 78.694 40.449 1.00 50.45 C
ATOM 2928 OG SER A 381 61.211 77.705 41.175 1.00 46.55 O
ATOM 2929 N HIS A 382 63.785 79.654 38.212 1.00 53.04 N
ATOM 2930 CA HIS A 382 64.460 80.707 37.456 1.00 53.43 C
ATOM 2931 C HIS A 382 64.179 80.698 35.958 1.00 54.44 C
ATOM 2932 O HIS A 382 63.844 81.728 35.379 1.00 54.70 O
ATOM 2933 CB HIS A 382 65.973 80.624 37.645 1.00 52.81 C
ATOM 2934 CG HIS A 382 66.470 81.339 38.856 1.00 52.02 C
ATOM 2935 ND1 HIS A 382 67.643 82.060 38.859 1.00 53.39 N
ATOM 2936 CD2 HIS A 382 65.965 81.434 40.106 1.00 51.52 C
ATOM 2937 CE1 HIS A 382 67.838 82.571 40.062 1.00 53.87 C
ATOM 2938 NE2 HIS A 382 66.834 82.205 40.837 1.00 52.32 N
ATOM 2939 N LEU A 383 64.337 79.549 35.316 1.00 54.78 N
ATOM 2940 CA LEU A 383 64.107 79.507 33.883 1.00 57.23 C
ATOM 2941 C LEU A 383 62.647 79.743 33.595 1.00 57.03 C
ATOM 2942 O LEU A 383 62.283 80.435 32.644 1.00 56.93 O
ATOM 2943 CB LEU A 383 64.524 78.152 33.298 1.00 59.93 C
ATOM 2944 CG LEU A 383 65.965 77.644 33.450 1.00 60.20 C
ATOM 2945 CD1 LEU A 383 66.219 76.708 32.280 1.00 60.36 C
ATOM 2946 CD2 LEU A 383 66.994 78.774 33.439 1.00 58.27 C
ATOM 2947 N LEU A 384 61.815 79.147 34.436 1.00 57.15 N
ATOM 2948 CA LEU A 384 60.375 79.250 34.302 1.00 56.17 C
ATOM 2949 C LEU A 384 59.861 80.692 34.537 1.00 56.48 C
ATOM 2950 O LEU A 384 58.858 81.089 33.939 1.00 56.62 O
ATOM 2951 CB LEU A 384 59.733 78.262 35.279 1.00 54.36 C
ATOM 2952 CG LEU A 384 58.351 77.682 34.999 1.00 53.04 C
ATOM 2953 CD1 LEU A 384 58.344 77.004 33.643 1.00 54.16 C
ATOM 2954 CD2 LEU A 384 57.989 76.683 36.099 1.00 51.36 C
ATOM 2955 N ASN A 385 60.556 81.472 35.375 1.00 55.71 N
ATOM 2956 CA ASN A 385 60.142 82.849 35.691 1.00 56.41 C
ATOM 2957 C ASN A 385 60.955 83.944 35.018 1.00 56.96 C
ATOM 2958 O ASN A 385 60.417 84.979 34.649 1.00 56.65 O
ATOM 2959 CB ASN A 385 60.184 83.110 37.207 1.00 55.29 C
ATOM 2960 CG ASN A 385 59.169 82.294 37.974 1.00 56.49 C
ATOM 2961 OD1 ASN A 385 58.044 82.086 37.510 1.00 56.50 O
ATOM 2962 ND2 ASN A 385 59.552 81.840 39.166 1.00 55.86 N
ATOM 2963 N TYR A 386 62.258 83.727 34.899 1.00 58.78 N
ATOM 2964 CA TYR A 386 63.151 84.697 34.283 1.00 59.25 C
ATOM 2965 C TYR A 386 63.625 84.206 32.910 1.00 59.32 C
ATOM 2966 O TYR A 386 64.274 84.946 32.168 1.00 57.32 O
ATOM 2967 CB TYR A 386 64.365 84.923 35.178 1.00 59.63 C
ATOM 2968 CG TYR A 386 64.042 85.311 36.600 1.00 62.36 C
ATOM 2969 CD1 TYR A 386 63.280 86.448 36.884 1.00 63.27 C
ATOM 2970 CD2 TYR A 386 64.563 84.584 37.673 1.00 63.01 C
ATOM 2971 CE1 TYR A 386 63.052 86.859 38.213 1.00 64.14 C
ATOM 2972 CE2 TYR A 386 64.343 84.984 38.998 1.00 64.42 C
ATOM 2973 CZ TYR A 386 63.592 86.121 39.259 1.00 64.56 C
ATOM 2974 OH TYR A 386 63.401 86.526 40.560 1.00 66.00 O
ATOM 2975 N GLY A 387 63.292 82.958 32.579 1.00 59.93 N
ATOM 2976 CA GLY A 387 63.721 82.385 31.313 1.00 60.74 C
ATOM 2977 C GLY A 387 65.244 82.281 31.244 1.00 61.20 C
ATOM 2978 O GLY A 387 65.833 82.326 30.162 1.00 60.46 O
ATOM 2979 N ARG A 388 65.879 82.136 32.406 1.00 60.19 N
ATOM 2980 CA ARG A 388 67.326 82.054 32.493 1.00 58.71 C
ATOM 2981 C ARG A 388 67.708 81.989 33.965 1.00 59.09 C
ATOM 2982 O ARG A 388 67.014 82.531 34.814 1.00 60.08 O
ATOM 2983 CB ARG A 388 67.950 83.297 31.871 1.00 58.01 C
ATOM 2984 CG ARG A 388 67.882 84.526 32.764 1.00 59.46 C
ATOM 2985 CD ARG A 388 68.270 85.798 32.011 1.00 59.33 C
ATOM 2986 NE ARG A 388 68.366 86.973 32.884 1.00 60.06 N
ATOM 2987 CZ ARG A 388 69.339 87.175 33.773 1.00 60.77 C
ATOM 2988 NH1 ARG A 388 69.344 88.270 34.525 1.00 59.12 N
ATOM 2989 NH2 ARG A 388 70.314 86.285 33.910 1.00 62.18 N
ATOM 2990 N ARG A 389 68.817 81.330 34.268 1.00 59.35 N
ATOM 2991 CA ARG A 389 69.267 81.214 35.645 1.00 59.03 C
ATOM 2992 C ARG A 389 69.943 82.508 36.014 1.00 60.01 C
ATOM 2993 O ARG A 389 70.525 83.163 35.155 1.00 60.32 O
ATOM 2994 CB ARG A 389 70.255 80.055 35.790 1.00 56.76 C
ATOM 2995 CG ARG A 389 71.050 80.070 37.081 1.00 56.96 C
ATOM 2996 CD ARG A 389 70.182 79.856 38.308 1.00 56.48 C
ATOM 2997 NE ARG A 389 70.933 80.014 39.559 1.00 57.39 N
ATOM 2998 CZ ARG A 389 71.556 79.030 40.208 1.00 56.86 C
ATOM 2999 NH1 ARG A 389 71.530 77.791 39.741 1.00 58.54 N
ATOM 3000 NH2 ARG A 389 72.208 79.285 41.332 1.00 56.08 N
ATOM 3001 N ILE A 390 69.840 82.888 37.282 1.00 61.28 N
ATOM 3002 CA ILE A 390 70.477 84.107 37.767 1.00 63.17 C
ATOM 3003 C ILE A 390 71.458 83.696 38.862 1.00 64.62 C
ATOM 3004 O ILE A 390 71.063 83.217 39.927 1.00 64.76 O
ATOM 3005 CB ILE A 390 69.446 85.121 38.338 1.00 62.94 C
ATOM 3006 CG1 ILE A 390 68.535 85.628 37.211 1.00 63.17 C
ATOM 3007 CG2 ILE A 390 70.167 86.290 38.990 1.00 61.35 C
ATOM 3008 CD1 ILE A 390 67.448 86.599 37.657 1.00 61.76 C
ATOM 3009 N SER A 391 72.743 83.872 38.578 1.00 65.48 N
ATOM 3010 CA SER A 391 73.800 83.507 39.516 1.00 65.98 C
ATOM 3011 C SER A 391 73.702 84.234 40.851 1.00 65.23 C
ATOM 3012 O SER A 391 73.031 85.255 40.963 1.00 64.90 O
ATOM 3013 CB SER A 391 75.166 83.808 38.897 1.00 66.74 C
ATOM 3014 OG SER A 391 75.311 85.196 38.647 1.00 67.23 O
ATOM 3015 N LEU A 392 74.380 83.699 41.860 1.00 64.57 N
ATOM 3016 CA LEU A 392 74.390 84.331 43.166 1.00 65.04 C
ATOM 3017 C LEU A 392 75.198 85.606 43.023 1.00 65.73 C
ATOM 3018 O LEU A 392 75.037 86.558 43.789 1.00 65.40 O
ATOM 3019 CB LEU A 392 75.073 83.440 44.197 1.00 65.63 C
ATOM 3020 CG LEU A 392 74.319 82.234 44.740 1.00 66.40 C
ATOM 3021 CD1 LEU A 392 75.201 81.511 45.756 1.00 66.48 C
ATOM 3022 CD2 LEU A 392 73.023 82.703 45.387 1.00 67.25 C
ATOM 3023 N GLU A 393 76.083 85.612 42.033 1.00 66.94 N
ATOM 3024 CA GLU A 393 76.940 86.760 41.800 1.00 66.62 C
ATOM 3025 C GLU A 393 76.159 87.918 41.219 1.00 64.98 C
ATOM 3026 O GLU A 393 76.484 89.077 41.490 1.00 63.79 O
ATOM 3027 CB GLU A 393 78.088 86.384 40.868 1.00 68.67 C
ATOM 3028 CG GLU A 393 78.957 87.559 40.486 1.00 71.25 C
ATOM 3029 CD GLU A 393 80.072 87.158 39.561 1.00 72.03 C
ATOM 3030 OE1 GLU A 393 79.784 86.471 38.558 1.00 72.12 O
ATOM 3031 OE2 GLU A 393 81.231 87.533 39.838 1.00 74.45 O
ATOM 3032 N GLU A 394 75.137 87.608 40.418 1.00 63.77 N
ATOM 3033 CA GLU A 394 74.310 88.661 39.830 1.00 62.65 C
ATOM 3034 C GLU A 394 73.474 89.221 40.973 1.00 61.63 C
ATOM 3035 O GLU A 394 73.495 90.427 41.225 1.00 62.22 O
ATOM 3036 CB GLU A 394 73.394 88.123 38.733 1.00 61.52 C
ATOM 3037 CG GLU A 394 72.828 89.223 37.855 1.00 61.70 C
ATOM 3038 CD GLU A 394 71.800 88.715 36.855 1.00 64.56 C
ATOM 3039 OE1 GLU A 394 72.041 87.674 36.210 1.00 66.22 O
ATOM 3040 OE2 GLU A 394 70.744 89.362 36.697 1.00 65.87 O
ATOM 3041 N TRP A 395 72.755 88.341 41.672 1.00 59.28 N
ATOM 3042 CA TRP A 395 71.946 88.761 42.816 1.00 57.58 C
ATOM 3043 C TRP A 395 72.794 89.660 43.708 1.00 58.30 C
ATOM 3044 O TRP A 395 72.409 90.791 44.011 1.00 60.49 O
ATOM 3045 CB TRP A 395 71.479 87.560 43.650 1.00 53.51 C
ATOM 3046 CG TRP A 395 70.286 86.854 43.132 1.00 49.85 C
ATOM 3047 CD1 TRP A 395 70.056 85.520 43.182 1.00 49.54 C
ATOM 3048 CD2 TRP A 395 69.146 87.435 42.483 1.00 49.93 C
ATOM 3049 NE1 TRP A 395 68.847 85.218 42.600 1.00 50.16 N
ATOM 3050 CE2 TRP A 395 68.266 86.378 42.161 1.00 50.01 C
ATOM 3051 CE3 TRP A 395 68.781 88.745 42.140 1.00 49.47 C
ATOM 3052 CZ2 TRP A 395 67.039 86.588 41.509 1.00 49.35 C
ATOM 3053 CZ3 TRP A 395 67.560 88.951 41.490 1.00 49.11 C
ATOM 3054 CH2 TRP A 395 66.707 87.875 41.183 1.00 47.29 C
ATOM 3055 N ASP A 396 73.955 89.164 44.120 1.00 57.43 N
ATOM 3056 CA ASP A 396 74.805 89.948 44.986 1.00 57.46 C
ATOM 3057 C ASP A 396 75.163 91.279 44.361 1.00 57.43 C
ATOM 3058 O ASP A 396 75.367 92.273 45.057 1.00 57.16 O
ATOM 3059 CB ASP A 396 76.073 89.198 45.324 1.00 58.37 C
ATOM 3060 CG ASP A 396 76.930 89.967 46.282 1.00 60.07 C
ATOM 3061 OD1 ASP A 396 77.565 90.960 45.856 1.00 61.98 O
ATOM 3062 OD2 ASP A 396 76.947 89.593 47.468 1.00 60.51 O
ATOM 3063 N SER A 397 75.240 91.299 43.039 1.00 57.88 N
ATOM 3064 CA SER A 397 75.564 92.531 42.326 1.00 58.61 C
ATOM 3065 C SER A 397 74.432 93.531 42.515 1.00 58.11 C
ATOM 3066 O SER A 397 74.654 94.718 42.779 1.00 58.21 O
ATOM 3067 CB SER A 397 75.741 92.246 40.832 1.00 58.62 C
ATOM 3068 OG SER A 397 75.711 93.446 40.079 1.00 59.21 O
ATOM 3069 N ARG A 398 73.214 93.022 42.368 1.00 56.68 N
ATOM 3070 CA ARG A 398 72.009 93.814 42.503 1.00 55.06 C
ATOM 3071 C ARG A 398 71.806 94.238 43.951 1.00 55.42 C
ATOM 3072 O ARG A 398 71.522 95.404 44.235 1.00 55.45 O
ATOM 3073 CB ARG A 398 70.832 92.988 42.024 1.00 52.64 C
ATOM 3074 CG ARG A 398 71.034 92.468 40.629 1.00 50.57 C
ATOM 3075 CD ARG A 398 69.914 91.540 40.244 1.00 50.28 C
ATOM 3076 NE ARG A 398 69.801 91.414 38.799 1.00 49.23 N
ATOM 3077 CZ ARG A 398 69.776 92.449 37.962 1.00 49.95 C
ATOM 3078 NH1 ARG A 398 69.863 93.687 38.437 1.00 48.25 N
ATOM 3079 NH2 ARG A 398 69.653 92.248 36.651 1.00 48.26 N
ATOM 3080 N ILE A 399 71.963 93.289 44.866 1.00 54.06 N
ATOM 3081 CA ILE A 399 71.788 93.577 46.274 1.00 55.01 C
ATOM 3082 C ILE A 399 72.725 94.678 46.717 1.00 57.90 C
ATOM 3083 O ILE A 399 72.345 95.555 47.493 1.00 59.36 O
ATOM 3084 CB ILE A 399 72.058 92.336 47.146 1.00 53.56 C
ATOM 3085 CG1 ILE A 399 70.965 91.293 46.913 1.00 53.33 C
ATOM 3086 CG2 ILE A 399 72.123 92.733 48.619 1.00 51.85 C
ATOM 3087 CD1 ILE A 399 71.141 90.023 47.700 1.00 53.49 C
ATOM 3088 N SER A 400 73.956 94.633 46.219 1.00 60.81 N
ATOM 3089 CA SER A 400 74.966 95.618 46.596 1.00 62.06 C
ATOM 3090 C SER A 400 74.620 97.058 46.209 1.00 62.17 C
ATOM 3091 O SER A 400 75.003 97.997 46.910 1.00 61.81 O
ATOM 3092 CB SER A 400 76.317 95.215 46.001 1.00 61.84 C
ATOM 3093 OG SER A 400 76.752 93.985 46.559 1.00 61.45 O
ATOM 3094 N ALA A 401 73.880 97.220 45.112 1.00 62.16 N
ATOM 3095 CA ALA A 401 73.485 98.541 44.622 1.00 62.63 C
ATOM 3096 C ALA A 401 72.415 99.224 45.472 1.00 63.70 C
ATOM 3097 O ALA A 401 72.233 100.437 45.396 1.00 64.90 O
ATOM 3098 CB ALA A 401 72.996 98.436 43.188 1.00 60.86 C
ATOM 3099 N VAL A 402 71.714 98.444 46.286 1.00 64.15 N
ATOM 3100 CA VAL A 402 70.648 98.974 47.124 1.00 62.76 C
ATOM 3101 C VAL A 402 71.122 99.833 48.297 1.00 62.49 C
ATOM 3102 O VAL A 402 72.034 99.455 49.031 1.00 60.05 O
ATOM 3103 CB VAL A 402 69.773 97.821 47.685 1.00 61.93 C
ATOM 3104 CG1 VAL A 402 68.558 98.385 48.401 1.00 61.99 C
ATOM 3105 CG2 VAL A 402 69.333 96.905 46.561 1.00 61.28 C
ATOM 3106 N ASP A 403 70.494 100.997 48.451 1.00 63.82 N
ATOM 3107 CA ASP A 403 70.789 101.903 49.564 1.00 65.28 C
ATOM 3108 C ASP A 403 69.496 102.405 50.225 1.00 65.05 C
ATOM 3109 O ASP A 403 68.393 102.199 49.705 1.00 64.49 O
ATOM 3110 CB ASP A 403 71.637 103.102 49.109 1.00 66.08 C
ATOM 3111 CG ASP A 403 71.022 103.861 47.945 1.00 67.61 C
ATOM 3112 OD1 ASP A 403 69.815 103.692 47.666 1.00 68.52 O
ATOM 3113 OD2 ASP A 403 71.754 104.645 47.311 1.00 67.99 O
ATOM 3114 N ALA A 404 69.637 103.057 51.376 1.00 64.57 N
ATOM 3115 CA ALA A 404 68.482 103.574 52.096 1.00 63.33 C
ATOM 3116 C ALA A 404 67.528 104.321 51.158 1.00 63.09 C
ATOM 3117 O ALA A 404 66.355 103.967 51.061 1.00 63.69 O
ATOM 3118 CB ALA A 404 68.933 104.478 53.227 1.00 61.29 C
ATOM 3119 N ARG A 405 68.027 105.328 50.448 1.00 62.83 N
ATOM 3120 CA ARG A 405 67.177 106.100 49.545 1.00 63.22 C
ATOM 3121 C ARG A 405 66.378 105.229 48.598 1.00 61.94 C
ATOM 3122 O ARG A 405 65.202 105.486 48.349 1.00 60.68 O
ATOM 3123 CB ARG A 405 68.002 107.092 48.725 1.00 66.26 C
ATOM 3124 CG ARG A 405 67.184 107.832 47.672 1.00 71.75 C
ATOM 3125 CD ARG A 405 67.910 109.069 47.141 1.00 78.10 C
ATOM 3126 NE ARG A 405 67.097 110.287 47.260 1.00 83.25 N
ATOM 3127 CZ ARG A 405 66.029 110.566 46.513 1.00 84.74 C
ATOM 3128 NH1 ARG A 405 65.628 109.715 45.575 1.00 85.53 N
ATOM 3129 NH2 ARG A 405 65.361 111.699 46.706 1.00 85.82 N
ATOM 3130 N MET A 406 67.025 104.199 48.070 1.00 61.15 N
ATOM 3131 CA MET A 406 66.375 103.294 47.137 1.00 60.24 C
ATOM 3132 C MET A 406 65.244 102.532 47.827 1.00 59.29 C
ATOM 3133 O MET A 406 64.165 102.354 47.261 1.00 58.58 O
ATOM 3134 CB MET A 406 67.410 102.322 46.574 1.00 62.38 C
ATOM 3135 CG MET A 406 66.994 101.626 45.287 1.00 65.15 C
ATOM 3136 SD MET A 406 68.428 100.914 44.427 1.00 68.19 S
ATOM 3137 CE MET A 406 67.982 99.225 44.367 1.00 68.86 C
ATOM 3138 N VAL A 407 65.490 102.083 49.055 1.00 57.99 N
ATOM 3139 CA VAL A 407 64.475 101.354 49.803 1.00 55.84 C
ATOM 3140 C VAL A 407 63.265 102.258 50.010 1.00 54.84 C
ATOM 3141 O VAL A 407 62.125 101.850 49.784 1.00 54.51 O
ATOM 3142 CB VAL A 407 65.022 100.882 51.163 1.00 54.93 C
ATOM 3143 CG1 VAL A 407 63.909 100.322 52.018 1.00 54.83 C
ATOM 3144 CG2 VAL A 407 66.062 99.815 50.939 1.00 54.32 C
ATOM 3145 N ARG A 408 63.524 103.492 50.419 1.00 53.56 N
ATOM 3146 CA ARG A 408 62.456 104.452 50.634 1.00 53.17 C
ATOM 3147 C ARG A 408 61.617 104.689 49.390 1.00 52.33 C
ATOM 3148 O ARG A 408 60.402 104.597 49.444 1.00 53.85 O
ATOM 3149 CB ARG A 408 63.021 105.781 51.122 1.00 52.91 C
ATOM 3150 CG ARG A 408 63.545 105.721 52.532 1.00 54.24 C
ATOM 3151 CD ARG A 408 63.689 107.109 53.090 1.00 57.22 C
ATOM 3152 NE ARG A 408 64.715 107.872 52.394 1.00 60.77 N
ATOM 3153 CZ ARG A 408 66.000 107.859 52.734 1.00 63.81 C
ATOM 3154 NH1 ARG A 408 66.400 107.119 53.765 1.00 63.92 N
ATOM 3155 NH2 ARG A 408 66.884 108.580 52.045 1.00 64.45 N
ATOM 3156 N ASP A 409 62.252 104.991 48.269 1.00 52.02 N
ATOM 3157 CA ASP A 409 61.494 105.234 47.049 1.00 53.39 C
ATOM 3158 C ASP A 409 60.705 104.014 46.590 1.00 51.86 C
ATOM 3159 O ASP A 409 59.537 104.125 46.234 1.00 51.56 O
ATOM 3160 CB ASP A 409 62.415 105.692 45.914 1.00 57.19 C
ATOM 3161 CG ASP A 409 63.241 106.911 46.288 1.00 61.35 C
ATOM 3162 OD1 ASP A 409 62.858 107.630 47.246 1.00 61.45 O
ATOM 3163 OD2 ASP A 409 64.271 107.153 45.616 1.00 63.95 O
ATOM 3164 N VAL A 410 61.336 102.847 46.586 1.00 51.37 N
ATOM 3165 CA VAL A 410 60.635 101.639 46.156 1.00 51.16 C
ATOM 3166 C VAL A 410 59.481 101.334 47.112 1.00 49.84 C
ATOM 3167 O VAL A 410 58.354 101.107 46.678 1.00 48.29 O
ATOM 3168 CB VAL A 410 61.603 100.415 46.058 1.00 51.15 C
ATOM 3169 CG1 VAL A 410 60.842 99.159 45.663 1.00 49.01 C
ATOM 3170 CG2 VAL A 410 62.662 100.691 45.009 1.00 50.37 C
ATOM 3171 N CYS A 411 59.765 101.339 48.411 1.00 49.01 N
ATOM 3172 CA CYS A 411 58.730 101.096 49.412 1.00 49.05 C
ATOM 3173 C CYS A 411 57.616 102.142 49.336 1.00 47.45 C
ATOM 3174 O CYS A 411 56.435 101.809 49.435 1.00 47.16 O
ATOM 3175 CB CYS A 411 59.342 101.093 50.806 1.00 50.21 C
ATOM 3176 SG CYS A 411 60.273 99.591 51.141 1.00 53.47 S
ATOM 3177 N SER A 412 57.993 103.404 49.169 1.00 45.02 N
ATOM 3178 CA SER A 412 57.005 104.449 49.047 1.00 45.23 C
ATOM 3179 C SER A 412 56.166 104.099 47.836 1.00 46.97 C
ATOM 3180 O SER A 412 54.947 104.263 47.835 1.00 50.27 O
ATOM 3181 CB SER A 412 57.671 105.796 48.823 1.00 42.58 C
ATOM 3182 OG SER A 412 58.427 106.168 49.958 1.00 45.29 O
ATOM 3183 N LYS A 413 56.825 103.586 46.807 1.00 47.98 N
ATOM 3184 CA LYS A 413 56.151 103.236 45.571 1.00 48.32 C
ATOM 3185 C LYS A 413 55.053 102.183 45.697 1.00 48.67 C
ATOM 3186 O LYS A 413 53.960 102.356 45.160 1.00 50.29 O
ATOM 3187 CB LYS A 413 57.179 102.776 44.539 1.00 50.15 C
ATOM 3188 CG LYS A 413 56.564 102.349 43.203 1.00 52.74 C
ATOM 3189 CD LYS A 413 57.628 102.013 42.188 1.00 53.95 C
ATOM 3190 CE LYS A 413 57.037 101.619 40.844 1.00 56.13 C
ATOM 3191 NZ LYS A 413 58.147 101.292 39.881 1.00 59.57 N
ATOM 3192 N TYR A 414 55.331 101.096 46.405 1.00 48.03 N
ATOM 3193 CA TYR A 414 54.351 100.028 46.539 1.00 47.38 C
ATOM 3194 C TYR A 414 53.485 100.074 47.792 1.00 48.10 C
ATOM 3195 O TYR A 414 52.404 99.480 47.814 1.00 48.93 O
ATOM 3196 CB TYR A 414 55.052 98.656 46.458 1.00 46.60 C
ATOM 3197 CG TYR A 414 55.650 98.361 45.094 1.00 45.33 C
ATOM 3198 CD1 TYR A 414 56.918 98.828 44.754 1.00 44.37 C
ATOM 3199 CD2 TYR A 414 54.895 97.721 44.100 1.00 45.38 C
ATOM 3200 CE1 TYR A 414 57.419 98.682 43.463 1.00 44.72 C
ATOM 3201 CE2 TYR A 414 55.386 97.569 42.796 1.00 44.54 C
ATOM 3202 CZ TYR A 414 56.648 98.056 42.484 1.00 45.45 C
ATOM 3203 OH TYR A 414 57.123 97.950 41.194 1.00 44.38 O
ATOM 3204 N ILE A 415 53.939 100.795 48.816 1.00 46.34 N
ATOM 3205 CA ILE A 415 53.220 100.864 50.089 1.00 44.61 C
ATOM 3206 C ILE A 415 52.464 102.144 50.450 1.00 42.96 C
ATOM 3207 O ILE A 415 51.272 102.120 50.749 1.00 42.30 O
ATOM 3208 CB ILE A 415 54.187 100.622 51.252 1.00 45.71 C
ATOM 3209 CG1 ILE A 415 54.958 99.326 51.017 1.00 48.01 C
ATOM 3210 CG2 ILE A 415 53.424 100.600 52.564 1.00 45.65 C
ATOM 3211 CD1 ILE A 415 56.123 99.131 51.973 1.00 48.52 C
ATOM 3212 N TYR A 416 53.176 103.260 50.444 1.00 40.77 N
ATOM 3213 CA TYR A 416 52.587 104.507 50.852 1.00 37.87 C
ATOM 3214 C TYR A 416 51.247 104.875 50.239 1.00 38.38 C
ATOM 3215 O TYR A 416 51.079 104.922 49.019 1.00 39.21 O
ATOM 3216 CB TYR A 416 53.569 105.644 50.664 1.00 34.64 C
ATOM 3217 CG TYR A 416 53.170 106.839 51.491 1.00 35.33 C
ATOM 3218 CD1 TYR A 416 53.493 106.915 52.851 1.00 34.58 C
ATOM 3219 CD2 TYR A 416 52.417 107.869 50.930 1.00 34.33 C
ATOM 3220 CE1 TYR A 416 53.070 107.991 53.631 1.00 35.47 C
ATOM 3221 CE2 TYR A 416 51.992 108.939 51.690 1.00 36.31 C
ATOM 3222 CZ TYR A 416 52.312 109.000 53.041 1.00 37.23 C
ATOM 3223 OH TYR A 416 51.812 110.054 53.785 1.00 40.45 O
ATOM 3224 N ASP A 417 50.303 105.147 51.133 1.00 36.78 N
ATOM 3225 CA ASP A 417 48.950 105.531 50.798 1.00 36.60 C
ATOM 3226 C ASP A 417 48.261 104.596 49.823 1.00 36.65 C
ATOM 3227 O ASP A 417 47.518 105.044 48.952 1.00 37.75 O
ATOM 3228 CB ASP A 417 48.897 106.963 50.251 1.00 34.66 C
ATOM 3229 CG ASP A 417 47.454 107.494 50.145 1.00 35.20 C
ATOM 3230 OD1 ASP A 417 47.237 108.470 49.382 1.00 33.24 O
ATOM 3231 OD2 ASP A 417 46.546 106.939 50.831 1.00 31.06 O
ATOM 3232 N LYS A 418 48.496 103.300 49.973 1.00 36.38 N
ATOM 3233 CA LYS A 418 47.867 102.314 49.107 1.00 36.51 C
ATOM 3234 C LYS A 418 46.717 101.684 49.851 1.00 36.83 C
ATOM 3235 O LYS A 418 46.661 101.762 51.065 1.00 38.79 O
ATOM 3236 CB LYS A 418 48.856 101.213 48.743 1.00 36.71 C
ATOM 3237 CG LYS A 418 49.897 101.629 47.745 1.00 37.98 C
ATOM 3238 CD LYS A 418 49.304 101.758 46.363 1.00 36.41 C
ATOM 3239 CE LYS A 418 50.362 102.169 45.359 1.00 38.98 C
ATOM 3240 NZ LYS A 418 49.819 102.188 43.967 1.00 43.13 N
ATOM 3241 N CYS A 419 45.810 101.043 49.130 1.00 37.08 N
ATOM 3242 CA CYS A 419 44.683 100.375 49.762 1.00 36.57 C
ATOM 3243 C CYS A 419 45.081 98.928 49.849 1.00 36.72 C
ATOM 3244 O CYS A 419 45.186 98.256 48.829 1.00 40.08 O
ATOM 3245 CB CYS A 419 43.424 100.513 48.916 1.00 34.74 C
ATOM 3246 SG CYS A 419 42.923 102.203 48.770 1.00 34.79 S
ATOM 3247 N PRO A 420 45.313 98.428 51.066 1.00 35.39 N
ATOM 3248 CA PRO A 420 45.714 97.038 51.287 1.00 34.36 C
ATOM 3249 C PRO A 420 44.610 95.999 51.209 1.00 34.79 C
ATOM 3250 O PRO A 420 43.411 96.302 51.108 1.00 35.05 O
ATOM 3251 CB PRO A 420 46.319 97.084 52.679 1.00 34.57 C
ATOM 3252 CG PRO A 420 45.417 98.053 53.368 1.00 33.58 C
ATOM 3253 CD PRO A 420 45.306 99.171 52.337 1.00 33.95 C
ATOM 3254 N ALA A 421 45.048 94.752 51.267 1.00 33.52 N
ATOM 3255 CA ALA A 421 44.152 93.623 51.239 1.00 32.68 C
ATOM 3256 C ALA A 421 44.364 93.036 52.622 1.00 33.22 C
ATOM 3257 O ALA A 421 45.504 92.900 53.090 1.00 33.15 O
ATOM 3258 CB ALA A 421 44.561 92.639 50.160 1.00 31.48 C
ATOM 3259 N LEU A 422 43.262 92.707 53.278 1.00 32.11 N
ATOM 3260 CA LEU A 422 43.324 92.194 54.622 1.00 31.39 C
ATOM 3261 C LEU A 422 42.536 90.915 54.829 1.00 31.32 C
ATOM 3262 O LEU A 422 41.415 90.765 54.336 1.00 32.45 O
ATOM 3263 CB LEU A 422 42.806 93.258 55.586 1.00 32.42 C
ATOM 3264 CG LEU A 422 42.686 92.813 57.040 1.00 33.40 C
ATOM 3265 CD1 LEU A 422 44.031 92.989 57.705 1.00 34.58 C
ATOM 3266 CD2 LEU A 422 41.629 93.632 57.764 1.00 35.60 C
ATOM 3267 N ALA A 423 43.139 89.990 55.565 1.00 30.22 N
ATOM 3268 CA ALA A 423 42.493 88.737 55.896 1.00 29.24 C
ATOM 3269 C ALA A 423 42.706 88.528 57.393 1.00 29.49 C
ATOM 3270 O ALA A 423 43.847 88.526 57.878 1.00 29.21 O
ATOM 3271 CB ALA A 423 43.090 87.593 55.096 1.00 24.78 C
ATOM 3272 N ALA A 424 41.603 88.401 58.130 1.00 29.25 N
ATOM 3273 CA ALA A 424 41.673 88.177 59.565 1.00 28.96 C
ATOM 3274 C ALA A 424 40.848 86.936 59.909 1.00 30.62 C
ATOM 3275 O ALA A 424 39.704 86.797 59.469 1.00 31.01 O
ATOM 3276 CB ALA A 424 41.156 89.377 60.293 1.00 25.47 C
ATOM 3277 N VAL A 425 41.442 86.017 60.667 1.00 31.51 N
ATOM 3278 CA VAL A 425 40.750 84.796 61.060 1.00 31.95 C
ATOM 3279 C VAL A 425 40.898 84.574 62.561 1.00 31.37 C
ATOM 3280 O VAL A 425 41.927 84.904 63.130 1.00 32.38 O
ATOM 3281 CB VAL A 425 41.315 83.567 60.322 1.00 32.82 C
ATOM 3282 CG1 VAL A 425 40.346 82.391 60.438 1.00 32.88 C
ATOM 3283 CG2 VAL A 425 41.554 83.897 58.873 1.00 34.27 C
ATOM 3284 N GLY A 426 39.864 84.020 63.188 1.00 30.83 N
ATOM 3285 CA GLY A 426 39.896 83.765 64.615 1.00 33.34 C
ATOM 3286 C GLY A 426 39.173 84.794 65.478 1.00 34.94 C
ATOM 3287 O GLY A 426 38.154 85.366 65.054 1.00 35.14 O
ATOM 3288 N PRO A 427 39.662 85.028 66.716 1.00 34.92 N
ATOM 3289 CA PRO A 427 39.079 85.992 67.669 1.00 34.36 C
ATOM 3290 C PRO A 427 39.575 87.384 67.334 1.00 33.70 C
ATOM 3291 O PRO A 427 40.395 87.941 68.053 1.00 33.70 O
ATOM 3292 CB PRO A 427 39.603 85.502 69.006 1.00 33.77 C
ATOM 3293 CG PRO A 427 40.966 85.004 68.646 1.00 33.62 C
ATOM 3294 CD PRO A 427 40.730 84.242 67.360 1.00 32.53 C
ATOM 3295 N ILE A 428 39.061 87.929 66.232 1.00 34.16 N
ATOM 3296 CA ILE A 428 39.456 89.239 65.716 1.00 33.56 C
ATOM 3297 C ILE A 428 38.649 90.494 66.086 1.00 34.09 C
ATOM 3298 O ILE A 428 38.739 91.499 65.389 1.00 35.54 O
ATOM 3299 CB ILE A 428 39.535 89.180 64.188 1.00 31.73 C
ATOM 3300 CG1 ILE A 428 38.197 88.698 63.632 1.00 30.83 C
ATOM 3301 CG2 ILE A 428 40.658 88.228 63.761 1.00 33.80 C
ATOM 3302 CD1 ILE A 428 38.096 88.744 62.131 1.00 27.52 C
ATOM 3303 N GLU A 429 37.892 90.477 67.174 1.00 34.67 N
ATOM 3304 CA GLU A 429 37.123 91.665 67.525 1.00 36.45 C
ATOM 3305 C GLU A 429 37.935 92.926 67.762 1.00 35.28 C
ATOM 3306 O GLU A 429 37.497 94.017 67.431 1.00 35.48 O
ATOM 3307 CB GLU A 429 36.262 91.428 68.759 1.00 39.11 C
ATOM 3308 CG GLU A 429 35.361 92.604 69.064 1.00 44.85 C
ATOM 3309 CD GLU A 429 34.403 92.330 70.208 1.00 51.45 C
ATOM 3310 OE1 GLU A 429 34.795 92.573 71.370 1.00 51.63 O
ATOM 3311 OE2 GLU A 429 33.259 91.863 69.944 1.00 54.26 O
ATOM 3312 N GLN A 430 39.116 92.795 68.337 1.00 36.64 N
ATOM 3313 CA GLN A 430 39.912 93.978 68.616 1.00 37.72 C
ATOM 3314 C GLN A 430 40.537 94.645 67.366 1.00 37.11 C
ATOM 3315 O GLN A 430 40.952 95.800 67.420 1.00 36.08 O
ATOM 3316 CB GLN A 430 40.998 93.635 69.646 1.00 40.11 C
ATOM 3317 CG GLN A 430 41.498 94.848 70.431 1.00 45.82 C
ATOM 3318 CD GLN A 430 42.726 94.553 71.283 1.00 49.50 C
ATOM 3319 OE1 GLN A 430 43.846 94.393 70.773 1.00 51.86 O
ATOM 3320 NE2 GLN A 430 42.520 94.479 72.592 1.00 51.33 N
ATOM 3321 N LEU A 431 40.601 93.931 66.244 1.00 36.13 N
ATOM 3322 CA LEU A 431 41.178 94.507 65.037 1.00 35.42 C
ATOM 3323 C LEU A 431 40.265 95.603 64.500 1.00 37.25 C
ATOM 3324 O LEU A 431 39.159 95.326 64.051 1.00 38.03 O
ATOM 3325 CB LEU A 431 41.365 93.434 63.972 1.00 33.49 C
ATOM 3326 CG LEU A 431 41.975 93.955 62.673 1.00 33.30 C
ATOM 3327 CD1 LEU A 431 43.389 94.386 62.940 1.00 31.78 C
ATOM 3328 CD2 LEU A 431 41.931 92.891 61.600 1.00 31.77 C
ATOM 3329 N LEU A 432 40.731 96.847 64.514 1.00 39.65 N
ATOM 3330 CA LEU A 432 39.894 97.943 64.043 1.00 41.57 C
ATOM 3331 C LEU A 432 39.509 97.858 62.583 1.00 41.44 C
ATOM 3332 O LEU A 432 40.117 97.115 61.813 1.00 42.58 O
ATOM 3333 CB LEU A 432 40.539 99.298 64.362 1.00 44.14 C
ATOM 3334 CG LEU A 432 40.509 99.639 65.874 1.00 45.59 C
ATOM 3335 CD1 LEU A 432 40.770 101.127 66.083 1.00 45.40 C
ATOM 3336 CD2 LEU A 432 39.143 99.274 66.470 1.00 44.63 C
ATOM 3337 N ASP A 433 38.488 98.622 62.207 1.00 40.00 N
ATOM 3338 CA ASP A 433 37.979 98.592 60.841 1.00 39.05 C
ATOM 3339 C ASP A 433 38.961 98.998 59.731 1.00 37.45 C
ATOM 3340 O ASP A 433 40.020 99.578 59.978 1.00 34.65 O
ATOM 3341 CB ASP A 433 36.731 99.459 60.733 1.00 38.45 C
ATOM 3342 CG ASP A 433 37.069 100.905 60.585 1.00 40.22 C
ATOM 3343 OD1 ASP A 433 37.555 101.483 61.574 1.00 43.44 O
ATOM 3344 OD2 ASP A 433 36.877 101.458 59.481 1.00 39.85 O
ATOM 3345 N TYR A 434 38.555 98.701 58.497 1.00 37.70 N
ATOM 3346 CA TYR A 434 39.335 98.981 57.299 1.00 35.84 C
ATOM 3347 C TYR A 434 39.767 100.416 57.203 1.00 35.95 C
ATOM 3348 O TYR A 434 40.917 100.695 56.866 1.00 37.14 O
ATOM 3349 CB TYR A 434 38.536 98.652 56.036 1.00 36.10 C
ATOM 3350 CG TYR A 434 39.414 98.584 54.815 1.00 36.17 C
ATOM 3351 CD1 TYR A 434 40.161 97.436 54.537 1.00 35.00 C
ATOM 3352 CD2 TYR A 434 39.588 99.699 53.996 1.00 36.89 C
ATOM 3353 CE1 TYR A 434 41.065 97.399 53.489 1.00 35.35 C
ATOM 3354 CE2 TYR A 434 40.498 99.673 52.936 1.00 38.68 C
ATOM 3355 CZ TYR A 434 41.233 98.516 52.695 1.00 37.77 C
ATOM 3356 OH TYR A 434 42.147 98.484 51.671 1.00 40.19 O
ATOM 3357 N ASN A 435 38.837 101.334 57.464 1.00 35.14 N
ATOM 3358 CA ASN A 435 39.154 102.756 57.396 1.00 32.01 C
ATOM 3359 C ASN A 435 40.275 103.076 58.353 1.00 30.64 C
ATOM 3360 O ASN A 435 41.200 103.776 57.989 1.00 29.97 O
ATOM 3361 CB ASN A 435 37.930 103.613 57.720 1.00 34.35 C
ATOM 3362 CG ASN A 435 36.983 103.751 56.542 1.00 35.57 C
ATOM 3363 OD1 ASN A 435 37.363 104.236 55.468 1.00 36.93 O
ATOM 3364 ND2 ASN A 435 35.739 103.335 56.737 1.00 34.47 N
ATOM 3365 N ARG A 436 40.212 102.565 59.577 1.00 31.33 N
ATOM 3366 CA ARG A 436 41.294 102.826 60.514 1.00 34.42 C
ATOM 3367 C ARG A 436 42.599 102.248 59.994 1.00 36.18 C
ATOM 3368 O ARG A 436 43.630 102.916 60.020 1.00 39.48 O
ATOM 3369 CB ARG A 436 40.980 102.258 61.887 1.00 34.97 C
ATOM 3370 CG ARG A 436 39.985 103.119 62.630 1.00 37.32 C
ATOM 3371 CD ARG A 436 40.542 104.521 62.807 1.00 38.54 C
ATOM 3372 NE ARG A 436 41.309 104.609 64.042 1.00 40.40 N
ATOM 3373 CZ ARG A 436 40.754 104.667 65.243 1.00 41.97 C
ATOM 3374 NH1 ARG A 436 39.432 104.658 65.354 1.00 43.86 N
ATOM 3375 NH2 ARG A 436 41.511 104.707 66.330 1.00 42.29 N
ATOM 3376 N ILE A 437 42.561 101.018 59.502 1.00 35.53 N
ATOM 3377 CA ILE A 437 43.759 100.413 58.958 1.00 36.19 C
ATOM 3378 C ILE A 437 44.270 101.221 57.761 1.00 38.41 C
ATOM 3379 O ILE A 437 45.469 101.502 57.649 1.00 40.07 O
ATOM 3380 CB ILE A 437 43.484 98.959 58.517 1.00 36.75 C
ATOM 3381 CG1 ILE A 437 43.157 98.117 59.757 1.00 37.20 C
ATOM 3382 CG2 ILE A 437 44.696 98.390 57.779 1.00 35.02 C
ATOM 3383 CD1 ILE A 437 42.855 96.670 59.480 1.00 40.09 C
ATOM 3384 N ARG A 438 43.357 101.593 56.866 1.00 37.76 N
ATOM 3385 CA ARG A 438 43.715 102.348 55.678 1.00 35.93 C
ATOM 3386 C ARG A 438 44.469 103.612 56.027 1.00 36.31 C
ATOM 3387 O ARG A 438 45.288 104.080 55.250 1.00 35.60 O
ATOM 3388 CB ARG A 438 42.463 102.712 54.895 1.00 36.03 C
ATOM 3389 CG ARG A 438 42.731 103.555 53.653 1.00 34.55 C
ATOM 3390 CD ARG A 438 43.383 102.742 52.573 1.00 34.05 C
ATOM 3391 NE ARG A 438 43.592 103.530 51.364 1.00 35.73 N
ATOM 3392 CZ ARG A 438 44.473 104.523 51.245 1.00 38.02 C
ATOM 3393 NH1 ARG A 438 45.261 104.882 52.261 1.00 34.63 N
ATOM 3394 NH2 ARG A 438 44.565 105.166 50.093 1.00 39.09 N
ATOM 3395 N SER A 439 44.179 104.175 57.193 1.00 38.22 N
ATOM 3396 CA SER A 439 44.857 105.390 57.632 1.00 40.38 C
ATOM 3397 C SER A 439 46.254 105.102 58.120 1.00 39.67 C
ATOM 3398 O SER A 439 47.082 105.989 58.177 1.00 40.20 O
ATOM 3399 CB SER A 439 44.069 106.075 58.729 1.00 40.38 C
ATOM 3400 OG SER A 439 42.932 106.665 58.149 1.00 45.73 O
ATOM 3401 N GLY A 440 46.507 103.857 58.488 1.00 39.91 N
ATOM 3402 CA GLY A 440 47.835 103.505 58.926 1.00 43.20 C
ATOM 3403 C GLY A 440 48.736 103.367 57.708 1.00 45.93 C
ATOM 3404 O GLY A 440 49.891 102.951 57.822 1.00 48.44 O
ATOM 3405 N MET A 441 48.214 103.720 56.536 1.00 46.36 N
ATOM 3406 CA MET A 441 48.982 103.610 55.310 1.00 45.52 C
ATOM 3407 C MET A 441 49.656 104.907 54.917 1.00 47.02 C
ATOM 3408 O MET A 441 50.243 104.993 53.841 1.00 45.58 O
ATOM 3409 CB MET A 441 48.100 103.119 54.162 1.00 44.99 C
ATOM 3410 CG MET A 441 47.525 101.721 54.368 1.00 44.73 C
ATOM 3411 SD MET A 441 48.733 100.363 54.450 1.00 42.36 S
ATOM 3412 CE MET A 441 49.149 100.224 52.755 1.00 43.18 C
ATOM 3413 N TYR A 442 49.564 105.923 55.774 1.00 50.24 N
ATOM 3414 CA TYR A 442 50.243 107.191 55.497 1.00 53.89 C
ATOM 3415 C TYR A 442 50.668 107.979 56.730 1.00 55.83 C
ATOM 3416 O TYR A 442 50.070 107.878 57.799 1.00 52.97 O
ATOM 3417 CB TYR A 442 49.429 108.080 54.548 1.00 54.70 C
ATOM 3418 CG TYR A 442 48.060 108.414 55.026 1.00 57.74 C
ATOM 3419 CD1 TYR A 442 47.851 109.454 55.926 1.00 59.52 C
ATOM 3420 CD2 TYR A 442 46.972 107.654 54.626 1.00 59.35 C
ATOM 3421 CE1 TYR A 442 46.583 109.727 56.426 1.00 61.87 C
ATOM 3422 CE2 TYR A 442 45.704 107.910 55.115 1.00 62.74 C
ATOM 3423 CZ TYR A 442 45.509 108.944 56.017 1.00 63.77 C
ATOM 3424 OH TYR A 442 44.237 109.165 56.519 1.00 66.33 O
ATOM 3425 N TRP A 443 51.752 108.736 56.547 1.00 61.65 N
ATOM 3426 CA TRP A 443 52.383 109.577 57.567 1.00 64.97 C
ATOM 3427 C TRP A 443 52.985 108.747 58.726 1.00 66.37 C
ATOM 3428 O TRP A 443 52.253 108.195 59.548 1.00 66.87 O
ATOM 3429 CB TRP A 443 51.372 110.600 58.093 1.00 66.88 C
ATOM 3430 CG TRP A 443 51.973 111.885 58.576 1.00 70.28 C
ATOM 3431 CD1 TRP A 443 51.362 112.823 59.357 1.00 71.53 C
ATOM 3432 CD2 TRP A 443 53.304 112.372 58.332 1.00 72.93 C
ATOM 3433 NE1 TRP A 443 52.226 113.860 59.621 1.00 72.63 N
ATOM 3434 CE2 TRP A 443 53.425 113.610 59.006 1.00 73.67 C
ATOM 3435 CE3 TRP A 443 54.410 111.884 57.611 1.00 75.53 C
ATOM 3436 CZ2 TRP A 443 54.607 114.367 58.982 1.00 73.56 C
ATOM 3437 CZ3 TRP A 443 55.592 112.643 57.588 1.00 74.62 C
ATOM 3438 CH2 TRP A 443 55.673 113.868 58.271 1.00 74.45 C
ATOM 3439 N ILE A 444 54.318 108.647 58.769 1.00 67.17 N
ATOM 3440 CA ILE A 444 55.016 107.890 59.813 1.00 66.52 C
TER 3441 ILE A 444
ATOM 3442 N PRO B 19 88.721 74.692 42.050 1.00103.53 N
ATOM 3443 CA PRO B 19 89.484 73.908 43.055 1.00103.52 C
ATOM 3444 C PRO B 19 88.582 73.070 43.973 1.00103.17 C
ATOM 3445 O PRO B 19 88.754 73.069 45.193 1.00103.84 O
ATOM 3446 CB PRO B 19 90.299 74.914 43.861 1.00103.47 C
ATOM 3447 CG PRO B 19 90.467 76.046 42.842 1.00103.64 C
ATOM 3448 CD PRO B 19 89.125 76.110 42.098 1.00103.09 C
ATOM 3449 N GLY B 20 87.632 72.350 43.384 1.00101.94 N
ATOM 3450 CA GLY B 20 86.728 71.536 44.179 1.00100.69 C
ATOM 3451 C GLY B 20 87.338 70.248 44.707 1.00 99.94 C
ATOM 3452 O GLY B 20 86.621 69.282 44.972 1.00 99.58 O
ATOM 3453 N ALA B 21 88.660 70.229 44.860 1.00 99.18 N
ATOM 3454 CA ALA B 21 89.364 69.049 45.366 1.00 97.89 C
ATOM 3455 C ALA B 21 90.270 69.393 46.551 1.00 97.05 C
ATOM 3456 O ALA B 21 91.493 69.242 46.472 1.00 96.30 O
ATOM 3457 CB ALA B 21 90.182 68.408 44.253 1.00 97.77 C
ATOM 3458 N GLU B 22 89.652 69.859 47.638 1.00 95.84 N
ATOM 3459 CA GLU B 22 90.346 70.230 48.871 1.00 94.02 C
ATOM 3460 C GLU B 22 90.367 69.042 49.834 1.00 93.57 C
ATOM 3461 O GLU B 22 89.583 68.103 49.697 1.00 92.19 O
ATOM 3462 CB GLU B 22 89.629 71.402 49.541 1.00 93.80 C
ATOM 3463 CG GLU B 22 90.434 72.141 50.604 1.00 93.30 C
ATOM 3464 CD GLU B 22 91.389 73.158 50.002 1.00 93.71 C
ATOM 3465 OE1 GLU B 22 91.218 73.503 48.809 1.00 92.80 O
ATOM 3466 OE2 GLU B 22 92.298 73.625 50.725 1.00 93.88 O
ATOM 3467 N ASP B 23 91.260 69.092 50.816 1.00 93.82 N
ATOM 3468 CA ASP B 23 91.378 68.012 51.787 1.00 94.23 C
ATOM 3469 C ASP B 23 90.626 68.294 53.070 1.00 93.40 C
ATOM 3470 O ASP B 23 90.474 69.445 53.473 1.00 93.76 O
ATOM 3471 CB ASP B 23 92.846 67.749 52.132 1.00 96.27 C
ATOM 3472 CG ASP B 23 93.592 67.029 51.022 1.00 97.73 C
ATOM 3473 OD1 ASP B 23 93.050 66.030 50.500 1.00 97.45 O
ATOM 3474 OD2 ASP B 23 94.723 67.454 50.681 1.00 98.81 O
ATOM 3475 N LEU B 24 90.171 67.224 53.710 1.00 91.82 N
ATOM 3476 CA LEU B 24 89.445 67.325 54.962 1.00 91.02 C
ATOM 3477 C LEU B 24 90.399 67.134 56.136 1.00 90.64 C
ATOM 3478 O LEU B 24 90.364 66.110 56.812 1.00 90.30 O
ATOM 3479 CB LEU B 24 88.331 66.274 54.999 1.00 90.45 C
ATOM 3480 CG LEU B 24 87.604 65.971 56.317 1.00 90.39 C
ATOM 3481 CD1 LEU B 24 87.151 67.237 57.016 1.00 90.38 C
ATOM 3482 CD2 LEU B 24 86.421 65.096 56.004 1.00 89.99 C
ATOM 3483 N GLU B 25 91.246 68.130 56.376 1.00 90.81 N
ATOM 3484 CA GLU B 25 92.217 68.076 57.467 1.00 91.57 C
ATOM 3485 C GLU B 25 91.557 67.804 58.820 1.00 90.82 C
ATOM 3486 O GLU B 25 90.331 67.772 58.920 1.00 90.63 O
ATOM 3487 CB GLU B 25 93.012 69.379 57.503 1.00 93.58 C
ATOM 3488 CG GLU B 25 93.650 69.709 56.157 1.00 97.83 C
ATOM 3489 CD GLU B 25 94.529 70.945 56.194 1.00100.41 C
ATOM 3490 OE1 GLU B 25 95.483 70.985 57.008 1.00101.21 O
ATOM 3491 OE2 GLU B 25 94.265 71.876 55.398 1.00102.27 O
ATOM 3492 N ILE B 26 92.364 67.604 59.859 1.00 90.00 N
ATOM 3493 CA ILE B 26 91.817 67.299 61.177 1.00 88.80 C
ATOM 3494 C ILE B 26 92.891 67.145 62.261 1.00 88.92 C
ATOM 3495 O ILE B 26 93.239 66.038 62.648 1.00 89.29 O
ATOM 3496 CB ILE B 26 90.952 66.010 61.091 1.00 87.77 C
ATOM 3497 CG1 ILE B 26 90.515 65.549 62.475 1.00 86.52 C
ATOM 3498 CG2 ILE B 26 91.723 64.919 60.370 1.00 88.70 C
ATOM 3499 CD1 ILE B 26 89.759 64.238 62.443 1.00 85.13 C
ATOM 3500 N THR B 27 93.405 68.269 62.751 1.00 89.46 N
ATOM 3501 CA THR B 27 94.432 68.281 63.794 1.00 89.96 C
ATOM 3502 C THR B 27 93.874 67.706 65.094 1.00 89.86 C
ATOM 3503 O THR B 27 92.771 67.168 65.109 1.00 89.49 O
ATOM 3504 CB THR B 27 94.925 69.729 64.050 1.00 90.89 C
ATOM 3505 OG1 THR B 27 95.381 70.298 62.816 1.00 92.98 O
ATOM 3506 CG2 THR B 27 96.076 69.751 65.047 1.00 91.73 C
ATOM 3507 N LYS B 28 94.646 67.805 66.175 1.00 90.45 N
ATOM 3508 CA LYS B 28 94.228 67.319 67.489 1.00 91.00 C
ATOM 3509 C LYS B 28 95.179 67.777 68.589 1.00 91.97 C
ATOM 3510 O LYS B 28 95.965 66.989 69.099 1.00 92.78 O
ATOM 3511 CB LYS B 28 94.138 65.791 67.509 1.00 89.05 C
ATOM 3512 CG LYS B 28 93.724 65.241 68.867 1.00 88.37 C
ATOM 3513 CD LYS B 28 93.412 63.755 68.807 1.00 88.45 C
ATOM 3514 CE LYS B 28 92.927 63.228 70.156 1.00 87.71 C
ATOM 3515 NZ LYS B 28 92.487 61.805 70.075 1.00 86.45 N
ATOM 3516 N LEU B 29 95.091 69.050 68.958 1.00 93.01 N
ATOM 3517 CA LEU B 29 95.939 69.629 69.998 1.00 94.26 C
ATOM 3518 C LEU B 29 96.275 68.701 71.167 1.00 94.28 C
ATOM 3519 O LEU B 29 95.565 67.732 71.443 1.00 93.20 O
ATOM 3520 CB LEU B 29 95.295 70.906 70.550 1.00 95.56 C
ATOM 3521 CG LEU B 29 95.163 72.101 69.602 1.00 96.90 C
ATOM 3522 CD1 LEU B 29 94.527 73.253 70.361 1.00 96.73 C
ATOM 3523 CD2 LEU B 29 96.533 72.515 69.059 1.00 97.69 C
ATOM 3524 N PRO B 30 97.373 69.005 71.879 1.00 95.00 N
ATOM 3525 CA PRO B 30 97.831 68.221 73.029 1.00 95.11 C
ATOM 3526 C PRO B 30 96.821 68.094 74.168 1.00 95.26 C
ATOM 3527 O PRO B 30 96.795 67.078 74.864 1.00 95.42 O
ATOM 3528 CB PRO B 30 99.104 68.953 73.463 1.00 95.76 C
ATOM 3529 CG PRO B 30 98.873 70.371 73.003 1.00 95.73 C
ATOM 3530 CD PRO B 30 98.276 70.148 71.638 1.00 95.55 C
ATOM 3531 N ASN B 31 95.988 69.112 74.366 1.00 94.88 N
ATOM 3532 CA ASN B 31 95.010 69.051 75.446 1.00 94.37 C
ATOM 3533 C ASN B 31 93.811 68.163 75.125 1.00 93.34 C
ATOM 3534 O ASN B 31 92.916 68.004 75.951 1.00 93.83 O
ATOM 3535 CB ASN B 31 94.530 70.453 75.823 1.00 95.27 C
ATOM 3536 CG ASN B 31 93.629 71.064 74.781 1.00 95.81 C
ATOM 3537 OD1 ASN B 31 93.166 72.193 74.943 1.00 97.25 O
ATOM 3538 ND2 ASN B 31 93.371 70.329 73.707 1.00 95.03 N
ATOM 3539 N GLY B 32 93.794 67.588 73.926 1.00 92.06 N
ATOM 3540 CA GLY B 32 92.701 66.710 73.548 1.00 90.62 C
ATOM 3541 C GLY B 32 91.665 67.328 72.627 1.00 90.09 C
ATOM 3542 O GLY B 32 90.813 66.625 72.082 1.00 89.82 O
ATOM 3543 N LEU B 33 91.719 68.643 72.458 1.00 89.48 N
ATOM 3544 CA LEU B 33 90.771 69.325 71.586 1.00 88.89 C
ATOM 3545 C LEU B 33 90.971 68.877 70.144 1.00 88.73 C
ATOM 3546 O LEU B 33 92.084 68.916 69.623 1.00 89.23 O
ATOM 3547 CB LEU B 33 90.962 70.838 71.669 1.00 88.74 C
ATOM 3548 CG LEU B 33 90.094 71.647 70.708 1.00 87.61 C
ATOM 3549 CD1 LEU B 33 88.628 71.449 71.055 1.00 88.22 C
ATOM 3550 CD2 LEU B 33 90.471 73.106 70.798 1.00 87.70 C
ATOM 3551 N ILE B 34 89.893 68.455 69.497 1.00 87.64 N
ATOM 3552 CA ILE B 34 89.982 68.005 68.116 1.00 86.21 C
ATOM 3553 C ILE B 34 89.547 69.119 67.179 1.00 85.26 C
ATOM 3554 O ILE B 34 88.579 69.821 67.450 1.00 86.09 O
ATOM 3555 CB ILE B 34 89.116 66.749 67.898 1.00 86.55 C
ATOM 3556 CG1 ILE B 34 89.692 65.597 68.729 1.00 87.44 C
ATOM 3557 CG2 ILE B 34 89.061 66.390 66.419 1.00 84.91 C
ATOM 3558 CD1 ILE B 34 88.844 64.347 68.750 1.00 88.80 C
ATOM 3559 N ILE B 35 90.277 69.281 66.081 1.00 83.76 N
ATOM 3560 CA ILE B 35 89.986 70.319 65.103 1.00 82.19 C
ATOM 3561 C ILE B 35 89.841 69.731 63.716 1.00 81.41 C
ATOM 3562 O ILE B 35 90.814 69.258 63.146 1.00 81.87 O
ATOM 3563 CB ILE B 35 91.119 71.347 65.042 1.00 82.49 C
ATOM 3564 CG1 ILE B 35 91.354 71.946 66.427 1.00 84.06 C
ATOM 3565 CG2 ILE B 35 90.779 72.430 64.041 1.00 82.35 C
ATOM 3566 CD1 ILE B 35 92.532 72.894 66.485 1.00 85.67 C
ATOM 3567 N ALA B 36 88.632 69.766 63.168 1.00 80.72 N
ATOM 3568 CA ALA B 36 88.395 69.238 61.828 1.00 80.38 C
ATOM 3569 C ALA B 36 87.857 70.347 60.934 1.00 80.43 C
ATOM 3570 O ALA B 36 86.880 70.997 61.278 1.00 81.92 O
ATOM 3571 CB ALA B 36 87.408 68.092 61.889 1.00 78.91 C
ATOM 3572 N SER B 37 88.495 70.581 59.795 1.00 80.60 N
ATOM 3573 CA SER B 37 88.025 71.625 58.894 1.00 81.12 C
ATOM 3574 C SER B 37 87.841 71.057 57.501 1.00 81.09 C
ATOM 3575 O SER B 37 88.109 69.891 57.263 1.00 80.63 O
ATOM 3576 CB SER B 37 89.016 72.790 58.834 1.00 81.62 C
ATOM 3577 OG SER B 37 89.986 72.572 57.826 1.00 83.41 O
ATOM 3578 N LEU B 38 87.378 71.890 56.581 1.00 82.16 N
ATOM 3579 CA LEU B 38 87.162 71.463 55.207 1.00 82.67 C
ATOM 3580 C LEU B 38 86.757 72.632 54.331 1.00 82.84 C
ATOM 3581 O LEU B 38 85.724 73.252 54.550 1.00 84.16 O
ATOM 3582 CB LEU B 38 86.081 70.381 55.135 1.00 81.78 C
ATOM 3583 CG LEU B 38 85.475 70.167 53.740 1.00 83.23 C
ATOM 3584 CD1 LEU B 38 86.552 69.886 52.698 1.00 82.57 C
ATOM 3585 CD2 LEU B 38 84.498 69.018 53.805 1.00 83.11 C
ATOM 3586 N GLU B 39 87.578 72.930 53.337 1.00 83.38 N
ATOM 3587 CA GLU B 39 87.286 74.018 52.421 1.00 83.62 C
ATOM 3588 C GLU B 39 86.496 73.487 51.228 1.00 83.40 C
ATOM 3589 O GLU B 39 86.945 72.591 50.520 1.00 83.42 O
ATOM 3590 CB GLU B 39 88.587 74.660 51.939 1.00 83.61 C
ATOM 3591 CG GLU B 39 88.395 75.759 50.915 1.00 83.87 C
ATOM 3592 CD GLU B 39 87.486 76.851 51.422 1.00 84.94 C
ATOM 3593 OE1 GLU B 39 86.251 76.664 51.378 1.00 84.63 O
ATOM 3594 OE2 GLU B 39 88.009 77.888 51.882 1.00 84.95 O
ATOM 3595 N ASN B 40 85.304 74.024 51.021 1.00 83.72 N
ATOM 3596 CA ASN B 40 84.486 73.602 49.895 1.00 84.06 C
ATOM 3597 C ASN B 40 84.230 74.823 49.047 1.00 84.39 C
ATOM 3598 O ASN B 40 83.433 74.793 48.114 1.00 83.58 O
ATOM 3599 CB ASN B 40 83.163 73.021 50.373 1.00 84.01 C
ATOM 3600 CG ASN B 40 82.504 73.878 51.414 1.00 83.94 C
ATOM 3601 OD1 ASN B 40 82.903 75.019 51.646 1.00 83.25 O
ATOM 3602 ND2 ASN B 40 81.481 73.335 52.051 1.00 84.80 N
ATOM 3603 N PHE B 41 84.925 75.901 49.395 1.00 86.03 N
ATOM 3604 CA PHE B 41 84.824 77.174 48.693 1.00 87.88 C
ATOM 3605 C PHE B 41 83.399 77.731 48.606 1.00 87.52 C
ATOM 3606 O PHE B 41 83.111 78.612 47.789 1.00 87.67 O
ATOM 3607 CB PHE B 41 85.444 77.049 47.293 1.00 89.53 C
ATOM 3608 CG PHE B 41 86.922 76.758 47.313 1.00 92.53 C
ATOM 3609 CD1 PHE B 41 87.415 75.543 46.842 1.00 93.12 C
ATOM 3610 CD2 PHE B 41 87.820 77.687 47.840 1.00 93.75 C
ATOM 3611 CE1 PHE B 41 88.780 75.258 46.897 1.00 94.47 C
ATOM 3612 CE2 PHE B 41 89.186 77.410 47.898 1.00 94.35 C
ATOM 3613 CZ PHE B 41 89.666 76.193 47.426 1.00 94.82 C
ATOM 3614 N SER B 42 82.510 77.216 49.451 1.00 86.62 N
ATOM 3615 CA SER B 42 81.132 77.690 49.487 1.00 84.79 C
ATOM 3616 C SER B 42 81.154 79.127 49.986 1.00 83.44 C
ATOM 3617 O SER B 42 81.956 79.474 50.852 1.00 83.83 O
ATOM 3618 CB SER B 42 80.292 76.843 50.440 1.00 85.12 C
ATOM 3619 OG SER B 42 79.058 77.482 50.714 1.00 84.74 O
ATOM 3620 N PRO B 43 80.276 79.983 49.446 1.00 81.44 N
ATOM 3621 CA PRO B 43 80.250 81.380 49.886 1.00 80.30 C
ATOM 3622 C PRO B 43 79.854 81.534 51.354 1.00 79.95 C
ATOM 3623 O PRO B 43 79.971 82.614 51.932 1.00 79.05 O
ATOM 3624 CB PRO B 43 79.250 82.021 48.926 1.00 79.68 C
ATOM 3625 CG PRO B 43 78.336 80.886 48.582 1.00 79.79 C
ATOM 3626 CD PRO B 43 79.274 79.737 48.396 1.00 79.59 C
ATOM 3627 N ALA B 44 79.407 80.440 51.959 1.00 79.99 N
ATOM 3628 CA ALA B 44 78.988 80.468 53.347 1.00 80.21 C
ATOM 3629 C ALA B 44 79.770 79.480 54.198 1.00 80.63 C
ATOM 3630 O ALA B 44 79.978 78.332 53.804 1.00 81.41 O
ATOM 3631 CB ALA B 44 77.503 80.163 53.436 1.00 80.20 C
ATOM 3632 N SER B 45 80.192 79.934 55.372 1.00 79.92 N
ATOM 3633 CA SER B 45 80.933 79.100 56.305 1.00 79.43 C
ATOM 3634 C SER B 45 80.007 78.704 57.445 1.00 79.31 C
ATOM 3635 O SER B 45 79.122 79.459 57.816 1.00 80.19 O
ATOM 3636 CB SER B 45 82.119 79.873 56.872 1.00 79.18 C
ATOM 3637 OG SER B 45 82.885 80.441 55.829 1.00 81.50 O
ATOM 3638 N ARG B 46 80.211 77.526 58.007 1.00 79.16 N
ATOM 3639 CA ARG B 46 79.377 77.074 59.106 1.00 78.91 C
ATOM 3640 C ARG B 46 80.233 76.375 60.145 1.00 78.37 C
ATOM 3641 O ARG B 46 80.443 75.166 60.077 1.00 79.96 O
ATOM 3642 CB ARG B 46 78.295 76.124 58.594 1.00 80.28 C
ATOM 3643 CG ARG B 46 77.421 75.509 59.684 1.00 82.12 C
ATOM 3644 CD ARG B 46 76.243 74.777 59.047 1.00 84.32 C
ATOM 3645 NE ARG B 46 75.480 73.941 59.976 1.00 85.59 N
ATOM 3646 CZ ARG B 46 74.606 74.389 60.873 1.00 85.21 C
ATOM 3647 NH1 ARG B 46 74.364 75.689 60.983 1.00 84.94 N
ATOM 3648 NH2 ARG B 46 73.963 73.523 61.652 1.00 85.19 N
ATOM 3649 N ILE B 47 80.725 77.148 61.105 1.00 76.45 N
ATOM 3650 CA ILE B 47 81.566 76.631 62.175 1.00 73.21 C
ATOM 3651 C ILE B 47 80.697 76.106 63.307 1.00 72.57 C
ATOM 3652 O ILE B 47 79.547 76.499 63.438 1.00 74.33 O
ATOM 3653 CB ILE B 47 82.481 77.738 62.700 1.00 71.37 C
ATOM 3654 CG1 ILE B 47 83.241 78.343 61.525 1.00 70.30 C
ATOM 3655 CG2 ILE B 47 83.458 77.187 63.717 1.00 70.78 C
ATOM 3656 CD1 ILE B 47 83.958 79.597 61.859 1.00 68.34 C
ATOM 3657 N GLY B 48 81.249 75.206 64.113 1.00 71.51 N
ATOM 3658 CA GLY B 48 80.509 74.641 65.223 1.00 68.06 C
ATOM 3659 C GLY B 48 81.412 74.084 66.311 1.00 66.42 C
ATOM 3660 O GLY B 48 82.567 73.731 66.067 1.00 67.73 O
ATOM 3661 N VAL B 49 80.881 74.015 67.524 1.00 63.18 N
ATOM 3662 CA VAL B 49 81.608 73.495 68.669 1.00 59.90 C
ATOM 3663 C VAL B 49 80.865 72.269 69.194 1.00 59.27 C
ATOM 3664 O VAL B 49 79.920 72.394 69.968 1.00 60.04 O
ATOM 3665 CB VAL B 49 81.707 74.563 69.776 1.00 58.24 C
ATOM 3666 CG1 VAL B 49 82.249 73.957 71.054 1.00 56.94 C
ATOM 3667 CG2 VAL B 49 82.588 75.699 69.304 1.00 56.40 C
ATOM 3668 N PHE B 50 81.277 71.085 68.756 1.00 58.05 N
ATOM 3669 CA PHE B 50 80.634 69.859 69.203 1.00 58.11 C
ATOM 3670 C PHE B 50 81.130 69.509 70.592 1.00 59.93 C
ATOM 3671 O PHE B 50 82.287 69.737 70.911 1.00 61.43 O
ATOM 3672 CB PHE B 50 80.919 68.730 68.224 1.00 55.36 C
ATOM 3673 CG PHE B 50 80.351 68.972 66.852 1.00 54.39 C
ATOM 3674 CD1 PHE B 50 80.855 69.992 66.044 1.00 52.82 C
ATOM 3675 CD2 PHE B 50 79.285 68.207 66.383 1.00 52.48 C
ATOM 3676 CE1 PHE B 50 80.302 70.247 64.787 1.00 53.14 C
ATOM 3677 CE2 PHE B 50 78.724 68.450 65.132 1.00 52.70 C
ATOM 3678 CZ PHE B 50 79.232 69.473 64.329 1.00 53.35 C
ATOM 3679 N ILE B 51 80.251 68.975 71.430 1.00 61.72 N
ATOM 3680 CA ILE B 51 80.629 68.637 72.792 1.00 63.47 C
ATOM 3681 C ILE B 51 79.875 67.421 73.308 1.00 66.51 C
ATOM 3682 O ILE B 51 78.720 67.197 72.954 1.00 66.80 O
ATOM 3683 CB ILE B 51 80.330 69.793 73.736 1.00 62.45 C
ATOM 3684 CG1 ILE B 51 80.895 71.089 73.166 1.00 61.74 C
ATOM 3685 CG2 ILE B 51 80.916 69.497 75.101 1.00 63.36 C
ATOM 3686 CD1 ILE B 51 80.474 72.324 73.923 1.00 61.94 C
ATOM 3687 N LYS B 52 80.535 66.639 74.152 1.00 69.87 N
ATOM 3688 CA LYS B 52 79.912 65.460 74.732 1.00 73.14 C
ATOM 3689 C LYS B 52 79.235 65.901 76.025 1.00 74.71 C
ATOM 3690 O LYS B 52 79.792 65.740 77.111 1.00 75.93 O
ATOM 3691 CB LYS B 52 80.960 64.380 75.041 1.00 74.06 C
ATOM 3692 CG LYS B 52 81.769 63.921 73.844 1.00 75.54 C
ATOM 3693 CD LYS B 52 82.670 62.756 74.226 1.00 77.34 C
ATOM 3694 CE LYS B 52 83.522 62.274 73.053 1.00 77.87 C
ATOM 3695 NZ LYS B 52 84.352 61.106 73.447 1.00 77.63 N
ATOM 3696 N ALA B 53 78.043 66.475 75.904 1.00 75.56 N
ATOM 3697 CA ALA B 53 77.294 66.935 77.069 1.00 75.65 C
ATOM 3698 C ALA B 53 75.820 66.657 76.821 1.00 75.30 C
ATOM 3699 O ALA B 53 75.443 66.297 75.708 1.00 75.51 O
ATOM 3700 CB ALA B 53 77.528 68.424 77.285 1.00 75.88 C
ATOM 3701 N GLY B 54 74.988 66.809 77.847 1.00 74.53 N
ATOM 3702 CA GLY B 54 73.573 66.550 77.664 1.00 73.46 C
ATOM 3703 C GLY B 54 72.861 66.146 78.933 1.00 73.09 C
ATOM 3704 O GLY B 54 73.472 66.032 79.986 1.00 72.25 O
ATOM 3705 N SER B 55 71.556 65.937 78.828 1.00 74.25 N
ATOM 3706 CA SER B 55 70.745 65.545 79.975 1.00 75.85 C
ATOM 3707 C SER B 55 71.253 64.240 80.581 1.00 76.00 C
ATOM 3708 O SER B 55 70.951 63.908 81.732 1.00 75.39 O
ATOM 3709 CB SER B 55 69.287 65.384 79.537 1.00 77.04 C
ATOM 3710 OG SER B 55 69.189 64.531 78.402 1.00 76.09 O
ATOM 3711 N ARG B 56 72.017 63.509 79.779 1.00 76.48 N
ATOM 3712 CA ARG B 56 72.608 62.236 80.167 1.00 77.62 C
ATOM 3713 C ARG B 56 73.477 62.373 81.427 1.00 77.76 C
ATOM 3714 O ARG B 56 73.460 61.510 82.311 1.00 77.39 O
ATOM 3715 CB ARG B 56 73.446 61.724 78.994 1.00 78.48 C
ATOM 3716 CG ARG B 56 74.296 60.518 79.270 1.00 80.32 C
ATOM 3717 CD ARG B 56 75.133 60.187 78.047 1.00 81.20 C
ATOM 3718 NE ARG B 56 75.893 58.959 78.236 1.00 83.96 N
ATOM 3719 CZ ARG B 56 75.358 57.802 78.614 1.00 84.98 C
ATOM 3720 NH1 ARG B 56 74.057 57.709 78.846 1.00 85.93 N
ATOM 3721 NH2 ARG B 56 76.123 56.735 78.765 1.00 86.61 N
ATOM 3722 N TYR B 57 74.219 63.473 81.505 1.00 77.63 N
ATOM 3723 CA TYR B 57 75.106 63.747 82.627 1.00 77.65 C
ATOM 3724 C TYR B 57 74.423 64.421 83.819 1.00 78.23 C
ATOM 3725 O TYR B 57 75.064 64.725 84.826 1.00 79.35 O
ATOM 3726 CB TYR B 57 76.275 64.605 82.147 1.00 77.59 C
ATOM 3727 CG TYR B 57 77.021 63.980 80.995 1.00 78.69 C
ATOM 3728 CD1 TYR B 57 76.430 63.865 79.737 1.00 79.41 C
ATOM 3729 CD2 TYR B 57 78.301 63.457 81.169 1.00 79.29 C
ATOM 3730 CE1 TYR B 57 77.090 63.242 78.681 1.00 80.24 C
ATOM 3731 CE2 TYR B 57 78.972 62.828 80.117 1.00 79.87 C
ATOM 3732 CZ TYR B 57 78.357 62.723 78.877 1.00 80.00 C
ATOM 3733 OH TYR B 57 78.994 62.082 77.839 1.00 80.01 O
ATOM 3734 N GLU B 58 73.125 64.663 83.713 1.00 78.49 N
ATOM 3735 CA GLU B 58 72.402 65.292 84.809 1.00 78.26 C
ATOM 3736 C GLU B 58 72.078 64.211 85.815 1.00 76.19 C
ATOM 3737 O GLU B 58 72.075 63.032 85.481 1.00 75.87 O
ATOM 3738 CB GLU B 58 71.082 65.905 84.319 1.00 80.67 C
ATOM 3739 CG GLU B 58 71.189 67.164 83.448 1.00 83.35 C
ATOM 3740 CD GLU B 58 69.861 67.501 82.767 1.00 85.32 C
ATOM 3741 OE1 GLU B 58 68.812 66.976 83.211 1.00 87.13 O
ATOM 3742 OE2 GLU B 58 69.857 68.290 81.797 1.00 85.85 O
ATOM 3743 N THR B 59 71.822 64.616 87.048 1.00 74.35 N
ATOM 3744 CA THR B 59 71.435 63.676 88.084 1.00 73.42 C
ATOM 3745 C THR B 59 70.134 64.253 88.613 1.00 72.33 C
ATOM 3746 O THR B 59 69.752 65.361 88.241 1.00 72.34 O
ATOM 3747 CB THR B 59 72.455 63.608 89.233 1.00 74.53 C
ATOM 3748 OG1 THR B 59 72.330 64.766 90.071 1.00 75.19 O
ATOM 3749 CG2 THR B 59 73.858 63.544 88.675 1.00 74.76 C
ATOM 3750 N THR B 60 69.460 63.518 89.483 1.00 70.53 N
ATOM 3751 CA THR B 60 68.198 63.979 90.027 1.00 69.28 C
ATOM 3752 C THR B 60 68.262 65.452 90.441 1.00 68.26 C
ATOM 3753 O THR B 60 67.395 66.258 90.079 1.00 69.12 O
ATOM 3754 CB THR B 60 67.787 63.117 91.246 1.00 70.10 C
ATOM 3755 OG1 THR B 60 66.366 63.158 91.403 1.00 71.85 O
ATOM 3756 CG2 THR B 60 68.441 63.632 92.532 1.00 70.20 C
ATOM 3757 N ALA B 61 69.316 65.800 91.170 1.00 66.04 N
ATOM 3758 CA ALA B 61 69.498 67.149 91.691 1.00 63.16 C
ATOM 3759 C ALA B 61 69.528 68.296 90.691 1.00 61.58 C
ATOM 3760 O ALA B 61 69.054 69.389 90.998 1.00 61.52 O
ATOM 3761 CB ALA B 61 70.743 67.190 92.539 1.00 63.19 C
ATOM 3762 N ASN B 62 70.083 68.073 89.507 1.00 58.61 N
ATOM 3763 CA ASN B 62 70.152 69.151 88.540 1.00 55.91 C
ATOM 3764 C ASN B 62 69.414 68.893 87.224 1.00 56.17 C
ATOM 3765 O ASN B 62 69.737 69.496 86.200 1.00 55.01 O
ATOM 3766 CB ASN B 62 71.625 69.526 88.293 1.00 54.85 C
ATOM 3767 CG ASN B 62 72.410 68.463 87.519 1.00 55.41 C
ATOM 3768 OD1 ASN B 62 72.128 67.261 87.583 1.00 56.65 O
ATOM 3769 ND2 ASN B 62 73.428 68.915 86.797 1.00 54.52 N
ATOM 3770 N LEU B 63 68.404 68.020 87.264 1.00 56.28 N
ATOM 3771 CA LEU B 63 67.602 67.690 86.076 1.00 55.83 C
ATOM 3772 C LEU B 63 67.202 68.950 85.323 1.00 56.29 C
ATOM 3773 O LEU B 63 66.948 69.990 85.930 1.00 56.38 O
ATOM 3774 CB LEU B 63 66.334 66.929 86.472 1.00 54.49 C
ATOM 3775 CG LEU B 63 66.470 65.477 86.938 1.00 54.10 C
ATOM 3776 CD1 LEU B 63 65.182 65.003 87.586 1.00 54.54 C
ATOM 3777 CD2 LEU B 63 66.813 64.603 85.755 1.00 53.24 C
ATOM 3778 N GLY B 64 67.154 68.845 83.997 1.00 57.15 N
ATOM 3779 CA GLY B 64 66.787 69.972 83.156 1.00 57.18 C
ATOM 3780 C GLY B 64 67.830 71.069 82.990 1.00 57.75 C
ATOM 3781 O GLY B 64 67.676 71.951 82.139 1.00 58.99 O
ATOM 3782 N THR B 65 68.894 71.031 83.784 1.00 57.34 N
ATOM 3783 CA THR B 65 69.924 72.060 83.694 1.00 57.69 C
ATOM 3784 C THR B 65 70.544 72.152 82.288 1.00 57.38 C
ATOM 3785 O THR B 65 70.920 73.240 81.836 1.00 59.05 O
ATOM 3786 CB THR B 65 71.013 71.825 84.747 1.00 57.26 C
ATOM 3787 OG1 THR B 65 71.974 72.880 84.696 1.00 57.66 O
ATOM 3788 CG2 THR B 65 71.705 70.525 84.481 1.00 61.80 C
ATOM 3789 N ALA B 66 70.631 71.029 81.582 1.00 56.54 N
ATOM 3790 CA ALA B 66 71.190 71.041 80.231 1.00 56.14 C
ATOM 3791 C ALA B 66 70.224 71.693 79.238 1.00 57.19 C
ATOM 3792 O ALA B 66 70.656 72.264 78.231 1.00 58.37 O
ATOM 3793 CB ALA B 66 71.521 69.629 79.779 1.00 55.04 C
ATOM 3794 N HIS B 67 68.920 71.594 79.506 1.00 56.34 N
ATOM 3795 CA HIS B 67 67.918 72.212 78.642 1.00 54.85 C
ATOM 3796 C HIS B 67 68.065 73.730 78.754 1.00 54.19 C
ATOM 3797 O HIS B 67 68.207 74.429 77.746 1.00 52.85 O
ATOM 3798 CB HIS B 67 66.506 71.787 79.071 1.00 57.15 C
ATOM 3799 CG HIS B 67 65.397 72.441 78.291 1.00 58.56 C
ATOM 3800 ND1 HIS B 67 64.064 72.230 78.579 1.00 57.61 N
ATOM 3801 CD2 HIS B 67 65.421 73.320 77.257 1.00 58.27 C
ATOM 3802 CE1 HIS B 67 63.319 72.953 77.762 1.00 57.10 C
ATOM 3803 NE2 HIS B 67 64.117 73.624 76.951 1.00 56.78 N
ATOM 3804 N LEU B 68 68.030 74.235 79.985 1.00 53.26 N
ATOM 3805 CA LEU B 68 68.175 75.667 80.222 1.00 53.52 C
ATOM 3806 C LEU B 68 69.483 76.216 79.644 1.00 53.96 C
ATOM 3807 O LEU B 68 69.541 77.344 79.142 1.00 53.15 O
ATOM 3808 CB LEU B 68 68.129 75.959 81.722 1.00 52.48 C
ATOM 3809 CG LEU B 68 68.327 77.440 82.057 1.00 52.34 C
ATOM 3810 CD1 LEU B 68 67.382 78.274 81.227 1.00 53.10 C
ATOM 3811 CD2 LEU B 68 68.086 77.685 83.530 1.00 52.89 C
ATOM 3812 N LEU B 69 70.538 75.416 79.737 1.00 54.92 N
ATOM 3813 CA LEU B 69 71.840 75.816 79.227 1.00 56.11 C
ATOM 3814 C LEU B 69 71.767 76.018 77.713 1.00 56.32 C
ATOM 3815 O LEU B 69 72.446 76.878 77.143 1.00 56.43 O
ATOM 3816 CB LEU B 69 72.873 74.746 79.584 1.00 55.77 C
ATOM 3817 CG LEU B 69 74.304 74.927 79.066 1.00 56.48 C
ATOM 3818 CD1 LEU B 69 74.861 76.298 79.445 1.00 54.10 C
ATOM 3819 CD2 LEU B 69 75.162 73.804 79.628 1.00 57.07 C
ATOM 3820 N ARG B 70 70.936 75.210 77.073 1.00 56.95 N
ATOM 3821 CA ARG B 70 70.727 75.273 75.632 1.00 58.18 C
ATOM 3822 C ARG B 70 70.100 76.631 75.269 1.00 59.08 C
ATOM 3823 O ARG B 70 70.454 77.256 74.255 1.00 59.01 O
ATOM 3824 CB ARG B 70 69.806 74.115 75.217 1.00 57.98 C
ATOM 3825 CG ARG B 70 69.413 74.114 73.769 1.00 59.20 C
ATOM 3826 CD ARG B 70 68.879 72.753 73.310 1.00 61.25 C
ATOM 3827 NE ARG B 70 67.567 72.368 73.838 1.00 61.16 N
ATOM 3828 CZ ARG B 70 67.384 71.465 74.797 1.00 63.06 C
ATOM 3829 NH1 ARG B 70 68.432 70.858 75.346 1.00 64.50 N
ATOM 3830 NH2 ARG B 70 66.156 71.137 75.184 1.00 62.46 N
ATOM 3831 N LEU B 71 69.179 77.084 76.120 1.00 57.81 N
ATOM 3832 CA LEU B 71 68.487 78.349 75.917 1.00 56.73 C
ATOM 3833 C LEU B 71 69.305 79.544 76.377 1.00 56.54 C
ATOM 3834 O LEU B 71 69.013 80.680 75.998 1.00 56.99 O
ATOM 3835 CB LEU B 71 67.164 78.370 76.688 1.00 56.19 C
ATOM 3836 CG LEU B 71 66.114 77.287 76.439 1.00 56.68 C
ATOM 3837 CD1 LEU B 71 64.939 77.529 77.386 1.00 55.39 C
ATOM 3838 CD2 LEU B 71 65.674 77.284 74.977 1.00 53.17 C
ATOM 3839 N ALA B 72 70.314 79.297 77.208 1.00 55.79 N
ATOM 3840 CA ALA B 72 71.132 80.381 77.736 1.00 55.02 C
ATOM 3841 C ALA B 72 72.203 80.885 76.784 1.00 56.05 C
ATOM 3842 O ALA B 72 72.982 81.765 77.140 1.00 56.79 O
ATOM 3843 CB ALA B 72 71.756 79.957 79.042 1.00 54.10 C
ATOM 3844 N SER B 73 72.240 80.346 75.571 1.00 57.33 N
ATOM 3845 CA SER B 73 73.234 80.771 74.591 1.00 60.63 C
ATOM 3846 C SER B 73 73.309 82.278 74.344 1.00 62.48 C
ATOM 3847 O SER B 73 74.383 82.802 74.040 1.00 63.71 O
ATOM 3848 CB SER B 73 73.019 80.044 73.256 1.00 61.98 C
ATOM 3849 OG SER B 73 71.643 79.925 72.929 1.00 66.15 O
ATOM 3850 N PRO B 74 72.177 83.000 74.466 1.00 64.37 N
ATOM 3851 CA PRO B 74 72.244 84.448 74.225 1.00 63.96 C
ATOM 3852 C PRO B 74 72.576 85.342 75.418 1.00 62.70 C
ATOM 3853 O PRO B 74 72.660 86.558 75.253 1.00 63.36 O
ATOM 3854 CB PRO B 74 70.869 84.756 73.632 1.00 64.29 C
ATOM 3855 CG PRO B 74 69.984 83.829 74.394 1.00 64.76 C
ATOM 3856 CD PRO B 74 70.777 82.530 74.391 1.00 64.93 C
ATOM 3857 N LEU B 75 72.768 84.757 76.601 1.00 61.86 N
ATOM 3858 CA LEU B 75 73.093 85.539 77.800 1.00 61.57 C
ATOM 3859 C LEU B 75 74.477 86.184 77.710 1.00 62.75 C
ATOM 3860 O LEU B 75 75.287 85.802 76.862 1.00 62.49 O
ATOM 3861 CB LEU B 75 72.994 84.660 79.044 1.00 59.49 C
ATOM 3862 CG LEU B 75 71.567 84.158 79.261 1.00 59.67 C
ATOM 3863 CD1 LEU B 75 71.503 83.234 80.464 1.00 59.62 C
ATOM 3864 CD2 LEU B 75 70.653 85.351 79.454 1.00 60.29 C
ATOM 3865 N THR B 76 74.754 87.161 78.574 1.00 65.28 N
ATOM 3866 CA THR B 76 76.051 87.842 78.519 1.00 67.32 C
ATOM 3867 C THR B 76 77.211 86.955 78.962 1.00 69.07 C
ATOM 3868 O THR B 76 77.072 86.076 79.823 1.00 69.05 O
ATOM 3869 CB THR B 76 76.093 89.149 79.366 1.00 66.37 C
ATOM 3870 OG1 THR B 76 76.241 88.820 80.749 1.00 66.93 O
ATOM 3871 CG2 THR B 76 74.830 89.962 79.179 1.00 66.04 C
ATOM 3872 N THR B 77 78.359 87.206 78.345 1.00 70.58 N
ATOM 3873 CA THR B 77 79.584 86.472 78.602 1.00 71.32 C
ATOM 3874 C THR B 77 80.612 87.466 79.107 1.00 72.43 C
ATOM 3875 O THR B 77 80.312 88.652 79.251 1.00 73.91 O
ATOM 3876 CB THR B 77 80.107 85.836 77.307 1.00 71.29 C
ATOM 3877 OG1 THR B 77 80.235 86.851 76.301 1.00 70.50 O
ATOM 3878 CG2 THR B 77 79.144 84.766 76.814 1.00 71.10 C
ATOM 3879 N LYS B 78 81.826 86.993 79.366 1.00 72.68 N
ATOM 3880 CA LYS B 78 82.879 87.874 79.857 1.00 72.18 C
ATOM 3881 C LYS B 78 83.398 88.756 78.731 1.00 70.19 C
ATOM 3882 O LYS B 78 83.924 89.838 78.973 1.00 69.75 O
ATOM 3883 CB LYS B 78 84.019 87.046 80.456 1.00 74.58 C
ATOM 3884 CG LYS B 78 83.602 86.241 81.682 1.00 77.11 C
ATOM 3885 CD LYS B 78 84.656 85.210 82.076 1.00 79.60 C
ATOM 3886 CE LYS B 78 84.165 84.342 83.231 1.00 81.13 C
ATOM 3887 NZ LYS B 78 85.119 83.242 83.558 1.00 83.16 N
ATOM 3888 N GLY B 79 83.221 88.301 77.498 1.00 68.41 N
ATOM 3889 CA GLY B 79 83.703 89.067 76.368 1.00 67.09 C
ATOM 3890 C GLY B 79 82.652 89.834 75.596 1.00 66.85 C
ATOM 3891 O GLY B 79 82.961 90.821 74.928 1.00 66.72 O
ATOM 3892 N ALA B 80 81.406 89.389 75.669 1.00 66.40 N
ATOM 3893 CA ALA B 80 80.346 90.069 74.945 1.00 65.38 C
ATOM 3894 C ALA B 80 79.086 90.112 75.782 1.00 65.21 C
ATOM 3895 O ALA B 80 78.819 89.196 76.560 1.00 65.56 O
ATOM 3896 CB ALA B 80 80.077 89.357 73.618 1.00 63.39 C
ATOM 3897 N SER B 81 78.315 91.183 75.631 1.00 64.86 N
ATOM 3898 CA SER B 81 77.068 91.315 76.368 1.00 64.00 C
ATOM 3899 C SER B 81 75.936 90.706 75.556 1.00 63.63 C
ATOM 3900 O SER B 81 76.002 90.615 74.321 1.00 62.12 O
ATOM 3901 CB SER B 81 76.749 92.785 76.642 1.00 64.64 C
ATOM 3902 OG SER B 81 76.505 93.488 75.433 1.00 65.22 O
ATOM 3903 N SER B 82 74.898 90.292 76.274 1.00 63.69 N
ATOM 3904 CA SER B 82 73.701 89.696 75.686 1.00 62.72 C
ATOM 3905 C SER B 82 73.277 90.510 74.464 1.00 62.00 C
ATOM 3906 O SER B 82 72.906 89.965 73.416 1.00 61.26 O
ATOM 3907 CB SER B 82 72.585 89.700 76.731 1.00 61.67 C
ATOM 3908 OG SER B 82 71.417 89.096 76.231 1.00 64.05 O
ATOM 3909 N PHE B 83 73.348 91.827 74.631 1.00 61.23 N
ATOM 3910 CA PHE B 83 72.995 92.782 73.599 1.00 60.31 C
ATOM 3911 C PHE B 83 73.895 92.659 72.375 1.00 61.51 C
ATOM 3912 O PHE B 83 73.397 92.540 71.244 1.00 61.35 O
ATOM 3913 CB PHE B 83 73.087 94.202 74.165 1.00 59.43 C
ATOM 3914 CG PHE B 83 72.884 95.279 73.141 1.00 59.84 C
ATOM 3915 CD1 PHE B 83 71.628 95.519 72.598 1.00 59.40 C
ATOM 3916 CD2 PHE B 83 73.960 96.034 72.688 1.00 60.11 C
ATOM 3917 CE1 PHE B 83 71.446 96.494 71.614 1.00 58.95 C
ATOM 3918 CE2 PHE B 83 73.787 97.010 71.704 1.00 60.13 C
ATOM 3919 CZ PHE B 83 72.526 97.238 71.167 1.00 59.10 C
ATOM 3920 N ARG B 84 75.214 92.675 72.590 1.00 62.04 N
ATOM 3921 CA ARG B 84 76.145 92.600 71.463 1.00 61.88 C
ATOM 3922 C ARG B 84 76.200 91.246 70.780 1.00 59.25 C
ATOM 3923 O ARG B 84 76.458 91.162 69.582 1.00 57.30 O
ATOM 3924 CB ARG B 84 77.558 93.029 71.863 1.00 64.33 C
ATOM 3925 CG ARG B 84 78.445 93.198 70.638 1.00 67.44 C
ATOM 3926 CD ARG B 84 79.705 93.993 70.899 1.00 69.90 C
ATOM 3927 NE ARG B 84 80.874 93.128 70.965 1.00 71.90 N
ATOM 3928 CZ ARG B 84 81.284 92.532 72.075 1.00 74.59 C
ATOM 3929 NH1 ARG B 84 80.615 92.718 73.211 1.00 75.59 N
ATOM 3930 NH2 ARG B 84 82.359 91.752 72.049 1.00 75.64 N
ATOM 3931 N ILE B 85 75.959 90.187 71.537 1.00 57.94 N
ATOM 3932 CA ILE B 85 75.961 88.861 70.946 1.00 58.05 C
ATOM 3933 C ILE B 85 74.891 88.792 69.852 1.00 58.77 C
ATOM 3934 O ILE B 85 75.154 88.310 68.740 1.00 59.31 O
ATOM 3935 CB ILE B 85 75.665 87.783 71.992 1.00 57.09 C
ATOM 3936 CG1 ILE B 85 76.804 87.721 73.004 1.00 56.41 C
ATOM 3937 CG2 ILE B 85 75.461 86.447 71.306 1.00 56.81 C
ATOM 3938 CD1 ILE B 85 76.564 86.749 74.143 1.00 57.21 C
ATOM 3939 N THR B 86 73.693 89.284 70.171 1.00 58.15 N
ATOM 3940 CA THR B 86 72.587 89.277 69.219 1.00 56.86 C
ATOM 3941 C THR B 86 72.768 90.335 68.135 1.00 55.77 C
ATOM 3942 O THR B 86 72.641 90.044 66.942 1.00 54.49 O
ATOM 3943 CB THR B 86 71.232 89.508 69.922 1.00 56.92 C
ATOM 3944 OG1 THR B 86 70.998 88.452 70.864 1.00 58.44 O
ATOM 3945 CG2 THR B 86 70.094 89.521 68.900 1.00 55.74 C
ATOM 3946 N ARG B 87 73.064 91.563 68.537 1.00 54.78 N
ATOM 3947 CA ARG B 87 73.245 92.614 67.547 1.00 56.65 C
ATOM 3948 C ARG B 87 74.443 92.329 66.639 1.00 57.27 C
ATOM 3949 O ARG B 87 74.378 92.516 65.417 1.00 55.79 O
ATOM 3950 CB ARG B 87 73.431 93.965 68.236 1.00 56.83 C
ATOM 3951 CG ARG B 87 72.181 94.489 68.908 1.00 57.97 C
ATOM 3952 CD ARG B 87 70.995 94.603 67.936 1.00 56.85 C
ATOM 3953 NE ARG B 87 69.857 95.249 68.587 1.00 56.07 N
ATOM 3954 CZ ARG B 87 69.742 96.562 68.775 1.00 55.08 C
ATOM 3955 NH1 ARG B 87 70.690 97.387 68.349 1.00 53.94 N
ATOM 3956 NH2 ARG B 87 68.690 97.047 69.421 1.00 52.95 N
ATOM 3957 N GLY B 88 75.531 91.873 67.259 1.00 57.84 N
ATOM 3958 CA GLY B 88 76.743 91.564 66.529 1.00 55.86 C
ATOM 3959 C GLY B 88 76.522 90.545 65.436 1.00 55.13 C
ATOM 3960 O GLY B 88 76.824 90.810 64.269 1.00 55.79 O
ATOM 3961 N ILE B 89 76.001 89.379 65.802 1.00 53.38 N
ATOM 3962 CA ILE B 89 75.763 88.337 64.817 1.00 53.45 C
ATOM 3963 C ILE B 89 74.792 88.769 63.723 1.00 55.48 C
ATOM 3964 O ILE B 89 74.983 88.434 62.544 1.00 55.60 O
ATOM 3965 CB ILE B 89 75.238 87.066 65.483 1.00 52.97 C
ATOM 3966 CG1 ILE B 89 76.346 86.456 66.345 1.00 54.12 C
ATOM 3967 CG2 ILE B 89 74.750 86.088 64.427 1.00 51.58 C
ATOM 3968 CD1 ILE B 89 75.963 85.179 67.072 1.00 54.42 C
ATOM 3969 N GLU B 90 73.755 89.516 64.107 1.00 56.70 N
ATOM 3970 CA GLU B 90 72.770 89.977 63.140 1.00 57.48 C
ATOM 3971 C GLU B 90 73.348 91.036 62.222 1.00 58.01 C
ATOM 3972 O GLU B 90 72.962 91.125 61.052 1.00 58.55 O
ATOM 3973 CB GLU B 90 71.533 90.528 63.844 1.00 57.35 C
ATOM 3974 CG GLU B 90 70.698 89.455 64.523 1.00 60.55 C
ATOM 3975 CD GLU B 90 69.321 89.948 64.956 1.00 61.28 C
ATOM 3976 OE1 GLU B 90 69.258 90.950 65.700 1.00 60.82 O
ATOM 3977 OE2 GLU B 90 68.307 89.327 64.557 1.00 61.22 O
ATOM 3978 N ALA B 91 74.282 91.823 62.749 1.00 57.70 N
ATOM 3979 CA ALA B 91 74.909 92.889 61.980 1.00 57.63 C
ATOM 3980 C ALA B 91 75.444 92.379 60.654 1.00 59.06 C
ATOM 3981 O ALA B 91 75.440 93.099 59.654 1.00 59.09 O
ATOM 3982 CB ALA B 91 76.028 93.516 62.777 1.00 56.62 C
ATOM 3983 N VAL B 92 75.891 91.127 60.640 1.00 61.11 N
ATOM 3984 CA VAL B 92 76.449 90.541 59.423 1.00 61.55 C
ATOM 3985 C VAL B 92 75.651 89.346 58.906 1.00 61.92 C
ATOM 3986 O VAL B 92 76.217 88.331 58.509 1.00 62.81 O
ATOM 3987 CB VAL B 92 77.917 90.118 59.653 1.00 61.03 C
ATOM 3988 CG1 VAL B 92 78.770 91.353 59.923 1.00 59.81 C
ATOM 3989 CG2 VAL B 92 78.001 89.135 60.824 1.00 59.58 C
ATOM 3990 N GLY B 93 74.329 89.475 58.910 1.00 61.55 N
ATOM 3991 CA GLY B 93 73.484 88.400 58.426 1.00 59.16 C
ATOM 3992 C GLY B 93 73.838 87.020 58.948 1.00 57.37 C
ATOM 3993 O GLY B 93 73.538 86.019 58.298 1.00 55.47 O
ATOM 3994 N GLY B 94 74.469 86.958 60.117 1.00 56.88 N
ATOM 3995 CA GLY B 94 74.827 85.667 60.679 1.00 57.06 C
ATOM 3996 C GLY B 94 73.737 85.061 61.552 1.00 57.14 C
ATOM 3997 O GLY B 94 72.713 85.695 61.820 1.00 57.16 O
ATOM 3998 N SER B 95 73.953 83.824 61.988 1.00 56.40 N
ATOM 3999 CA SER B 95 73.001 83.142 62.854 1.00 56.30 C
ATOM 4000 C SER B 95 73.736 82.356 63.930 1.00 55.29 C
ATOM 4001 O SER B 95 74.905 82.025 63.777 1.00 56.26 O
ATOM 4002 CB SER B 95 72.105 82.200 62.041 1.00 57.35 C
ATOM 4003 OG SER B 95 72.797 81.055 61.576 1.00 59.06 O
ATOM 4004 N LEU B 96 73.051 82.073 65.026 1.00 54.57 N
ATOM 4005 CA LEU B 96 73.643 81.320 66.114 1.00 55.09 C
ATOM 4006 C LEU B 96 72.584 80.382 66.652 1.00 56.89 C
ATOM 4007 O LEU B 96 71.488 80.810 66.980 1.00 57.84 O
ATOM 4008 CB LEU B 96 74.104 82.254 67.228 1.00 54.37 C
ATOM 4009 CG LEU B 96 74.459 81.566 68.550 1.00 54.73 C
ATOM 4010 CD1 LEU B 96 75.694 80.709 68.360 1.00 55.63 C
ATOM 4011 CD2 LEU B 96 74.697 82.606 69.626 1.00 55.24 C
ATOM 4012 N SER B 97 72.896 79.100 66.729 1.00 58.48 N
ATOM 4013 CA SER B 97 71.930 78.153 67.248 1.00 60.98 C
ATOM 4014 C SER B 97 72.626 77.055 68.049 1.00 62.17 C
ATOM 4015 O SER B 97 73.847 76.936 68.021 1.00 62.92 O
ATOM 4016 CB SER B 97 71.107 77.568 66.096 1.00 60.65 C
ATOM 4017 OG SER B 97 71.943 77.144 65.037 1.00 61.92 O
ATOM 4018 N VAL B 98 71.844 76.265 68.773 1.00 62.46 N
ATOM 4019 CA VAL B 98 72.390 75.202 69.588 1.00 62.61 C
ATOM 4020 C VAL B 98 71.499 73.975 69.513 1.00 64.38 C
ATOM 4021 O VAL B 98 70.339 74.020 69.910 1.00 66.44 O
ATOM 4022 CB VAL B 98 72.488 75.643 71.056 1.00 61.86 C
ATOM 4023 CG1 VAL B 98 73.027 74.505 71.916 1.00 62.74 C
ATOM 4024 CG2 VAL B 98 73.363 76.868 71.161 1.00 60.38 C
ATOM 4025 N TYR B 99 72.032 72.877 68.998 1.00 64.91 N
ATOM 4026 CA TYR B 99 71.256 71.655 68.923 1.00 65.04 C
ATOM 4027 C TYR B 99 71.814 70.690 69.963 1.00 65.85 C
ATOM 4028 O TYR B 99 72.985 70.766 70.321 1.00 65.58 O
ATOM 4029 CB TYR B 99 71.365 71.037 67.532 1.00 64.76 C
ATOM 4030 CG TYR B 99 71.134 72.010 66.406 1.00 65.60 C
ATOM 4031 CD1 TYR B 99 72.116 72.923 66.047 1.00 65.28 C
ATOM 4032 CD2 TYR B 99 69.924 72.021 65.703 1.00 65.92 C
ATOM 4033 CE1 TYR B 99 71.908 73.828 65.016 1.00 66.38 C
ATOM 4034 CE2 TYR B 99 69.704 72.919 64.669 1.00 65.86 C
ATOM 4035 CZ TYR B 99 70.703 73.824 64.329 1.00 66.58 C
ATOM 4036 OH TYR B 99 70.512 74.727 63.303 1.00 66.64 O
ATOM 4037 N SER B 100 70.977 69.789 70.461 1.00 66.53 N
ATOM 4038 CA SER B 100 71.454 68.831 71.433 1.00 68.15 C
ATOM 4039 C SER B 100 70.625 67.551 71.528 1.00 69.71 C
ATOM 4040 O SER B 100 69.432 67.539 71.225 1.00 70.59 O
ATOM 4041 CB SER B 100 71.569 69.499 72.805 1.00 67.23 C
ATOM 4042 OG SER B 100 70.325 69.970 73.254 1.00 67.79 O
ATOM 4043 N THR B 101 71.295 66.466 71.912 1.00 70.63 N
ATOM 4044 CA THR B 101 70.665 65.164 72.097 1.00 71.75 C
ATOM 4045 C THR B 101 70.902 64.832 73.567 1.00 72.39 C
ATOM 4046 O THR B 101 71.517 65.625 74.288 1.00 72.29 O
ATOM 4047 CB THR B 101 71.323 64.077 71.220 1.00 72.20 C
ATOM 4048 OG1 THR B 101 72.737 64.049 71.466 1.00 73.80 O
ATOM 4049 CG2 THR B 101 71.073 64.353 69.751 1.00 71.75 C
ATOM 4050 N ARG B 102 70.433 63.675 74.021 1.00 72.59 N
ATOM 4051 CA ARG B 102 70.636 63.324 75.419 1.00 72.95 C
ATOM 4052 C ARG B 102 72.127 63.286 75.739 1.00 72.88 C
ATOM 4053 O ARG B 102 72.517 63.435 76.897 1.00 72.21 O
ATOM 4054 CB ARG B 102 70.013 61.963 75.739 1.00 72.92 C
ATOM 4055 CG ARG B 102 68.675 61.747 75.089 1.00 74.15 C
ATOM 4056 CD ARG B 102 67.622 61.254 76.059 1.00 75.17 C
ATOM 4057 NE ARG B 102 66.315 61.338 75.416 1.00 77.33 N
ATOM 4058 CZ ARG B 102 65.145 61.294 76.047 1.00 78.21 C
ATOM 4059 NH1 ARG B 102 65.089 61.157 77.369 1.00 78.70 N
ATOM 4060 NH2 ARG B 102 64.022 61.416 75.350 1.00 77.95 N
ATOM 4061 N GLU B 103 72.966 63.116 74.718 1.00 73.49 N
ATOM 4062 CA GLU B 103 74.396 63.030 74.978 1.00 74.15 C
ATOM 4063 C GLU B 103 75.373 63.901 74.205 1.00 73.26 C
ATOM 4064 O GLU B 103 76.576 63.678 74.286 1.00 73.57 O
ATOM 4065 CB GLU B 103 74.852 61.570 74.885 1.00 75.27 C
ATOM 4066 CG GLU B 103 74.911 60.984 73.487 1.00 75.69 C
ATOM 4067 CD GLU B 103 75.189 59.487 73.518 1.00 76.14 C
ATOM 4068 OE1 GLU B 103 75.402 58.894 72.440 1.00 75.52 O
ATOM 4069 OE2 GLU B 103 75.190 58.903 74.628 1.00 76.61 O
ATOM 4070 N LYS B 104 74.889 64.882 73.457 1.00 72.75 N
ATOM 4071 CA LYS B 104 75.811 65.770 72.749 1.00 72.70 C
ATOM 4072 C LYS B 104 75.190 67.137 72.467 1.00 70.95 C
ATOM 4073 O LYS B 104 74.010 67.238 72.145 1.00 70.93 O
ATOM 4074 CB LYS B 104 76.315 65.132 71.445 1.00 74.34 C
ATOM 4075 CG LYS B 104 75.375 65.224 70.272 1.00 78.40 C
ATOM 4076 CD LYS B 104 76.125 64.967 68.967 1.00 80.89 C
ATOM 4077 CE LYS B 104 75.264 65.308 67.748 1.00 82.98 C
ATOM 4078 NZ LYS B 104 76.031 65.202 66.471 1.00 82.70 N
ATOM 4079 N MET B 105 75.991 68.187 72.608 1.00 68.69 N
ATOM 4080 CA MET B 105 75.525 69.545 72.380 1.00 67.09 C
ATOM 4081 C MET B 105 76.357 70.237 71.313 1.00 67.07 C
ATOM 4082 O MET B 105 77.579 70.298 71.408 1.00 67.78 O
ATOM 4083 CB MET B 105 75.584 70.347 73.682 1.00 66.06 C
ATOM 4084 CG MET B 105 74.505 69.973 74.680 1.00 64.83 C
ATOM 4085 SD MET B 105 74.597 70.886 76.243 1.00 66.85 S
ATOM 4086 CE MET B 105 74.521 72.565 75.663 1.00 65.64 C
ATOM 4087 N THR B 106 75.692 70.775 70.302 1.00 66.50 N
ATOM 4088 CA THR B 106 76.398 71.442 69.223 1.00 65.76 C
ATOM 4089 C THR B 106 76.041 72.928 69.106 1.00 65.07 C
ATOM 4090 O THR B 106 74.880 73.285 68.935 1.00 64.81 O
ATOM 4091 CB THR B 106 76.092 70.748 67.881 1.00 66.73 C
ATOM 4092 OG1 THR B 106 76.077 69.326 68.070 1.00 67.40 O
ATOM 4093 CG2 THR B 106 77.149 71.105 66.839 1.00 66.51 C
ATOM 4094 N TYR B 107 77.052 73.786 69.202 1.00 64.11 N
ATOM 4095 CA TYR B 107 76.872 75.225 69.084 1.00 63.87 C
ATOM 4096 C TYR B 107 77.420 75.663 67.743 1.00 65.70 C
ATOM 4097 O TYR B 107 78.629 75.775 67.594 1.00 67.55 O
ATOM 4098 CB TYR B 107 77.663 75.964 70.152 1.00 61.46 C
ATOM 4099 CG TYR B 107 77.129 75.857 71.547 1.00 60.87 C
ATOM 4100 CD1 TYR B 107 77.025 74.626 72.186 1.00 60.59 C
ATOM 4101 CD2 TYR B 107 76.766 77.002 72.254 1.00 60.98 C
ATOM 4102 CE1 TYR B 107 76.573 74.538 73.498 1.00 60.26 C
ATOM 4103 CE2 TYR B 107 76.317 76.928 73.568 1.00 59.87 C
ATOM 4104 CZ TYR B 107 76.222 75.695 74.183 1.00 59.82 C
ATOM 4105 OH TYR B 107 75.774 75.625 75.480 1.00 59.78 O
ATOM 4106 N CYS B 108 76.564 75.932 66.768 1.00 67.55 N
ATOM 4107 CA CYS B 108 77.072 76.360 65.472 1.00 70.39 C
ATOM 4108 C CYS B 108 76.582 77.723 65.011 1.00 70.05 C
ATOM 4109 O CYS B 108 75.496 78.166 65.371 1.00 70.73 O
ATOM 4110 CB CYS B 108 76.747 75.315 64.409 1.00 72.74 C
ATOM 4111 SG CYS B 108 75.053 74.754 64.457 1.00 79.69 S
ATOM 4112 N VAL B 109 77.408 78.376 64.204 1.00 69.90 N
ATOM 4113 CA VAL B 109 77.114 79.690 63.659 1.00 69.77 C
ATOM 4114 C VAL B 109 77.314 79.638 62.151 1.00 70.30 C
ATOM 4115 O VAL B 109 78.232 78.975 61.665 1.00 69.54 O
ATOM 4116 CB VAL B 109 78.068 80.740 64.232 1.00 69.54 C
ATOM 4117 CG1 VAL B 109 77.850 80.886 65.720 1.00 69.98 C
ATOM 4118 CG2 VAL B 109 79.502 80.314 63.972 1.00 70.51 C
ATOM 4119 N GLU B 110 76.445 80.315 61.410 1.00 70.79 N
ATOM 4120 CA GLU B 110 76.566 80.354 59.959 1.00 72.19 C
ATOM 4121 C GLU B 110 76.639 81.800 59.537 1.00 72.63 C
ATOM 4122 O GLU B 110 76.025 82.655 60.159 1.00 73.32 O
ATOM 4123 CB GLU B 110 75.372 79.681 59.266 1.00 73.05 C
ATOM 4124 CG GLU B 110 75.405 78.153 59.291 1.00 75.10 C
ATOM 4125 CD GLU B 110 74.796 77.517 58.041 1.00 76.08 C
ATOM 4126 OE1 GLU B 110 75.207 77.894 56.919 1.00 75.57 O
ATOM 4127 OE2 GLU B 110 73.918 76.634 58.185 1.00 76.05 O
ATOM 4128 N CYS B 111 77.414 82.075 58.497 1.00 73.83 N
ATOM 4129 CA CYS B 111 77.546 83.430 57.988 1.00 75.80 C
ATOM 4130 C CYS B 111 78.354 83.430 56.703 1.00 77.02 C
ATOM 4131 O CYS B 111 78.943 82.419 56.320 1.00 76.70 O
ATOM 4132 CB CYS B 111 78.229 84.333 59.009 1.00 76.03 C
ATOM 4133 SG CYS B 111 79.963 83.980 59.228 1.00 77.40 S
ATOM 4134 N LEU B 112 78.376 84.572 56.033 1.00 78.29 N
ATOM 4135 CA LEU B 112 79.110 84.677 54.791 1.00 79.04 C
ATOM 4136 C LEU B 112 80.594 84.653 55.113 1.00 79.96 C
ATOM 4137 O LEU B 112 81.023 85.225 56.119 1.00 80.56 O
ATOM 4138 CB LEU B 112 78.717 85.964 54.064 1.00 78.81 C
ATOM 4139 CG LEU B 112 77.212 86.071 53.784 1.00 78.85 C
ATOM 4140 CD1 LEU B 112 76.904 87.425 53.139 1.00 78.43 C
ATOM 4141 CD2 LEU B 112 76.759 84.902 52.890 1.00 76.16 C
ATOM 4142 N ARG B 113 81.359 83.969 54.259 1.00 80.73 N
ATOM 4143 CA ARG B 113 82.814 83.806 54.393 1.00 79.71 C
ATOM 4144 C ARG B 113 83.552 84.965 55.027 1.00 78.78 C
ATOM 4145 O ARG B 113 84.257 84.784 56.022 1.00 78.27 O
ATOM 4146 CB ARG B 113 83.455 83.557 53.028 1.00 80.40 C
ATOM 4147 CG ARG B 113 82.884 82.388 52.259 1.00 82.90 C
ATOM 4148 CD ARG B 113 83.666 82.178 50.975 1.00 83.22 C
ATOM 4149 NE ARG B 113 85.017 81.711 51.257 1.00 84.79 N
ATOM 4150 CZ ARG B 113 85.315 80.477 51.650 1.00 85.24 C
ATOM 4151 NH1 ARG B 113 84.361 79.569 51.798 1.00 84.98 N
ATOM 4152 NH2 ARG B 113 86.571 80.155 51.919 1.00 86.59 N
ATOM 4153 N ASP B 114 83.396 86.148 54.436 1.00 77.52 N
ATOM 4154 CA ASP B 114 84.079 87.347 54.906 1.00 76.64 C
ATOM 4155 C ASP B 114 83.757 87.807 56.321 1.00 76.04 C
ATOM 4156 O ASP B 114 84.236 88.854 56.746 1.00 76.94 O
ATOM 4157 CB ASP B 114 83.833 88.511 53.939 1.00 77.84 C
ATOM 4158 CG ASP B 114 84.292 88.204 52.520 1.00 79.53 C
ATOM 4159 OD1 ASP B 114 85.268 87.437 52.349 1.00 80.02 O
ATOM 4160 OD2 ASP B 114 83.686 88.745 51.572 1.00 80.02 O
ATOM 4161 N HIS B 115 82.966 87.041 57.064 1.00 75.13 N
ATOM 4162 CA HIS B 115 82.625 87.455 58.417 1.00 73.76 C
ATOM 4163 C HIS B 115 82.947 86.427 59.478 1.00 74.09 C
ATOM 4164 O HIS B 115 82.648 86.639 60.653 1.00 74.57 O
ATOM 4165 CB HIS B 115 81.144 87.821 58.495 1.00 72.86 C
ATOM 4166 CG HIS B 115 80.768 88.975 57.622 1.00 71.65 C
ATOM 4167 ND1 HIS B 115 81.355 90.217 57.741 1.00 70.91 N
ATOM 4168 CD2 HIS B 115 79.890 89.068 56.595 1.00 70.74 C
ATOM 4169 CE1 HIS B 115 80.857 91.025 56.822 1.00 69.97 C
ATOM 4170 NE2 HIS B 115 79.967 90.352 56.114 1.00 70.30 N
ATOM 4171 N VAL B 116 83.559 85.320 59.073 1.00 73.91 N
ATOM 4172 CA VAL B 116 83.912 84.264 60.016 1.00 73.93 C
ATOM 4173 C VAL B 116 84.639 84.782 61.269 1.00 75.05 C
ATOM 4174 O VAL B 116 84.388 84.305 62.376 1.00 73.81 O
ATOM 4175 CB VAL B 116 84.789 83.203 59.339 1.00 73.19 C
ATOM 4176 CG1 VAL B 116 84.989 82.041 60.272 1.00 72.14 C
ATOM 4177 CG2 VAL B 116 84.148 82.742 58.044 1.00 73.58 C
ATOM 4178 N ASP B 117 85.536 85.753 61.093 1.00 77.04 N
ATOM 4179 CA ASP B 117 86.291 86.332 62.211 1.00 79.00 C
ATOM 4180 C ASP B 117 85.352 86.969 63.216 1.00 78.37 C
ATOM 4181 O ASP B 117 85.490 86.783 64.428 1.00 78.27 O
ATOM 4182 CB ASP B 117 87.253 87.413 61.716 1.00 83.46 C
ATOM 4183 CG ASP B 117 88.365 86.858 60.850 1.00 88.03 C
ATOM 4184 OD1 ASP B 117 89.120 85.987 61.343 1.00 90.85 O
ATOM 4185 OD2 ASP B 117 88.487 87.295 59.678 1.00 90.16 O
ATOM 4186 N THR B 118 84.415 87.747 62.683 1.00 77.28 N
ATOM 4187 CA THR B 118 83.408 88.449 63.467 1.00 75.38 C
ATOM 4188 C THR B 118 82.611 87.458 64.321 1.00 74.06 C
ATOM 4189 O THR B 118 82.726 87.429 65.551 1.00 73.34 O
ATOM 4190 CB THR B 118 82.437 89.199 62.521 1.00 75.34 C
ATOM 4191 OG1 THR B 118 83.184 90.060 61.652 1.00 73.71 O
ATOM 4192 CG2 THR B 118 81.432 90.027 63.320 1.00 76.02 C
ATOM 4193 N VAL B 119 81.810 86.651 63.633 1.00 72.24 N
ATOM 4194 CA VAL B 119 80.960 85.633 64.236 1.00 71.06 C
ATOM 4195 C VAL B 119 81.672 84.714 65.213 1.00 69.99 C
ATOM 4196 O VAL B 119 81.079 84.255 66.188 1.00 68.80 O
ATOM 4197 CB VAL B 119 80.311 84.763 63.128 1.00 71.44 C
ATOM 4198 CG1 VAL B 119 79.894 83.424 63.682 1.00 71.14 C
ATOM 4199 CG2 VAL B 119 79.103 85.481 62.552 1.00 72.36 C
ATOM 4200 N MET B 120 82.944 84.447 64.946 1.00 70.70 N
ATOM 4201 CA MET B 120 83.724 83.549 65.785 1.00 71.41 C
ATOM 4202 C MET B 120 83.881 84.016 67.229 1.00 69.94 C
ATOM 4203 O MET B 120 83.771 83.213 68.164 1.00 68.53 O
ATOM 4204 CB MET B 120 85.099 83.325 65.169 1.00 74.75 C
ATOM 4205 CG MET B 120 85.761 82.055 65.655 1.00 79.36 C
ATOM 4206 SD MET B 120 84.914 80.584 65.026 1.00 84.22 S
ATOM 4207 CE MET B 120 86.208 79.938 63.967 1.00 85.78 C
ATOM 4208 N GLU B 121 84.144 85.309 67.409 1.00 68.68 N
ATOM 4209 CA GLU B 121 84.305 85.868 68.751 1.00 67.76 C
ATOM 4210 C GLU B 121 83.153 85.445 69.645 1.00 65.62 C
ATOM 4211 O GLU B 121 83.343 85.055 70.802 1.00 63.36 O
ATOM 4212 CB GLU B 121 84.354 87.401 68.702 1.00 68.85 C
ATOM 4213 CG GLU B 121 83.975 88.050 70.035 1.00 69.90 C
ATOM 4214 CD GLU B 121 84.100 89.564 70.031 1.00 71.70 C
ATOM 4215 OE1 GLU B 121 83.691 90.208 69.036 1.00 71.55 O
ATOM 4216 OE2 GLU B 121 84.596 90.111 71.040 1.00 73.17 O
ATOM 4217 N TYR B 122 81.952 85.533 69.083 1.00 64.75 N
ATOM 4218 CA TYR B 122 80.738 85.192 69.801 1.00 63.48 C
ATOM 4219 C TYR B 122 80.651 83.699 70.087 1.00 62.63 C
ATOM 4220 O TYR B 122 80.436 83.299 71.230 1.00 61.87 O
ATOM 4221 CB TYR B 122 79.514 85.696 69.013 1.00 61.54 C
ATOM 4222 CG TYR B 122 79.537 87.201 68.792 1.00 58.03 C
ATOM 4223 CD1 TYR B 122 79.532 87.739 67.500 1.00 57.25 C
ATOM 4224 CD2 TYR B 122 79.649 88.083 69.873 1.00 55.59 C
ATOM 4225 CE1 TYR B 122 79.648 89.122 67.290 1.00 55.77 C
ATOM 4226 CE2 TYR B 122 79.767 89.462 69.677 1.00 54.10 C
ATOM 4227 CZ TYR B 122 79.771 89.973 68.386 1.00 55.24 C
ATOM 4228 OH TYR B 122 79.942 91.326 68.185 1.00 55.59 O
ATOM 4229 N LEU B 123 80.843 82.873 69.066 1.00 63.15 N
ATOM 4230 CA LEU B 123 80.772 81.436 69.282 1.00 65.01 C
ATOM 4231 C LEU B 123 81.700 81.070 70.419 1.00 65.90 C
ATOM 4232 O LEU B 123 81.363 80.253 71.269 1.00 66.44 O
ATOM 4233 CB LEU B 123 81.174 80.671 68.020 1.00 64.94 C
ATOM 4234 CG LEU B 123 81.193 79.144 68.160 1.00 64.36 C
ATOM 4235 CD1 LEU B 123 79.822 78.635 68.548 1.00 64.04 C
ATOM 4236 CD2 LEU B 123 81.638 78.521 66.847 1.00 64.42 C
ATOM 4237 N LEU B 124 82.868 81.701 70.433 1.00 68.24 N
ATOM 4238 CA LEU B 124 83.877 81.458 71.459 1.00 69.28 C
ATOM 4239 C LEU B 124 83.360 81.799 72.857 1.00 67.74 C
ATOM 4240 O LEU B 124 83.295 80.938 73.734 1.00 66.62 O
ATOM 4241 CB LEU B 124 85.121 82.296 71.165 1.00 72.49 C
ATOM 4242 CG LEU B 124 86.349 81.971 72.026 1.00 75.96 C
ATOM 4243 CD1 LEU B 124 87.099 80.803 71.368 1.00 76.33 C
ATOM 4244 CD2 LEU B 124 87.263 83.211 72.169 1.00 75.05 C
ATOM 4245 N ASN B 125 83.010 83.069 73.043 1.00 67.35 N
ATOM 4246 CA ASN B 125 82.495 83.591 74.310 1.00 67.26 C
ATOM 4247 C ASN B 125 81.349 82.776 74.910 1.00 68.30 C
ATOM 4248 O ASN B 125 81.304 82.511 76.117 1.00 67.49 O
ATOM 4249 CB ASN B 125 82.032 85.028 74.103 1.00 64.57 C
ATOM 4250 CG ASN B 125 83.117 86.032 74.391 1.00 63.91 C
ATOM 4251 OD1 ASN B 125 83.456 86.260 75.547 1.00 63.95 O
ATOM 4252 ND2 ASN B 125 83.675 86.637 73.344 1.00 62.66 N
ATOM 4253 N VAL B 126 80.417 82.380 74.056 1.00 68.98 N
ATOM 4254 CA VAL B 126 79.274 81.614 74.503 1.00 69.82 C
ATOM 4255 C VAL B 126 79.639 80.255 75.090 1.00 70.69 C
ATOM 4256 O VAL B 126 79.122 79.873 76.137 1.00 71.21 O
ATOM 4257 CB VAL B 126 78.276 81.425 73.349 1.00 69.30 C
ATOM 4258 CG1 VAL B 126 77.182 80.456 73.753 1.00 69.42 C
ATOM 4259 CG2 VAL B 126 77.672 82.768 72.980 1.00 68.70 C
ATOM 4260 N THR B 127 80.537 79.534 74.429 1.00 71.99 N
ATOM 4261 CA THR B 127 80.936 78.198 74.885 1.00 72.09 C
ATOM 4262 C THR B 127 82.012 78.151 75.968 1.00 72.25 C
ATOM 4263 O THR B 127 82.091 77.182 76.721 1.00 71.88 O
ATOM 4264 CB THR B 127 81.452 77.338 73.713 1.00 71.77 C
ATOM 4265 OG1 THR B 127 82.617 77.957 73.155 1.00 71.64 O
ATOM 4266 CG2 THR B 127 80.385 77.190 72.632 1.00 70.86 C
ATOM 4267 N THR B 128 82.834 79.190 76.060 1.00 72.97 N
ATOM 4268 CA THR B 128 83.908 79.182 77.043 1.00 73.11 C
ATOM 4269 C THR B 128 83.871 80.266 78.116 1.00 72.93 C
ATOM 4270 O THR B 128 84.439 80.086 79.192 1.00 72.12 O
ATOM 4271 CB THR B 128 85.263 79.256 76.334 1.00 73.44 C
ATOM 4272 OG1 THR B 128 85.371 80.504 75.640 1.00 74.36 O
ATOM 4273 CG2 THR B 128 85.388 78.125 75.330 1.00 74.21 C
ATOM 4274 N ALA B 129 83.201 81.380 77.846 1.00 73.39 N
ATOM 4275 CA ALA B 129 83.160 82.460 78.828 1.00 73.29 C
ATOM 4276 C ALA B 129 81.785 82.916 79.309 1.00 72.75 C
ATOM 4277 O ALA B 129 81.556 84.111 79.481 1.00 73.13 O
ATOM 4278 CB ALA B 129 83.933 83.660 78.290 1.00 74.17 C
ATOM 4279 N PRO B 130 80.850 81.978 79.539 1.00 71.97 N
ATOM 4280 CA PRO B 130 79.529 82.399 80.007 1.00 70.48 C
ATOM 4281 C PRO B 130 79.583 82.960 81.426 1.00 69.10 C
ATOM 4282 O PRO B 130 80.366 82.495 82.243 1.00 68.47 O
ATOM 4283 CB PRO B 130 78.713 81.109 79.924 1.00 70.40 C
ATOM 4284 CG PRO B 130 79.719 80.061 80.201 1.00 71.34 C
ATOM 4285 CD PRO B 130 80.892 80.516 79.360 1.00 72.33 C
ATOM 4286 N GLU B 131 78.754 83.963 81.709 1.00 69.10 N
ATOM 4287 CA GLU B 131 78.702 84.566 83.039 1.00 68.62 C
ATOM 4288 C GLU B 131 77.480 84.149 83.855 1.00 68.35 C
ATOM 4289 O GLU B 131 77.458 84.349 85.071 1.00 68.56 O
ATOM 4290 CB GLU B 131 78.739 86.089 82.940 1.00 68.04 C
ATOM 4291 CG GLU B 131 80.103 86.646 82.582 1.00 70.28 C
ATOM 4292 CD GLU B 131 80.172 88.154 82.733 1.00 70.54 C
ATOM 4293 OE1 GLU B 131 79.411 88.701 83.554 1.00 71.22 O
ATOM 4294 OE2 GLU B 131 80.996 88.793 82.050 1.00 70.85 O
ATOM 4295 N PHE B 132 76.476 83.571 83.188 1.00 67.86 N
ATOM 4296 CA PHE B 132 75.236 83.124 83.835 1.00 66.81 C
ATOM 4297 C PHE B 132 74.807 84.030 84.986 1.00 66.01 C
ATOM 4298 O PHE B 132 74.573 83.564 86.106 1.00 64.52 O
ATOM 4299 CB PHE B 132 75.385 81.689 84.346 1.00 67.32 C
ATOM 4300 CG PHE B 132 75.663 80.689 83.264 1.00 68.72 C
ATOM 4301 CD1 PHE B 132 76.453 79.573 83.523 1.00 69.36 C
ATOM 4302 CD2 PHE B 132 75.142 80.863 81.984 1.00 69.33 C
ATOM 4303 CE1 PHE B 132 76.725 78.640 82.523 1.00 70.77 C
ATOM 4304 CE2 PHE B 132 75.405 79.935 80.971 1.00 70.60 C
ATOM 4305 CZ PHE B 132 76.200 78.820 81.240 1.00 70.79 C
ATOM 4306 N ARG B 133 74.711 85.327 84.695 1.00 65.43 N
ATOM 4307 CA ARG B 133 74.309 86.322 85.683 1.00 64.48 C
ATOM 4308 C ARG B 133 72.986 85.889 86.291 1.00 64.43 C
ATOM 4309 O ARG B 133 72.046 85.541 85.576 1.00 65.38 O
ATOM 4310 CB ARG B 133 74.172 87.689 85.020 1.00 62.78 C
ATOM 4311 CG ARG B 133 75.447 88.152 84.375 1.00 61.11 C
ATOM 4312 CD ARG B 133 75.316 89.545 83.846 1.00 62.11 C
ATOM 4313 NE ARG B 133 76.592 90.060 83.367 1.00 62.86 N
ATOM 4314 CZ ARG B 133 76.807 91.330 83.039 1.00 64.60 C
ATOM 4315 NH1 ARG B 133 75.825 92.218 83.133 1.00 66.84 N
ATOM 4316 NH2 ARG B 133 78.008 91.718 82.638 1.00 64.72 N
ATOM 4317 N PRO B 134 72.891 85.914 87.625 1.00 63.73 N
ATOM 4318 CA PRO B 134 71.674 85.509 88.339 1.00 63.62 C
ATOM 4319 C PRO B 134 70.377 86.062 87.760 1.00 63.41 C
ATOM 4320 O PRO B 134 69.451 85.307 87.459 1.00 63.56 O
ATOM 4321 CB PRO B 134 71.929 85.995 89.761 1.00 62.57 C
ATOM 4322 CG PRO B 134 73.410 85.918 89.868 1.00 63.16 C
ATOM 4323 CD PRO B 134 73.864 86.503 88.555 1.00 63.04 C
ATOM 4324 N TRP B 135 70.312 87.378 87.597 1.00 62.34 N
ATOM 4325 CA TRP B 135 69.108 87.989 87.068 1.00 61.25 C
ATOM 4326 C TRP B 135 68.759 87.544 85.645 1.00 60.61 C
ATOM 4327 O TRP B 135 67.605 87.234 85.369 1.00 61.58 O
ATOM 4328 CB TRP B 135 69.210 89.515 87.166 1.00 60.47 C
ATOM 4329 CG TRP B 135 70.409 90.118 86.522 1.00 58.89 C
ATOM 4330 CD1 TRP B 135 70.508 90.580 85.247 1.00 59.12 C
ATOM 4331 CD2 TRP B 135 71.691 90.320 87.123 1.00 59.60 C
ATOM 4332 NE1 TRP B 135 71.772 91.061 85.009 1.00 59.19 N
ATOM 4333 CE2 TRP B 135 72.520 90.912 86.147 1.00 60.10 C
ATOM 4334 CE3 TRP B 135 72.222 90.056 88.393 1.00 58.35 C
ATOM 4335 CZ2 TRP B 135 73.858 91.245 86.402 1.00 59.82 C
ATOM 4336 CZ3 TRP B 135 73.545 90.387 88.645 1.00 56.35 C
ATOM 4337 CH2 TRP B 135 74.348 90.975 87.655 1.00 57.74 C
ATOM 4338 N GLU B 136 69.739 87.489 84.747 1.00 59.67 N
ATOM 4339 CA GLU B 136 69.470 87.061 83.373 1.00 57.73 C
ATOM 4340 C GLU B 136 68.942 85.632 83.370 1.00 57.54 C
ATOM 4341 O GLU B 136 68.091 85.268 82.557 1.00 58.36 O
ATOM 4342 CB GLU B 136 70.734 87.156 82.497 1.00 54.53 C
ATOM 4343 CG GLU B 136 71.190 88.584 82.227 1.00 52.41 C
ATOM 4344 CD GLU B 136 72.422 88.680 81.335 1.00 52.89 C
ATOM 4345 OE1 GLU B 136 72.951 89.803 81.197 1.00 51.99 O
ATOM 4346 OE2 GLU B 136 72.865 87.654 80.773 1.00 53.28 O
ATOM 4347 N VAL B 137 69.436 84.823 84.296 1.00 57.86 N
ATOM 4348 CA VAL B 137 69.003 83.433 84.379 1.00 57.82 C
ATOM 4349 C VAL B 137 67.566 83.342 84.880 1.00 58.08 C
ATOM 4350 O VAL B 137 66.748 82.623 84.312 1.00 56.88 O
ATOM 4351 CB VAL B 137 69.958 82.612 85.296 1.00 55.75 C
ATOM 4352 CG1 VAL B 137 69.373 81.241 85.589 1.00 54.05 C
ATOM 4353 CG2 VAL B 137 71.305 82.465 84.611 1.00 53.23 C
ATOM 4354 N THR B 138 67.265 84.086 85.937 1.00 59.56 N
ATOM 4355 CA THR B 138 65.928 84.099 86.510 1.00 61.10 C
ATOM 4356 C THR B 138 64.902 84.489 85.444 1.00 61.68 C
ATOM 4357 O THR B 138 63.825 83.896 85.352 1.00 62.33 O
ATOM 4358 CB THR B 138 65.835 85.109 87.648 1.00 60.61 C
ATOM 4359 OG1 THR B 138 67.031 85.061 88.431 1.00 61.79 O
ATOM 4360 CG2 THR B 138 64.674 84.774 88.536 1.00 60.88 C
ATOM 4361 N ASP B 139 65.256 85.488 84.644 1.00 61.15 N
ATOM 4362 CA ASP B 139 64.407 85.988 83.572 1.00 61.82 C
ATOM 4363 C ASP B 139 64.153 84.992 82.464 1.00 61.16 C
ATOM 4364 O ASP B 139 63.080 84.976 81.868 1.00 62.19 O
ATOM 4365 CB ASP B 139 65.038 87.233 82.961 1.00 64.01 C
ATOM 4366 CG ASP B 139 64.613 88.499 83.667 1.00 68.15 C
ATOM 4367 OD1 ASP B 139 64.522 88.483 84.920 1.00 70.39 O
ATOM 4368 OD2 ASP B 139 64.371 89.510 82.971 1.00 68.75 O
ATOM 4369 N LEU B 140 65.154 84.167 82.191 1.00 60.33 N
ATOM 4370 CA LEU B 140 65.094 83.183 81.125 1.00 58.32 C
ATOM 4371 C LEU B 140 64.339 81.903 81.450 1.00 57.71 C
ATOM 4372 O LEU B 140 63.731 81.296 80.572 1.00 57.25 O
ATOM 4373 CB LEU B 140 66.520 82.835 80.700 1.00 58.04 C
ATOM 4374 CG LEU B 140 66.700 81.783 79.612 1.00 57.75 C
ATOM 4375 CD1 LEU B 140 66.042 82.242 78.330 1.00 56.92 C
ATOM 4376 CD2 LEU B 140 68.170 81.554 79.389 1.00 57.95 C
ATOM 4377 N GLN B 141 64.363 81.491 82.708 1.00 57.63 N
ATOM 4378 CA GLN B 141 63.709 80.249 83.078 1.00 57.60 C
ATOM 4379 C GLN B 141 62.263 80.095 82.678 1.00 56.76 C
ATOM 4380 O GLN B 141 61.834 79.005 82.321 1.00 57.45 O
ATOM 4381 CB GLN B 141 63.887 79.983 84.568 1.00 58.80 C
ATOM 4382 CG GLN B 141 65.310 79.546 84.858 1.00 61.03 C
ATOM 4383 CD GLN B 141 65.439 78.764 86.130 1.00 62.18 C
ATOM 4384 OE1 GLN B 141 64.871 77.684 86.270 1.00 61.79 O
ATOM 4385 NE2 GLN B 141 66.195 79.305 87.074 1.00 65.40 N
ATOM 4386 N PRO B 142 61.476 81.169 82.737 1.00 56.36 N
ATOM 4387 CA PRO B 142 60.094 80.923 82.322 1.00 54.76 C
ATOM 4388 C PRO B 142 60.009 80.462 80.864 1.00 53.23 C
ATOM 4389 O PRO B 142 59.033 79.832 80.453 1.00 54.14 O
ATOM 4390 CB PRO B 142 59.405 82.258 82.594 1.00 54.42 C
ATOM 4391 CG PRO B 142 60.530 83.244 82.655 1.00 56.03 C
ATOM 4392 CD PRO B 142 61.621 82.500 83.341 1.00 55.57 C
ATOM 4393 N GLN B 143 61.052 80.747 80.094 1.00 51.20 N
ATOM 4394 CA GLN B 143 61.095 80.338 78.697 1.00 50.80 C
ATOM 4395 C GLN B 143 61.035 78.822 78.533 1.00 51.02 C
ATOM 4396 O GLN B 143 60.543 78.314 77.533 1.00 51.12 O
ATOM 4397 CB GLN B 143 62.367 80.835 78.033 1.00 50.70 C
ATOM 4398 CG GLN B 143 62.388 80.562 76.555 1.00 53.32 C
ATOM 4399 CD GLN B 143 61.399 81.425 75.801 1.00 55.92 C
ATOM 4400 OE1 GLN B 143 60.275 81.644 76.250 1.00 58.67 O
ATOM 4401 NE2 GLN B 143 61.812 81.917 74.645 1.00 58.31 N
ATOM 4402 N LEU B 144 61.562 78.100 79.509 1.00 51.68 N
ATOM 4403 CA LEU B 144 61.553 76.652 79.462 1.00 52.05 C
ATOM 4404 C LEU B 144 60.126 76.149 79.259 1.00 52.92 C
ATOM 4405 O LEU B 144 59.906 75.173 78.537 1.00 51.96 O
ATOM 4406 CB LEU B 144 62.144 76.083 80.756 1.00 52.58 C
ATOM 4407 CG LEU B 144 63.605 76.439 81.056 1.00 53.33 C
ATOM 4408 CD1 LEU B 144 63.922 76.125 82.518 1.00 52.18 C
ATOM 4409 CD2 LEU B 144 64.527 75.681 80.104 1.00 53.71 C
ATOM 4410 N LYS B 145 59.153 76.812 79.888 1.00 53.92 N
ATOM 4411 CA LYS B 145 57.750 76.402 79.726 1.00 54.16 C
ATOM 4412 C LYS B 145 57.339 76.534 78.266 1.00 52.59 C
ATOM 4413 O LYS B 145 56.786 75.608 77.664 1.00 51.29 O
ATOM 4414 CB LYS B 145 56.811 77.267 80.575 1.00 54.75 C
ATOM 4415 CG LYS B 145 56.536 76.698 81.944 1.00 58.94 C
ATOM 4416 CD LYS B 145 55.743 77.660 82.816 1.00 61.32 C
ATOM 4417 CE LYS B 145 55.832 77.259 84.289 1.00 62.72 C
ATOM 4418 NZ LYS B 145 55.020 78.160 85.155 1.00 65.23 N
ATOM 4419 N VAL B 146 57.624 77.703 77.707 1.00 50.60 N
ATOM 4420 CA VAL B 146 57.280 77.998 76.326 1.00 49.56 C
ATOM 4421 C VAL B 146 57.955 77.037 75.361 1.00 49.90 C
ATOM 4422 O VAL B 146 57.296 76.366 74.571 1.00 50.66 O
ATOM 4423 CB VAL B 146 57.679 79.449 75.943 1.00 46.93 C
ATOM 4424 CG1 VAL B 146 57.243 79.754 74.528 1.00 45.46 C
ATOM 4425 CG2 VAL B 146 57.057 80.432 76.905 1.00 44.79 C
ATOM 4426 N ASP B 147 59.276 76.981 75.429 1.00 49.90 N
ATOM 4427 CA ASP B 147 60.043 76.121 74.552 1.00 49.85 C
ATOM 4428 C ASP B 147 59.512 74.697 74.585 1.00 48.41 C
ATOM 4429 O ASP B 147 59.353 74.044 73.543 1.00 47.65 O
ATOM 4430 CB ASP B 147 61.513 76.133 74.973 1.00 54.08 C
ATOM 4431 CG ASP B 147 62.414 75.441 73.956 1.00 57.85 C
ATOM 4432 OD1 ASP B 147 62.404 75.882 72.782 1.00 59.44 O
ATOM 4433 OD2 ASP B 147 63.121 74.463 74.324 1.00 58.63 O
ATOM 4434 N LYS B 148 59.241 74.227 75.797 1.00 46.00 N
ATOM 4435 CA LYS B 148 58.737 72.886 76.007 1.00 45.24 C
ATOM 4436 C LYS B 148 57.313 72.718 75.457 1.00 45.31 C
ATOM 4437 O LYS B 148 57.003 71.703 74.824 1.00 43.51 O
ATOM 4438 CB LYS B 148 58.793 72.557 77.502 1.00 43.85 C
ATOM 4439 CG LYS B 148 58.266 71.178 77.859 1.00 45.62 C
ATOM 4440 CD LYS B 148 58.700 70.764 79.258 1.00 45.97 C
ATOM 4441 CE LYS B 148 58.153 69.405 79.627 1.00 46.03 C
ATOM 4442 NZ LYS B 148 58.603 69.000 80.982 1.00 49.91 N
ATOM 4443 N ALA B 149 56.458 73.716 75.695 1.00 45.85 N
ATOM 4444 CA ALA B 149 55.072 73.685 75.220 1.00 44.79 C
ATOM 4445 C ALA B 149 54.996 73.547 73.693 1.00 44.72 C
ATOM 4446 O ALA B 149 54.174 72.787 73.174 1.00 44.88 O
ATOM 4447 CB ALA B 149 54.334 74.936 75.671 1.00 40.42 C
ATOM 4448 N VAL B 150 55.839 74.271 72.966 1.00 44.02 N
ATOM 4449 CA VAL B 150 55.791 74.150 71.524 1.00 47.56 C
ATOM 4450 C VAL B 150 56.332 72.781 71.083 1.00 48.64 C
ATOM 4451 O VAL B 150 55.773 72.141 70.191 1.00 49.03 O
ATOM 4452 CB VAL B 150 56.577 75.289 70.815 1.00 48.31 C
ATOM 4453 CG1 VAL B 150 56.098 76.632 71.317 1.00 50.82 C
ATOM 4454 CG2 VAL B 150 58.067 75.147 71.048 1.00 51.95 C
ATOM 4455 N ALA B 151 57.408 72.321 71.712 1.00 49.21 N
ATOM 4456 CA ALA B 151 57.983 71.032 71.352 1.00 49.29 C
ATOM 4457 C ALA B 151 56.960 69.903 71.502 1.00 49.44 C
ATOM 4458 O ALA B 151 56.809 69.066 70.612 1.00 48.84 O
ATOM 4459 CB ALA B 151 59.192 70.753 72.212 1.00 48.85 C
ATOM 4460 N PHE B 152 56.245 69.901 72.621 1.00 50.13 N
ATOM 4461 CA PHE B 152 55.257 68.869 72.893 1.00 51.69 C
ATOM 4462 C PHE B 152 53.999 68.877 72.049 1.00 52.39 C
ATOM 4463 O PHE B 152 53.081 68.098 72.298 1.00 52.36 O
ATOM 4464 CB PHE B 152 54.883 68.878 74.372 1.00 52.40 C
ATOM 4465 CG PHE B 152 55.864 68.142 75.238 1.00 55.38 C
ATOM 4466 CD1 PHE B 152 57.199 68.540 75.297 1.00 56.33 C
ATOM 4467 CD2 PHE B 152 55.463 67.028 75.971 1.00 56.30 C
ATOM 4468 CE1 PHE B 152 58.121 67.833 76.072 1.00 56.86 C
ATOM 4469 CE2 PHE B 152 56.379 66.319 76.747 1.00 56.65 C
ATOM 4470 CZ PHE B 152 57.709 66.721 76.796 1.00 56.09 C
ATOM 4471 N GLN B 153 53.946 69.744 71.046 1.00 54.79 N
ATOM 4472 CA GLN B 153 52.773 69.783 70.179 1.00 55.66 C
ATOM 4473 C GLN B 153 52.788 68.565 69.271 1.00 55.89 C
ATOM 4474 O GLN B 153 51.741 68.154 68.755 1.00 57.87 O
ATOM 4475 CB GLN B 153 52.749 71.058 69.354 1.00 54.73 C
ATOM 4476 CG GLN B 153 52.837 72.288 70.212 1.00 58.26 C
ATOM 4477 CD GLN B 153 52.264 73.511 69.535 1.00 60.40 C
ATOM 4478 OE1 GLN B 153 51.049 73.629 69.374 1.00 62.37 O
ATOM 4479 NE2 GLN B 153 53.134 74.429 69.128 1.00 59.90 N
ATOM 4480 N SER B 154 53.982 67.997 69.085 1.00 54.69 N
ATOM 4481 CA SER B 154 54.167 66.788 68.286 1.00 52.57 C
ATOM 4482 C SER B 154 54.101 65.666 69.321 1.00 52.48 C
ATOM 4483 O SER B 154 54.894 65.646 70.264 1.00 52.57 O
ATOM 4484 CB SER B 154 55.548 66.782 67.631 1.00 53.07 C
ATOM 4485 OG SER B 154 55.864 68.024 67.026 1.00 49.81 O
ATOM 4486 N PRO B 155 53.144 64.730 69.180 1.00 52.16 N
ATOM 4487 CA PRO B 155 53.034 63.630 70.152 1.00 52.28 C
ATOM 4488 C PRO B 155 54.325 62.824 70.173 1.00 52.52 C
ATOM 4489 O PRO B 155 54.707 62.253 71.188 1.00 50.44 O
ATOM 4490 CB PRO B 155 51.849 62.821 69.623 1.00 51.04 C
ATOM 4491 CG PRO B 155 51.037 63.841 68.900 1.00 49.61 C
ATOM 4492 CD PRO B 155 52.088 64.627 68.163 1.00 50.32 C
ATOM 4493 N GLN B 156 54.966 62.797 69.010 1.00 55.04 N
ATOM 4494 CA GLN B 156 56.226 62.125 68.774 1.00 57.96 C
ATOM 4495 C GLN B 156 57.148 62.385 69.972 1.00 58.09 C
ATOM 4496 O GLN B 156 57.558 61.466 70.671 1.00 58.42 O
ATOM 4497 CB GLN B 156 56.810 62.690 67.471 1.00 62.20 C
ATOM 4498 CG GLN B 156 58.247 62.277 67.109 1.00 67.91 C
ATOM 4499 CD GLN B 156 58.950 63.277 66.153 1.00 69.73 C
ATOM 4500 OE1 GLN B 156 58.426 63.632 65.085 1.00 69.72 O
ATOM 4501 NE2 GLN B 156 60.141 63.726 66.548 1.00 69.72 N
ATOM 4502 N VAL B 157 57.438 63.651 70.227 1.00 59.15 N
ATOM 4503 CA VAL B 157 58.304 64.051 71.333 1.00 60.16 C
ATOM 4504 C VAL B 157 57.913 63.499 72.715 1.00 60.42 C
ATOM 4505 O VAL B 157 58.771 63.067 73.483 1.00 62.07 O
ATOM 4506 CB VAL B 157 58.365 65.585 71.429 1.00 60.72 C
ATOM 4507 CG1 VAL B 157 57.098 66.101 72.072 1.00 62.52 C
ATOM 4508 CG2 VAL B 157 59.594 66.023 72.208 1.00 61.08 C
ATOM 4509 N GLY B 158 56.625 63.517 73.035 1.00 60.26 N
ATOM 4510 CA GLY B 158 56.184 63.032 74.328 1.00 59.36 C
ATOM 4511 C GLY B 158 56.440 61.563 74.570 1.00 60.02 C
ATOM 4512 O GLY B 158 56.911 61.183 75.640 1.00 60.93 O
ATOM 4513 N VAL B 159 56.135 60.722 73.591 1.00 60.46 N
ATOM 4514 CA VAL B 159 56.350 59.293 73.768 1.00 61.70 C
ATOM 4515 C VAL B 159 57.831 58.923 73.783 1.00 62.63 C
ATOM 4516 O VAL B 159 58.231 57.994 74.483 1.00 62.60 O
ATOM 4517 CB VAL B 159 55.641 58.476 72.684 1.00 61.16 C
ATOM 4518 CG1 VAL B 159 54.165 58.799 72.688 1.00 62.78 C
ATOM 4519 CG2 VAL B 159 56.243 58.766 71.345 1.00 62.09 C
ATOM 4520 N LEU B 160 58.651 59.637 73.019 1.00 63.22 N
ATOM 4521 CA LEU B 160 60.077 59.342 73.018 1.00 63.86 C
ATOM 4522 C LEU B 160 60.669 59.659 74.388 1.00 64.93 C
ATOM 4523 O LEU B 160 61.584 58.970 74.848 1.00 64.51 O
ATOM 4524 CB LEU B 160 60.807 60.141 71.936 1.00 63.80 C
ATOM 4525 CG LEU B 160 60.473 59.720 70.499 1.00 63.86 C
ATOM 4526 CD1 LEU B 160 61.536 60.273 69.557 1.00 61.94 C
ATOM 4527 CD2 LEU B 160 60.402 58.196 70.398 1.00 61.55 C
ATOM 4528 N GLU B 161 60.145 60.701 75.034 1.00 65.61 N
ATOM 4529 CA GLU B 161 60.608 61.083 76.365 1.00 65.15 C
ATOM 4530 C GLU B 161 60.293 59.936 77.300 1.00 63.87 C
ATOM 4531 O GLU B 161 61.166 59.468 78.025 1.00 64.05 O
ATOM 4532 CB GLU B 161 59.893 62.340 76.861 1.00 66.41 C
ATOM 4533 CG GLU B 161 60.356 63.643 76.223 1.00 71.16 C
ATOM 4534 CD GLU B 161 61.710 64.121 76.736 1.00 73.25 C
ATOM 4535 OE1 GLU B 161 62.742 63.566 76.297 1.00 73.52 O
ATOM 4536 OE2 GLU B 161 61.733 65.051 77.584 1.00 75.17 O
ATOM 4537 N ASN B 162 59.039 59.489 77.271 1.00 62.81 N
ATOM 4538 CA ASN B 162 58.589 58.388 78.112 1.00 62.03 C
ATOM 4539 C ASN B 162 59.281 57.089 77.740 1.00 61.24 C
ATOM 4540 O ASN B 162 59.497 56.227 78.592 1.00 60.31 O
ATOM 4541 CB ASN B 162 57.078 58.191 77.987 1.00 63.03 C
ATOM 4542 CG ASN B 162 56.295 59.301 78.644 1.00 63.64 C
ATOM 4543 OD1 ASN B 162 56.669 59.781 79.710 1.00 65.10 O
ATOM 4544 ND2 ASN B 162 55.194 59.705 78.023 1.00 63.92 N
ATOM 4545 N LEU B 163 59.614 56.948 76.460 1.00 60.65 N
ATOM 4546 CA LEU B 163 60.288 55.750 75.981 1.00 59.52 C
ATOM 4547 C LEU B 163 61.621 55.610 76.703 1.00 59.37 C
ATOM 4548 O LEU B 163 61.863 54.602 77.360 1.00 60.13 O
ATOM 4549 CB LEU B 163 60.524 55.830 74.475 1.00 59.29 C
ATOM 4550 CG LEU B 163 60.980 54.518 73.835 1.00 59.29 C
ATOM 4551 CD1 LEU B 163 59.869 53.482 73.931 1.00 59.41 C
ATOM 4552 CD2 LEU B 163 61.351 54.759 72.389 1.00 58.26 C
ATOM 4553 N HIS B 164 62.484 56.619 76.588 1.00 57.74 N
ATOM 4554 CA HIS B 164 63.776 56.588 77.266 1.00 57.14 C
ATOM 4555 C HIS B 164 63.616 56.423 78.786 1.00 57.52 C
ATOM 4556 O HIS B 164 64.496 55.904 79.461 1.00 57.91 O
ATOM 4557 CB HIS B 164 64.561 57.867 76.980 1.00 56.79 C
ATOM 4558 CG HIS B 164 65.004 58.001 75.555 1.00 58.60 C
ATOM 4559 ND1 HIS B 164 64.124 57.959 74.494 1.00 60.22 N
ATOM 4560 CD2 HIS B 164 66.232 58.189 75.016 1.00 58.35 C
ATOM 4561 CE1 HIS B 164 64.792 58.114 73.364 1.00 59.33 C
ATOM 4562 NE2 HIS B 164 66.073 58.255 73.653 1.00 58.28 N
ATOM 4563 N ALA B 165 62.492 56.868 79.327 1.00 57.18 N
ATOM 4564 CA ALA B 165 62.257 56.745 80.753 1.00 57.35 C
ATOM 4565 C ALA B 165 61.877 55.310 81.094 1.00 57.97 C
ATOM 4566 O ALA B 165 62.026 54.874 82.233 1.00 57.77 O
ATOM 4567 CB ALA B 165 61.146 57.698 81.188 1.00 57.20 C
ATOM 4568 N ALA B 166 61.371 54.580 80.107 1.00 59.05 N
ATOM 4569 CA ALA B 166 60.976 53.192 80.323 1.00 61.04 C
ATOM 4570 C ALA B 166 62.120 52.273 79.921 1.00 62.04 C
ATOM 4571 O ALA B 166 62.282 51.187 80.464 1.00 62.58 O
ATOM 4572 CB ALA B 166 59.731 52.861 79.505 1.00 60.63 C
ATOM 4573 N ALA B 167 62.923 52.724 78.971 1.00 62.99 N
ATOM 4574 CA ALA B 167 64.037 51.928 78.501 1.00 64.19 C
ATOM 4575 C ALA B 167 65.178 51.913 79.499 1.00 65.78 C
ATOM 4576 O ALA B 167 65.852 50.899 79.647 1.00 67.51 O
ATOM 4577 CB ALA B 167 64.529 52.453 77.169 1.00 62.95 C
ATOM 4578 N TYR B 168 65.402 53.021 80.194 1.00 66.29 N
ATOM 4579 CA TYR B 168 66.509 53.065 81.141 1.00 67.39 C
ATOM 4580 C TYR B 168 66.114 53.414 82.564 1.00 68.59 C
ATOM 4581 O TYR B 168 64.990 53.835 82.824 1.00 69.43 O
ATOM 4582 CB TYR B 168 67.569 54.051 80.655 1.00 66.19 C
ATOM 4583 CG TYR B 168 68.060 53.765 79.257 1.00 67.21 C
ATOM 4584 CD1 TYR B 168 67.289 54.086 78.146 1.00 67.68 C
ATOM 4585 CD2 TYR B 168 69.288 53.145 79.042 1.00 68.45 C
ATOM 4586 CE1 TYR B 168 67.730 53.795 76.849 1.00 67.85 C
ATOM 4587 CE2 TYR B 168 69.739 52.847 77.749 1.00 67.37 C
ATOM 4588 CZ TYR B 168 68.956 53.174 76.661 1.00 67.38 C
ATOM 4589 OH TYR B 168 69.395 52.870 75.391 1.00 65.96 O
ATOM 4590 N LYS B 169 67.051 53.212 83.485 1.00 69.74 N
ATOM 4591 CA LYS B 169 66.834 53.529 84.891 1.00 71.46 C
ATOM 4592 C LYS B 169 67.650 54.774 85.190 1.00 72.24 C
ATOM 4593 O LYS B 169 67.400 55.474 86.167 1.00 72.95 O
ATOM 4594 CB LYS B 169 67.325 52.401 85.804 1.00 72.07 C
ATOM 4595 CG LYS B 169 66.506 51.131 85.772 1.00 73.40 C
ATOM 4596 CD LYS B 169 67.064 50.123 86.762 1.00 74.45 C
ATOM 4597 CE LYS B 169 66.266 48.830 86.753 1.00 75.46 C
ATOM 4598 NZ LYS B 169 66.764 47.835 87.758 1.00 75.58 N
ATOM 4599 N THR B 170 68.631 55.048 84.338 1.00 72.88 N
ATOM 4600 CA THR B 170 69.490 56.203 84.542 1.00 74.00 C
ATOM 4601 C THR B 170 70.050 56.808 83.257 1.00 73.83 C
ATOM 4602 O THR B 170 69.772 56.334 82.150 1.00 74.51 O
ATOM 4603 CB THR B 170 70.675 55.836 85.459 1.00 74.99 C
ATOM 4604 OG1 THR B 170 71.277 54.620 84.993 1.00 76.69 O
ATOM 4605 CG2 THR B 170 70.205 55.657 86.893 1.00 74.19 C
ATOM 4606 N ALA B 171 70.846 57.863 83.436 1.00 73.23 N
ATOM 4607 CA ALA B 171 71.504 58.600 82.351 1.00 71.87 C
ATOM 4608 C ALA B 171 70.608 58.917 81.151 1.00 69.69 C
ATOM 4609 O ALA B 171 70.030 59.997 81.066 1.00 67.82 O
ATOM 4610 CB ALA B 171 72.770 57.840 81.885 1.00 71.59 C
ATOM 4611 N LEU B 172 70.511 57.972 80.224 1.00 68.40 N
ATOM 4612 CA LEU B 172 69.703 58.163 79.038 1.00 67.41 C
ATOM 4613 C LEU B 172 68.220 58.247 79.370 1.00 67.90 C
ATOM 4614 O LEU B 172 67.409 58.685 78.543 1.00 67.81 O
ATOM 4615 CB LEU B 172 69.954 57.026 78.050 1.00 66.06 C
ATOM 4616 CG LEU B 172 71.332 57.014 77.385 1.00 64.14 C
ATOM 4617 CD1 LEU B 172 71.430 55.786 76.499 1.00 64.04 C
ATOM 4618 CD2 LEU B 172 71.552 58.276 76.569 1.00 61.49 C
ATOM 4619 N ALA B 173 67.863 57.831 80.582 1.00 67.03 N
ATOM 4620 CA ALA B 173 66.468 57.867 80.994 1.00 65.52 C
ATOM 4621 C ALA B 173 66.044 59.304 81.210 1.00 64.88 C
ATOM 4622 O ALA B 173 64.864 59.623 81.114 1.00 65.65 O
ATOM 4623 CB ALA B 173 66.272 57.065 82.267 1.00 65.25 C
ATOM 4624 N ASN B 174 67.013 60.166 81.507 1.00 64.48 N
ATOM 4625 CA ASN B 174 66.742 61.582 81.728 1.00 64.20 C
ATOM 4626 C ASN B 174 66.059 62.223 80.523 1.00 64.04 C
ATOM 4627 O ASN B 174 66.446 61.982 79.378 1.00 65.32 O
ATOM 4628 CB ASN B 174 68.039 62.330 82.033 1.00 63.72 C
ATOM 4629 CG ASN B 174 68.620 61.940 83.373 1.00 64.09 C
ATOM 4630 OD1 ASN B 174 67.907 61.394 84.224 1.00 63.39 O
ATOM 4631 ND2 ASN B 174 69.908 62.230 83.582 1.00 61.34 N
ATOM 4632 N PRO B 175 65.025 63.050 80.769 1.00 63.08 N
ATOM 4633 CA PRO B 175 64.278 63.733 79.705 1.00 61.14 C
ATOM 4634 C PRO B 175 65.105 64.811 79.008 1.00 59.71 C
ATOM 4635 O PRO B 175 65.978 65.428 79.617 1.00 59.82 O
ATOM 4636 CB PRO B 175 63.086 64.305 80.453 1.00 60.57 C
ATOM 4637 CG PRO B 175 63.674 64.631 81.785 1.00 60.57 C
ATOM 4638 CD PRO B 175 64.478 63.400 82.092 1.00 61.79 C
ATOM 4639 N LEU B 176 64.824 65.032 77.731 1.00 59.00 N
ATOM 4640 CA LEU B 176 65.550 66.021 76.946 1.00 58.81 C
ATOM 4641 C LEU B 176 65.064 67.447 77.234 1.00 58.80 C
ATOM 4642 O LEU B 176 65.761 68.432 76.935 1.00 59.05 O
ATOM 4643 CB LEU B 176 65.406 65.700 75.458 1.00 58.84 C
ATOM 4644 CG LEU B 176 66.288 66.503 74.500 1.00 61.75 C
ATOM 4645 CD1 LEU B 176 67.767 66.299 74.845 1.00 61.59 C
ATOM 4646 CD2 LEU B 176 65.998 66.069 73.066 1.00 61.85 C
ATOM 4647 N TYR B 177 63.864 67.550 77.809 1.00 57.06 N
ATOM 4648 CA TYR B 177 63.285 68.843 78.159 1.00 55.03 C
ATOM 4649 C TYR B 177 63.103 68.910 79.662 1.00 54.91 C
ATOM 4650 O TYR B 177 62.611 67.970 80.285 1.00 55.16 O
ATOM 4651 CB TYR B 177 61.932 69.066 77.453 1.00 52.39 C
ATOM 4652 CG TYR B 177 62.045 69.227 75.953 1.00 48.88 C
ATOM 4653 CD1 TYR B 177 61.989 68.125 75.107 1.00 48.45 C
ATOM 4654 CD2 TYR B 177 62.264 70.475 75.384 1.00 48.44 C
ATOM 4655 CE1 TYR B 177 62.151 68.259 73.723 1.00 47.80 C
ATOM 4656 CE2 TYR B 177 62.431 70.624 74.005 1.00 48.58 C
ATOM 4657 CZ TYR B 177 62.372 69.509 73.180 1.00 48.43 C
ATOM 4658 OH TYR B 177 62.512 69.640 71.814 1.00 48.94 O
ATOM 4659 N CYS B 178 63.507 70.032 80.239 1.00 55.04 N
ATOM 4660 CA CYS B 178 63.403 70.249 81.677 1.00 55.85 C
ATOM 4661 C CYS B 178 62.046 69.903 82.296 1.00 55.86 C
ATOM 4662 O CYS B 178 61.016 70.445 81.907 1.00 55.57 O
ATOM 4663 CB CYS B 178 63.736 71.707 81.996 1.00 54.69 C
ATOM 4664 SG CYS B 178 63.456 72.149 83.716 1.00 56.88 S
ATOM 4665 N PRO B 179 62.028 68.981 83.265 1.00 56.76 N
ATOM 4666 CA PRO B 179 60.753 68.629 83.895 1.00 57.59 C
ATOM 4667 C PRO B 179 60.112 69.876 84.494 1.00 58.32 C
ATOM 4668 O PRO B 179 60.810 70.834 84.849 1.00 58.37 O
ATOM 4669 CB PRO B 179 61.156 67.607 84.962 1.00 56.85 C
ATOM 4670 CG PRO B 179 62.597 67.905 85.217 1.00 57.32 C
ATOM 4671 CD PRO B 179 63.129 68.196 83.838 1.00 56.88 C
ATOM 4672 N ASP B 180 58.789 69.852 84.612 1.00 58.34 N
ATOM 4673 CA ASP B 180 58.038 70.988 85.124 1.00 58.44 C
ATOM 4674 C ASP B 180 58.370 71.449 86.534 1.00 57.98 C
ATOM 4675 O ASP B 180 58.510 72.650 86.777 1.00 58.75 O
ATOM 4676 CB ASP B 180 56.539 70.705 85.028 1.00 60.24 C
ATOM 4677 CG ASP B 180 56.084 70.425 83.601 1.00 61.41 C
ATOM 4678 OD1 ASP B 180 56.903 70.595 82.668 1.00 61.87 O
ATOM 4679 OD2 ASP B 180 54.904 70.040 83.417 1.00 61.33 O
ATOM 4680 N TYR B 181 58.499 70.517 87.469 1.00 57.27 N
ATOM 4681 CA TYR B 181 58.790 70.901 88.846 1.00 57.17 C
ATOM 4682 C TYR B 181 60.105 71.660 88.989 1.00 56.89 C
ATOM 4683 O TYR B 181 60.353 72.298 90.008 1.00 56.06 O
ATOM 4684 CB TYR B 181 58.783 69.671 89.766 1.00 58.06 C
ATOM 4685 CG TYR B 181 60.059 68.849 89.784 1.00 60.44 C
ATOM 4686 CD1 TYR B 181 61.133 69.206 90.598 1.00 61.21 C
ATOM 4687 CD2 TYR B 181 60.173 67.684 89.023 1.00 61.77 C
ATOM 4688 CE1 TYR B 181 62.287 68.420 90.661 1.00 62.61 C
ATOM 4689 CE2 TYR B 181 61.323 66.893 89.077 1.00 63.21 C
ATOM 4690 CZ TYR B 181 62.375 67.261 89.899 1.00 62.95 C
ATOM 4691 OH TYR B 181 63.496 66.457 89.967 1.00 62.35 O
ATOM 4692 N ARG B 182 60.947 71.614 87.967 1.00 57.58 N
ATOM 4693 CA ARG B 182 62.213 72.315 88.064 1.00 58.52 C
ATOM 4694 C ARG B 182 62.310 73.623 87.316 1.00 59.58 C
ATOM 4695 O ARG B 182 63.313 74.327 87.442 1.00 59.59 O
ATOM 4696 CB ARG B 182 63.370 71.391 87.677 1.00 58.57 C
ATOM 4697 CG ARG B 182 63.837 70.556 88.872 1.00 57.75 C
ATOM 4698 CD ARG B 182 65.085 69.764 88.583 1.00 56.07 C
ATOM 4699 NE ARG B 182 66.259 70.601 88.332 1.00 52.06 N
ATOM 4700 CZ ARG B 182 66.794 71.442 89.210 1.00 50.28 C
ATOM 4701 NH1 ARG B 182 66.266 71.591 90.416 1.00 48.01 N
ATOM 4702 NH2 ARG B 182 67.888 72.111 88.888 1.00 50.92 N
ATOM 4703 N ILE B 183 61.280 73.955 86.541 1.00 60.76 N
ATOM 4704 CA ILE B 183 61.275 75.220 85.818 1.00 61.07 C
ATOM 4705 C ILE B 183 61.317 76.294 86.908 1.00 62.05 C
ATOM 4706 O ILE B 183 60.440 76.343 87.776 1.00 61.00 O
ATOM 4707 CB ILE B 183 59.980 75.424 85.012 1.00 61.26 C
ATOM 4708 CG1 ILE B 183 59.740 74.251 84.061 1.00 61.23 C
ATOM 4709 CG2 ILE B 183 60.070 76.718 84.226 1.00 61.58 C
ATOM 4710 CD1 ILE B 183 60.612 74.254 82.837 1.00 61.71 C
ATOM 4711 N GLY B 184 62.345 77.136 86.870 1.00 63.20 N
ATOM 4712 CA GLY B 184 62.477 78.191 87.859 1.00 63.59 C
ATOM 4713 C GLY B 184 63.426 77.862 88.998 1.00 64.08 C
ATOM 4714 O GLY B 184 63.862 78.758 89.724 1.00 63.62 O
ATOM 4715 N LYS B 185 63.764 76.583 89.146 1.00 64.26 N
ATOM 4716 CA LYS B 185 64.645 76.142 90.220 1.00 63.52 C
ATOM 4717 C LYS B 185 66.119 75.937 89.872 1.00 62.96 C
ATOM 4718 O LYS B 185 66.961 75.860 90.764 1.00 62.58 O
ATOM 4719 CB LYS B 185 64.071 74.876 90.830 1.00 63.07 C
ATOM 4720 CG LYS B 185 62.730 75.119 91.466 1.00 64.50 C
ATOM 4721 CD LYS B 185 62.187 73.845 92.022 1.00 67.04 C
ATOM 4722 CE LYS B 185 60.870 74.072 92.719 1.00 69.19 C
ATOM 4723 NZ LYS B 185 60.314 72.761 93.166 1.00 71.05 N
ATOM 4724 N ILE B 186 66.432 75.846 88.586 1.00 63.13 N
ATOM 4725 CA ILE B 186 67.813 75.672 88.149 1.00 63.07 C
ATOM 4726 C ILE B 186 68.565 76.924 88.591 1.00 65.20 C
ATOM 4727 O ILE B 186 68.004 78.016 88.571 1.00 66.12 O
ATOM 4728 CB ILE B 186 67.865 75.520 86.621 1.00 61.48 C
ATOM 4729 CG1 ILE B 186 67.053 74.280 86.223 1.00 60.25 C
ATOM 4730 CG2 ILE B 186 69.303 75.444 86.142 1.00 60.25 C
ATOM 4731 CD1 ILE B 186 66.812 74.117 84.737 1.00 58.21 C
ATOM 4732 N THR B 187 69.822 76.781 89.000 1.00 66.28 N
ATOM 4733 CA THR B 187 70.584 77.941 89.467 1.00 66.86 C
ATOM 4734 C THR B 187 71.776 78.270 88.575 1.00 67.86 C
ATOM 4735 O THR B 187 72.161 77.464 87.722 1.00 67.40 O
ATOM 4736 CB THR B 187 71.103 77.710 90.898 1.00 66.54 C
ATOM 4737 OG1 THR B 187 72.114 76.693 90.884 1.00 68.07 O
ATOM 4738 CG2 THR B 187 69.977 77.252 91.796 1.00 65.72 C
ATOM 4739 N SER B 188 72.353 79.457 88.770 1.00 68.61 N
ATOM 4740 CA SER B 188 73.522 79.870 87.992 1.00 69.95 C
ATOM 4741 C SER B 188 74.684 78.952 88.361 1.00 70.86 C
ATOM 4742 O SER B 188 75.539 78.631 87.526 1.00 71.03 O
ATOM 4743 CB SER B 188 73.900 81.315 88.307 1.00 70.13 C
ATOM 4744 OG SER B 188 72.918 82.217 87.839 1.00 70.38 O
ATOM 4745 N GLU B 189 74.697 78.540 89.627 1.00 70.72 N
ATOM 4746 CA GLU B 189 75.717 77.640 90.145 1.00 70.19 C
ATOM 4747 C GLU B 189 75.674 76.360 89.316 1.00 67.82 C
ATOM 4748 O GLU B 189 76.689 75.913 88.782 1.00 67.41 O
ATOM 4749 CB GLU B 189 75.424 77.317 91.616 1.00 73.25 C
ATOM 4750 CG GLU B 189 76.592 76.688 92.378 1.00 78.56 C
ATOM 4751 CD GLU B 189 77.780 77.647 92.545 1.00 82.87 C
ATOM 4752 OE1 GLU B 189 78.819 77.226 93.117 1.00 84.46 O
ATOM 4753 OE2 GLU B 189 77.673 78.822 92.107 1.00 84.41 O
ATOM 4754 N GLN B 190 74.483 75.784 89.202 1.00 64.88 N
ATOM 4755 CA GLN B 190 74.306 74.559 88.448 1.00 63.74 C
ATOM 4756 C GLN B 190 74.721 74.707 86.988 1.00 64.22 C
ATOM 4757 O GLN B 190 75.284 73.782 86.400 1.00 64.27 O
ATOM 4758 CB GLN B 190 72.854 74.097 88.533 1.00 62.29 C
ATOM 4759 CG GLN B 190 72.417 73.703 89.926 1.00 61.46 C
ATOM 4760 CD GLN B 190 70.991 73.189 89.961 1.00 61.91 C
ATOM 4761 OE1 GLN B 190 70.055 73.900 89.605 1.00 64.04 O
ATOM 4762 NE2 GLN B 190 70.817 71.948 90.391 1.00 62.37 N
ATOM 4763 N LEU B 191 74.445 75.864 86.400 1.00 64.62 N
ATOM 4764 CA LEU B 191 74.817 76.091 85.009 1.00 66.26 C
ATOM 4765 C LEU B 191 76.326 76.165 84.892 1.00 66.77 C
ATOM 4766 O LEU B 191 76.911 75.609 83.961 1.00 66.65 O
ATOM 4767 CB LEU B 191 74.190 77.383 84.471 1.00 66.32 C
ATOM 4768 CG LEU B 191 72.669 77.370 84.254 1.00 65.41 C
ATOM 4769 CD1 LEU B 191 72.221 78.756 83.839 1.00 64.36 C
ATOM 4770 CD2 LEU B 191 72.283 76.324 83.201 1.00 62.71 C
ATOM 4771 N HIS B 192 76.954 76.856 85.839 1.00 68.19 N
ATOM 4772 CA HIS B 192 78.409 76.975 85.845 1.00 68.24 C
ATOM 4773 C HIS B 192 79.045 75.610 86.044 1.00 68.32 C
ATOM 4774 O HIS B 192 79.873 75.187 85.235 1.00 67.93 O
ATOM 4775 CB HIS B 192 78.880 77.923 86.949 1.00 67.74 C
ATOM 4776 CG HIS B 192 78.984 79.347 86.509 1.00 67.89 C
ATOM 4777 ND1 HIS B 192 78.141 80.337 86.972 1.00 67.94 N
ATOM 4778 CD2 HIS B 192 79.802 79.940 85.607 1.00 67.92 C
ATOM 4779 CE1 HIS B 192 78.433 81.477 86.372 1.00 68.05 C
ATOM 4780 NE2 HIS B 192 79.436 81.263 85.537 1.00 68.36 N
ATOM 4781 N HIS B 193 78.647 74.916 87.108 1.00 67.98 N
ATOM 4782 CA HIS B 193 79.208 73.606 87.383 1.00 69.08 C
ATOM 4783 C HIS B 193 79.015 72.643 86.222 1.00 68.75 C
ATOM 4784 O HIS B 193 79.883 71.816 85.957 1.00 70.07 O
ATOM 4785 CB HIS B 193 78.613 73.012 88.664 1.00 71.16 C
ATOM 4786 CG HIS B 193 78.924 73.807 89.894 1.00 73.76 C
ATOM 4787 ND1 HIS B 193 79.987 74.685 89.966 1.00 75.31 N
ATOM 4788 CD2 HIS B 193 78.312 73.860 91.101 1.00 74.60 C
ATOM 4789 CE1 HIS B 193 80.014 75.248 91.161 1.00 74.65 C
ATOM 4790 NE2 HIS B 193 79.008 74.765 91.870 1.00 75.52 N
ATOM 4791 N PHE B 194 77.892 72.744 85.519 1.00 67.43 N
ATOM 4792 CA PHE B 194 77.663 71.847 84.393 1.00 65.54 C
ATOM 4793 C PHE B 194 78.688 72.141 83.307 1.00 66.08 C
ATOM 4794 O PHE B 194 79.329 71.233 82.786 1.00 66.15 O
ATOM 4795 CB PHE B 194 76.257 72.020 83.826 1.00 62.66 C
ATOM 4796 CG PHE B 194 75.846 70.917 82.889 1.00 58.60 C
ATOM 4797 CD1 PHE B 194 75.310 69.728 83.384 1.00 55.94 C
ATOM 4798 CD2 PHE B 194 76.017 71.055 81.512 1.00 56.86 C
ATOM 4799 CE1 PHE B 194 74.950 68.690 82.517 1.00 55.26 C
ATOM 4800 CE2 PHE B 194 75.662 70.026 80.636 1.00 55.07 C
ATOM 4801 CZ PHE B 194 75.128 68.841 81.138 1.00 54.65 C
ATOM 4802 N VAL B 195 78.845 73.417 82.978 1.00 67.48 N
ATOM 4803 CA VAL B 195 79.802 73.833 81.957 1.00 69.05 C
ATOM 4804 C VAL B 195 81.237 73.471 82.341 1.00 69.65 C
ATOM 4805 O VAL B 195 82.017 73.003 81.509 1.00 70.18 O
ATOM 4806 CB VAL B 195 79.724 75.353 81.717 1.00 68.28 C
ATOM 4807 CG1 VAL B 195 80.898 75.819 80.864 1.00 69.39 C
ATOM 4808 CG2 VAL B 195 78.424 75.682 81.032 1.00 68.69 C
ATOM 4809 N GLN B 196 81.577 73.692 83.604 1.00 70.16 N
ATOM 4810 CA GLN B 196 82.917 73.404 84.103 1.00 69.82 C
ATOM 4811 C GLN B 196 83.218 71.917 84.080 1.00 69.40 C
ATOM 4812 O GLN B 196 84.309 71.507 83.678 1.00 69.99 O
ATOM 4813 CB GLN B 196 83.075 73.918 85.537 1.00 69.88 C
ATOM 4814 CG GLN B 196 82.696 75.378 85.714 1.00 71.25 C
ATOM 4815 CD GLN B 196 82.644 75.813 87.174 1.00 72.42 C
ATOM 4816 OE1 GLN B 196 82.273 75.037 88.060 1.00 72.52 O
ATOM 4817 NE2 GLN B 196 82.995 77.068 87.426 1.00 73.08 N
ATOM 4818 N ASN B 197 82.253 71.107 84.500 1.00 68.81 N
ATOM 4819 CA ASN B 197 82.459 69.670 84.549 1.00 69.10 C
ATOM 4820 C ASN B 197 82.132 68.925 83.265 1.00 69.45 C
ATOM 4821 O ASN B 197 82.167 67.697 83.254 1.00 70.84 O
ATOM 4822 CB ASN B 197 81.657 69.050 85.700 1.00 68.81 C
ATOM 4823 CG ASN B 197 81.857 69.781 87.022 1.00 69.85 C
ATOM 4824 OD1 ASN B 197 82.836 70.505 87.207 1.00 70.17 O
ATOM 4825 ND2 ASN B 197 80.927 69.584 87.953 1.00 69.79 N
ATOM 4826 N ASN B 198 81.835 69.636 82.183 1.00 69.28 N
ATOM 4827 CA ASN B 198 81.493 68.951 80.937 1.00 70.25 C
ATOM 4828 C ASN B 198 82.065 69.586 79.670 1.00 72.17 C
ATOM 4829 O ASN B 198 82.372 68.889 78.699 1.00 71.73 O
ATOM 4830 CB ASN B 198 79.969 68.836 80.820 1.00 68.67 C
ATOM 4831 CG ASN B 198 79.380 67.832 81.797 1.00 66.93 C
ATOM 4832 OD1 ASN B 198 79.517 66.626 81.612 1.00 67.56 O
ATOM 4833 ND2 ASN B 198 78.729 68.326 82.845 1.00 64.28 N
ATOM 4834 N PHE B 199 82.196 70.907 79.672 1.00 74.78 N
ATOM 4835 CA PHE B 199 82.738 71.617 78.519 1.00 78.44 C
ATOM 4836 C PHE B 199 84.260 71.688 78.656 1.00 80.28 C
ATOM 4837 O PHE B 199 84.843 72.763 78.820 1.00 80.08 O
ATOM 4838 CB PHE B 199 82.143 73.027 78.435 1.00 79.93 C
ATOM 4839 CG PHE B 199 80.722 73.065 77.934 1.00 80.79 C
ATOM 4840 CD1 PHE B 199 79.824 72.047 78.248 1.00 81.27 C
ATOM 4841 CD2 PHE B 199 80.275 74.135 77.163 1.00 81.05 C
ATOM 4842 CE1 PHE B 199 78.503 72.094 77.800 1.00 82.03 C
ATOM 4843 CE2 PHE B 199 78.957 74.192 76.712 1.00 81.45 C
ATOM 4844 CZ PHE B 199 78.069 73.169 77.031 1.00 81.49 C
ATOM 4845 N THR B 200 84.887 70.519 78.590 1.00 82.18 N
ATOM 4846 CA THR B 200 86.334 70.376 78.705 1.00 82.24 C
ATOM 4847 C THR B 200 86.947 70.101 77.323 1.00 83.57 C
ATOM 4848 O THR B 200 86.340 69.423 76.485 1.00 83.21 O
ATOM 4849 CB THR B 200 86.671 69.216 79.645 1.00 81.33 C
ATOM 4850 OG1 THR B 200 86.235 67.988 79.047 1.00 81.15 O
ATOM 4851 CG2 THR B 200 85.960 69.390 80.982 1.00 79.52 C
ATOM 4852 N SER B 201 88.155 70.615 77.100 1.00 84.86 N
ATOM 4853 CA SER B 201 88.851 70.461 75.818 1.00 85.15 C
ATOM 4854 C SER B 201 88.924 69.040 75.280 1.00 84.31 C
ATOM 4855 O SER B 201 89.002 68.844 74.072 1.00 84.25 O
ATOM 4856 CB SER B 201 90.272 71.015 75.918 1.00 86.04 C
ATOM 4857 OG SER B 201 91.098 70.152 76.677 1.00 89.08 O
ATOM 4858 N ALA B 202 88.904 68.055 76.173 1.00 84.30 N
ATOM 4859 CA ALA B 202 88.980 66.651 75.772 1.00 84.09 C
ATOM 4860 C ALA B 202 87.618 66.036 75.440 1.00 84.05 C
ATOM 4861 O ALA B 202 87.537 64.859 75.063 1.00 82.99 O
ATOM 4862 CB ALA B 202 89.661 65.843 76.865 1.00 84.64 C
ATOM 4863 N ARG B 203 86.557 66.834 75.594 1.00 84.12 N
ATOM 4864 CA ARG B 203 85.184 66.404 75.303 1.00 83.05 C
ATOM 4865 C ARG B 203 84.596 67.275 74.206 1.00 82.46 C
ATOM 4866 O ARG B 203 83.483 67.039 73.747 1.00 81.44 O
ATOM 4867 CB ARG B 203 84.312 66.520 76.548 1.00 82.52 C
ATOM 4868 CG ARG B 203 84.786 65.664 77.684 1.00 82.50 C
ATOM 4869 CD ARG B 203 83.992 65.904 78.942 1.00 82.30 C
ATOM 4870 NE ARG B 203 82.571 65.663 78.747 1.00 82.96 N
ATOM 4871 CZ ARG B 203 81.731 65.363 79.732 1.00 84.30 C
ATOM 4872 NH1 ARG B 203 82.173 65.260 80.976 1.00 84.61 N
ATOM 4873 NH2 ARG B 203 80.446 65.176 79.479 1.00 85.34 N
ATOM 4874 N MET B 204 85.367 68.275 73.792 1.00 82.65 N
ATOM 4875 CA MET B 204 84.954 69.217 72.762 1.00 83.47 C
ATOM 4876 C MET B 204 85.648 69.006 71.421 1.00 83.42 C
ATOM 4877 O MET B 204 86.662 68.310 71.331 1.00 84.14 O
ATOM 4878 CB MET B 204 85.222 70.645 73.232 1.00 84.29 C
ATOM 4879 CG MET B 204 84.323 71.123 74.354 1.00 85.88 C
ATOM 4880 SD MET B 204 84.951 72.643 75.114 1.00 88.08 S
ATOM 4881 CE MET B 204 84.816 73.809 73.747 1.00 88.29 C
ATOM 4882 N ALA B 205 85.089 69.634 70.388 1.00 82.65 N
ATOM 4883 CA ALA B 205 85.606 69.561 69.028 1.00 81.92 C
ATOM 4884 C ALA B 205 85.188 70.801 68.243 1.00 81.20 C
ATOM 4885 O ALA B 205 84.011 71.135 68.180 1.00 81.25 O
ATOM 4886 CB ALA B 205 85.082 68.306 68.333 1.00 81.49 C
ATOM 4887 N LEU B 206 86.159 71.482 67.649 1.00 80.73 N
ATOM 4888 CA LEU B 206 85.881 72.673 66.863 1.00 80.25 C
ATOM 4889 C LEU B 206 85.866 72.316 65.380 1.00 79.62 C
ATOM 4890 O LEU B 206 86.906 72.314 64.726 1.00 79.88 O
ATOM 4891 CB LEU B 206 86.950 73.738 67.120 1.00 81.09 C
ATOM 4892 CG LEU B 206 86.799 75.029 66.311 1.00 81.11 C
ATOM 4893 CD1 LEU B 206 85.500 75.715 66.718 1.00 81.98 C
ATOM 4894 CD2 LEU B 206 87.985 75.946 66.549 1.00 81.02 C
ATOM 4895 N VAL B 207 84.686 72.021 64.851 1.00 78.46 N
ATOM 4896 CA VAL B 207 84.551 71.659 63.443 1.00 77.96 C
ATOM 4897 C VAL B 207 84.093 72.841 62.585 1.00 78.94 C
ATOM 4898 O VAL B 207 83.346 73.691 63.055 1.00 79.85 O
ATOM 4899 CB VAL B 207 83.560 70.507 63.293 1.00 76.80 C
ATOM 4900 CG1 VAL B 207 83.419 70.118 61.834 1.00 75.92 C
ATOM 4901 CG2 VAL B 207 84.030 69.332 64.128 1.00 75.78 C
ATOM 4902 N GLY B 208 84.536 72.899 61.330 1.00 79.08 N
ATOM 4903 CA GLY B 208 84.144 74.007 60.475 1.00 79.69 C
ATOM 4904 C GLY B 208 84.118 73.699 58.992 1.00 80.97 C
ATOM 4905 O GLY B 208 84.829 72.822 58.513 1.00 81.08 O
ATOM 4906 N ILE B 209 83.286 74.422 58.254 1.00 82.17 N
ATOM 4907 CA ILE B 209 83.181 74.222 56.814 1.00 82.97 C
ATOM 4908 C ILE B 209 83.309 75.576 56.127 1.00 84.62 C
ATOM 4909 O ILE B 209 82.870 76.590 56.666 1.00 84.72 O
ATOM 4910 CB ILE B 209 81.829 73.596 56.424 1.00 81.87 C
ATOM 4911 CG1 ILE B 209 81.641 72.259 57.128 1.00 80.74 C
ATOM 4912 CG2 ILE B 209 81.784 73.357 54.936 1.00 82.07 C
ATOM 4913 CD1 ILE B 209 80.349 71.580 56.772 1.00 81.15 C
ATOM 4914 N GLY B 210 83.908 75.588 54.939 1.00 86.42 N
ATOM 4915 CA GLY B 210 84.081 76.834 54.215 1.00 88.62 C
ATOM 4916 C GLY B 210 85.198 77.652 54.828 1.00 90.40 C
ATOM 4917 O GLY B 210 85.275 78.870 54.654 1.00 89.76 O
ATOM 4918 N VAL B 211 86.062 76.966 55.563 1.00 92.62 N
ATOM 4919 CA VAL B 211 87.197 77.599 56.209 1.00 94.97 C
ATOM 4920 C VAL B 211 88.445 76.792 55.879 1.00 96.99 C
ATOM 4921 O VAL B 211 88.359 75.674 55.356 1.00 97.15 O
ATOM 4922 CB VAL B 211 87.015 77.645 57.738 1.00 94.30 C
ATOM 4923 CG1 VAL B 211 85.813 78.498 58.084 1.00 95.33 C
ATOM 4924 CG2 VAL B 211 86.839 76.240 58.285 1.00 93.75 C
ATOM 4925 N LYS B 212 89.606 77.366 56.170 1.00 98.53 N
ATOM 4926 CA LYS B 212 90.868 76.690 55.915 1.00 98.83 C
ATOM 4927 C LYS B 212 91.415 76.175 57.241 1.00 98.93 C
ATOM 4928 O LYS B 212 91.545 76.933 58.206 1.00 98.41 O
ATOM 4929 CB LYS B 212 91.866 77.649 55.271 1.00 99.39 C
ATOM 4930 CG LYS B 212 93.157 76.976 54.852 1.00101.57 C
ATOM 4931 CD LYS B 212 94.158 77.977 54.305 1.00102.26 C
ATOM 4932 CE LYS B 212 95.463 77.291 53.949 1.00102.45 C
ATOM 4933 NZ LYS B 212 96.493 78.276 53.537 1.00103.10 N
ATOM 4934 N HIS B 213 91.728 74.883 57.275 1.00 98.80 N
ATOM 4935 CA HIS B 213 92.247 74.231 58.470 1.00 99.01 C
ATOM 4936 C HIS B 213 93.240 75.079 59.254 1.00100.08 C
ATOM 4937 O HIS B 213 93.110 75.229 60.469 1.00 99.97 O
ATOM 4938 CB HIS B 213 92.914 72.911 58.099 1.00 98.02 C
ATOM 4939 CG HIS B 213 93.012 71.950 59.239 1.00 97.30 C
ATOM 4940 ND1 HIS B 213 91.932 71.223 59.689 1.00 97.17 N
ATOM 4941 CD2 HIS B 213 94.051 71.613 60.038 1.00 97.01 C
ATOM 4942 CE1 HIS B 213 92.300 70.480 60.715 1.00 96.65 C
ATOM 4943 NE2 HIS B 213 93.581 70.698 60.948 1.00 96.82 N
ATOM 4944 N SER B 214 94.238 75.621 58.560 1.00101.25 N
ATOM 4945 CA SER B 214 95.251 76.449 59.204 1.00102.23 C
ATOM 4946 C SER B 214 94.620 77.571 60.017 1.00103.24 C
ATOM 4947 O SER B 214 95.074 77.872 61.120 1.00103.63 O
ATOM 4948 CB SER B 214 96.202 77.031 58.156 1.00101.99 C
ATOM 4949 OG SER B 214 95.485 77.655 57.108 1.00101.92 O
ATOM 4950 N ASP B 215 93.568 78.180 59.471 1.00104.41 N
ATOM 4951 CA ASP B 215 92.864 79.267 60.147 1.00104.80 C
ATOM 4952 C ASP B 215 92.114 78.760 61.371 1.00105.80 C
ATOM 4953 O ASP B 215 92.328 79.245 62.482 1.00105.97 O
ATOM 4954 CB ASP B 215 91.871 79.939 59.197 1.00103.72 C
ATOM 4955 CG ASP B 215 92.551 80.770 58.135 1.00103.08 C
ATOM 4956 OD1 ASP B 215 93.243 81.744 58.493 1.00101.56 O
ATOM 4957 OD2 ASP B 215 92.391 80.449 56.939 1.00103.39 O
ATOM 4958 N LEU B 216 91.234 77.784 61.163 1.00107.09 N
ATOM 4959 CA LEU B 216 90.449 77.222 62.258 1.00108.72 C
ATOM 4960 C LEU B 216 91.392 76.674 63.316 1.00110.01 C
ATOM 4961 O LEU B 216 91.222 76.928 64.511 1.00109.83 O
ATOM 4962 CB LEU B 216 89.532 76.102 61.746 1.00108.45 C
ATOM 4963 CG LEU B 216 88.478 75.563 62.723 1.00108.09 C
ATOM 4964 CD1 LEU B 216 87.523 76.679 63.110 1.00107.80 C
ATOM 4965 CD2 LEU B 216 87.717 74.412 62.084 1.00107.24 C
ATOM 4966 N LYS B 217 92.392 75.925 62.861 1.00111.80 N
ATOM 4967 CA LYS B 217 93.379 75.337 63.755 1.00113.30 C
ATOM 4968 C LYS B 217 94.014 76.422 64.616 1.00114.08 C
ATOM 4969 O LYS B 217 94.210 76.244 65.818 1.00113.97 O
ATOM 4970 CB LYS B 217 94.460 74.615 62.943 1.00113.39 C
ATOM 4971 CG LYS B 217 95.561 73.990 63.789 1.00113.89 C
ATOM 4972 CD LYS B 217 96.562 73.231 62.935 1.00113.80 C
ATOM 4973 CE LYS B 217 97.630 72.572 63.795 1.00113.85 C
ATOM 4974 NZ LYS B 217 98.540 71.716 62.987 1.00113.45 N
ATOM 4975 N GLN B 218 94.321 77.554 63.994 1.00115.14 N
ATOM 4976 CA GLN B 218 94.939 78.660 64.702 1.00116.88 C
ATOM 4977 C GLN B 218 94.040 79.205 65.804 1.00118.18 C
ATOM 4978 O GLN B 218 94.479 79.376 66.941 1.00118.33 O
ATOM 4979 CB GLN B 218 95.288 79.770 63.717 1.00117.35 C
ATOM 4980 CG GLN B 218 96.027 80.934 64.340 1.00119.10 C
ATOM 4981 CD GLN B 218 96.654 81.841 63.300 1.00120.24 C
ATOM 4982 OE1 GLN B 218 95.964 82.395 62.443 1.00120.87 O
ATOM 4983 NE2 GLN B 218 97.973 81.993 63.366 1.00120.84 N
ATOM 4984 N VAL B 219 92.782 79.471 65.466 1.00119.49 N
ATOM 4985 CA VAL B 219 91.823 80.003 66.428 1.00120.90 C
ATOM 4986 C VAL B 219 91.772 79.147 67.689 1.00121.95 C
ATOM 4987 O VAL B 219 91.903 79.653 68.807 1.00121.97 O
ATOM 4988 CB VAL B 219 90.400 80.063 65.827 1.00121.14 C
ATOM 4989 CG1 VAL B 219 89.463 80.798 66.776 1.00121.10 C
ATOM 4990 CG2 VAL B 219 90.432 80.748 64.472 1.00121.29 C
ATOM 4991 N ALA B 220 91.586 77.846 67.496 1.00123.10 N
ATOM 4992 CA ALA B 220 91.500 76.902 68.600 1.00124.57 C
ATOM 4993 C ALA B 220 92.603 77.087 69.627 1.00125.89 C
ATOM 4994 O ALA B 220 92.367 77.598 70.723 1.00125.97 O
ATOM 4995 CB ALA B 220 91.531 75.485 68.066 1.00124.16 C
ATOM 4996 N GLU B 221 93.807 76.664 69.259 1.00127.74 N
ATOM 4997 CA GLU B 221 94.965 76.749 70.141 1.00129.54 C
ATOM 4998 C GLU B 221 95.173 78.121 70.772 1.00130.00 C
ATOM 4999 O GLU B 221 95.717 78.224 71.871 1.00129.96 O
ATOM 5000 CB GLU B 221 96.234 76.307 69.390 1.00130.57 C
ATOM 5001 CG GLU B 221 96.408 76.900 67.986 1.00131.45 C
ATOM 5002 CD GLU B 221 97.599 76.306 67.230 1.00131.41 C
ATOM 5003 OE1 GLU B 221 97.665 75.063 67.092 1.00130.83 O
ATOM 5004 OE2 GLU B 221 98.465 77.084 66.770 1.00131.11 O
ATOM 5005 N GLN B 222 94.705 79.167 70.099 1.00130.75 N
ATOM 5006 CA GLN B 222 94.871 80.522 70.608 1.00131.59 C
ATOM 5007 C GLN B 222 93.764 81.022 71.531 1.00131.60 C
ATOM 5008 O GLN B 222 94.026 81.807 72.444 1.00131.06 O
ATOM 5009 CB GLN B 222 95.036 81.498 69.440 1.00132.29 C
ATOM 5010 CG GLN B 222 96.211 81.167 68.532 1.00133.79 C
ATOM 5011 CD GLN B 222 96.436 82.213 67.461 1.00134.38 C
ATOM 5012 OE1 GLN B 222 95.521 82.560 66.716 1.00134.85 O
ATOM 5013 NE2 GLN B 222 97.662 82.719 67.374 1.00134.79 N
ATOM 5014 N PHE B 223 92.532 80.570 71.318 1.00132.09 N
ATOM 5015 CA PHE B 223 91.444 81.050 72.156 1.00132.79 C
ATOM 5016 C PHE B 223 90.764 80.046 73.072 1.00132.76 C
ATOM 5017 O PHE B 223 90.581 80.327 74.255 1.00132.46 O
ATOM 5018 CB PHE B 223 90.402 81.754 71.293 1.00133.56 C
ATOM 5019 CG PHE B 223 90.929 82.975 70.599 1.00134.69 C
ATOM 5020 CD1 PHE B 223 91.735 82.856 69.467 1.00135.26 C
ATOM 5021 CD2 PHE B 223 90.653 84.246 71.095 1.00134.78 C
ATOM 5022 CE1 PHE B 223 92.260 83.987 68.840 1.00135.53 C
ATOM 5023 CE2 PHE B 223 91.172 85.384 70.477 1.00135.30 C
ATOM 5024 CZ PHE B 223 91.977 85.254 69.347 1.00135.61 C
ATOM 5025 N LEU B 224 90.377 78.889 72.546 1.00132.89 N
ATOM 5026 CA LEU B 224 89.723 77.895 73.389 1.00133.23 C
ATOM 5027 C LEU B 224 90.597 77.602 74.600 1.00134.16 C
ATOM 5028 O LEU B 224 91.738 77.163 74.458 1.00134.47 O
ATOM 5029 CB LEU B 224 89.450 76.611 72.604 1.00131.94 C
ATOM 5030 CG LEU B 224 88.226 76.704 71.691 1.00130.98 C
ATOM 5031 CD1 LEU B 224 88.011 75.399 70.953 1.00130.53 C
ATOM 5032 CD2 LEU B 224 87.009 77.036 72.528 1.00130.61 C
ATOM 5033 N ASN B 225 90.056 77.858 75.790 1.00135.23 N
ATOM 5034 CA ASN B 225 90.792 77.647 77.035 1.00136.13 C
ATOM 5035 C ASN B 225 90.261 76.505 77.905 1.00136.32 C
ATOM 5036 O ASN B 225 90.700 75.362 77.763 1.00136.27 O
ATOM 5037 CB ASN B 225 90.807 78.940 77.859 1.00136.53 C
ATOM 5038 CG ASN B 225 91.223 80.148 77.044 1.00137.10 C
ATOM 5039 OD1 ASN B 225 92.299 80.169 76.441 1.00137.27 O
ATOM 5040 ND2 ASN B 225 90.369 81.165 77.022 1.00137.14 N
ATOM 5041 N ILE B 226 89.320 76.832 78.796 1.00136.47 N
ATOM 5042 CA ILE B 226 88.718 75.879 79.738 1.00136.28 C
ATOM 5043 C ILE B 226 89.390 74.506 79.676 1.00135.93 C
ATOM 5044 O ILE B 226 89.068 73.659 78.837 1.00136.15 O
ATOM 5045 CB ILE B 226 87.174 75.758 79.526 1.00136.26 C
ATOM 5046 CG1 ILE B 226 86.554 74.954 80.676 1.00136.03 C
ATOM 5047 CG2 ILE B 226 86.866 75.128 78.174 1.00136.38 C
ATOM 5048 CD1 ILE B 226 85.042 75.045 80.755 1.00136.02 C
ATOM 5049 N ARG B 227 90.341 74.313 80.586 1.00135.01 N
ATOM 5050 CA ARG B 227 91.134 73.095 80.664 1.00133.84 C
ATOM 5051 C ARG B 227 90.510 71.764 80.293 1.00132.28 C
ATOM 5052 O ARG B 227 89.294 71.573 80.303 1.00131.64 O
ATOM 5053 CB ARG B 227 91.791 72.964 82.045 1.00134.77 C
ATOM 5054 CG ARG B 227 93.183 73.596 82.139 1.00135.35 C
ATOM 5055 CD ARG B 227 94.117 73.094 81.030 1.00136.20 C
ATOM 5056 NE ARG B 227 93.765 73.647 79.721 1.00137.36 N
ATOM 5057 CZ ARG B 227 94.333 73.293 78.570 1.00137.72 C
ATOM 5058 NH1 ARG B 227 95.291 72.376 78.551 1.00138.15 N
ATOM 5059 NH2 ARG B 227 93.942 73.860 77.434 1.00136.90 N
ATOM 5060 N SER B 228 91.414 70.852 79.963 1.00130.77 N
ATOM 5061 CA SER B 228 91.126 69.490 79.562 1.00129.16 C
ATOM 5062 C SER B 228 90.586 68.611 80.680 1.00127.46 C
ATOM 5063 O SER B 228 90.275 69.075 81.778 1.00126.69 O
ATOM 5064 CB SER B 228 92.409 68.870 79.012 1.00129.71 C
ATOM 5065 OG SER B 228 93.500 69.170 79.868 1.00129.95 O
ATOM 5066 N GLY B 229 90.502 67.324 80.378 1.00125.77 N
ATOM 5067 CA GLY B 229 90.004 66.365 81.335 1.00124.14 C
ATOM 5068 C GLY B 229 88.689 65.833 80.828 1.00122.87 C
ATOM 5069 O GLY B 229 88.182 66.295 79.809 1.00123.00 O
ATOM 5070 N ALA B 230 88.143 64.849 81.524 1.00121.68 N
ATOM 5071 CA ALA B 230 86.870 64.283 81.132 1.00120.58 C
ATOM 5072 C ALA B 230 85.837 64.776 82.128 1.00119.78 C
ATOM 5073 O ALA B 230 84.683 64.351 82.094 1.00120.36 O
ATOM 5074 CB ALA B 230 86.939 62.764 81.145 1.00120.75 C
ATOM 5075 N GLY B 231 86.251 65.680 83.011 1.00118.31 N
ATOM 5076 CA GLY B 231 85.324 66.193 84.001 1.00116.70 C
ATOM 5077 C GLY B 231 84.527 65.043 84.583 1.00115.78 C
ATOM 5078 O GLY B 231 84.944 63.889 84.491 1.00116.30 O
ATOM 5079 N THR B 232 83.381 65.334 85.182 1.00114.70 N
ATOM 5080 CA THR B 232 82.574 64.267 85.750 1.00114.06 C
ATOM 5081 C THR B 232 82.108 63.337 84.636 1.00113.53 C
ATOM 5082 O THR B 232 81.584 63.781 83.610 1.00113.59 O
ATOM 5083 CB THR B 232 81.344 64.819 86.494 1.00114.51 C
ATOM 5084 OG1 THR B 232 81.779 65.634 87.588 1.00114.72 O
ATOM 5085 CG2 THR B 232 80.482 63.677 87.030 1.00113.79 C
ATOM 5086 N SER B 233 82.318 62.042 84.843 1.00112.12 N
ATOM 5087 CA SER B 233 81.916 61.039 83.872 1.00110.21 C
ATOM 5088 C SER B 233 80.484 60.634 84.174 1.00108.65 C
ATOM 5089 O SER B 233 80.064 60.622 85.332 1.00107.52 O
ATOM 5090 CB SER B 233 82.831 59.820 83.971 1.00110.89 C
ATOM 5091 OG SER B 233 84.191 60.196 83.848 1.00111.20 O
ATOM 5092 N SER B 234 79.735 60.306 83.127 1.00107.47 N
ATOM 5093 CA SER B 234 78.343 59.903 83.285 1.00106.05 C
ATOM 5094 C SER B 234 78.229 58.489 83.827 1.00104.92 C
ATOM 5095 O SER B 234 79.132 57.671 83.647 1.00104.91 O
ATOM 5096 CB SER B 234 77.613 59.985 81.941 1.00106.15 C
ATOM 5097 OG SER B 234 76.319 59.405 82.024 1.00105.80 O
ATOM 5098 N ALA B 235 77.116 58.207 84.497 1.00103.44 N
ATOM 5099 CA ALA B 235 76.875 56.876 85.033 1.00102.65 C
ATOM 5100 C ALA B 235 76.559 55.976 83.839 1.00101.95 C
ATOM 5101 O ALA B 235 76.109 56.455 82.798 1.00102.91 O
ATOM 5102 CB ALA B 235 75.700 56.904 86.001 1.00101.84 C
ATOM 5103 N LYS B 236 76.803 54.679 83.975 1.00100.72 N
ATOM 5104 CA LYS B 236 76.527 53.750 82.884 1.00 99.03 C
ATOM 5105 C LYS B 236 75.019 53.636 82.680 1.00 97.16 C
ATOM 5106 O LYS B 236 74.244 53.757 83.630 1.00 97.13 O
ATOM 5107 CB LYS B 236 77.113 52.378 83.209 1.00 99.96 C
ATOM 5108 CG LYS B 236 78.595 52.423 83.576 1.00101.73 C
ATOM 5109 CD LYS B 236 79.107 51.069 84.083 1.00101.63 C
ATOM 5110 CE LYS B 236 78.419 50.647 85.382 1.00100.59 C
ATOM 5111 NZ LYS B 236 78.871 49.305 85.847 1.00 99.85 N
ATOM 5112 N ALA B 237 74.606 53.411 81.439 1.00 94.27 N
ATOM 5113 CA ALA B 237 73.192 53.289 81.132 1.00 91.60 C
ATOM 5114 C ALA B 237 72.686 51.899 81.483 1.00 90.01 C
ATOM 5115 O ALA B 237 73.112 50.912 80.893 1.00 88.96 O
ATOM 5116 CB ALA B 237 72.962 53.571 79.664 1.00 92.00 C
ATOM 5117 N THR B 238 71.774 51.830 82.447 1.00 88.66 N
ATOM 5118 CA THR B 238 71.203 50.558 82.880 1.00 87.53 C
ATOM 5119 C THR B 238 69.834 50.366 82.252 1.00 86.25 C
ATOM 5120 O THR B 238 68.963 51.224 82.380 1.00 86.78 O
ATOM 5121 CB THR B 238 71.041 50.508 84.413 1.00 88.27 C
ATOM 5122 OG1 THR B 238 72.331 50.595 85.030 1.00 88.52 O
ATOM 5123 CG2 THR B 238 70.356 49.207 84.844 1.00 87.90 C
ATOM 5124 N TYR B 239 69.643 49.233 81.585 1.00 84.34 N
ATOM 5125 CA TYR B 239 68.375 48.938 80.928 1.00 82.63 C
ATOM 5126 C TYR B 239 67.282 48.544 81.926 1.00 82.57 C
ATOM 5127 O TYR B 239 67.526 47.787 82.860 1.00 82.19 O
ATOM 5128 CB TYR B 239 68.566 47.816 79.904 1.00 79.48 C
ATOM 5129 CG TYR B 239 67.421 47.693 78.926 1.00 77.02 C
ATOM 5130 CD1 TYR B 239 67.463 48.338 77.691 1.00 74.74 C
ATOM 5131 CD2 TYR B 239 66.285 46.941 79.242 1.00 75.23 C
ATOM 5132 CE1 TYR B 239 66.403 48.234 76.794 1.00 73.53 C
ATOM 5133 CE2 TYR B 239 65.222 46.833 78.353 1.00 73.46 C
ATOM 5134 CZ TYR B 239 65.286 47.481 77.131 1.00 73.12 C
ATOM 5135 OH TYR B 239 64.236 47.377 76.247 1.00 71.28 O
ATOM 5136 N TRP B 240 66.074 49.063 81.723 1.00 82.92 N
ATOM 5137 CA TRP B 240 64.962 48.750 82.607 1.00 83.20 C
ATOM 5138 C TRP B 240 63.874 47.939 81.910 1.00 83.33 C
ATOM 5139 O TRP B 240 63.356 46.975 82.478 1.00 83.88 O
ATOM 5140 CB TRP B 240 64.361 50.036 83.191 1.00 83.62 C
ATOM 5141 CG TRP B 240 63.098 49.810 83.998 1.00 84.59 C
ATOM 5142 CD1 TRP B 240 62.778 48.701 84.735 1.00 84.74 C
ATOM 5143 CD2 TRP B 240 62.001 50.721 84.156 1.00 85.09 C
ATOM 5144 NE1 TRP B 240 61.553 48.864 85.336 1.00 84.89 N
ATOM 5145 CE2 TRP B 240 61.054 50.093 85.000 1.00 85.27 C
ATOM 5146 CE3 TRP B 240 61.727 52.006 83.668 1.00 85.73 C
ATOM 5147 CZ2 TRP B 240 59.852 50.708 85.367 1.00 85.80 C
ATOM 5148 CZ3 TRP B 240 60.529 52.619 84.032 1.00 85.86 C
ATOM 5149 CH2 TRP B 240 59.607 51.966 84.875 1.00 86.31 C
ATOM 5150 N GLY B 241 63.530 48.318 80.682 1.00 82.73 N
ATOM 5151 CA GLY B 241 62.489 47.595 79.971 1.00 81.91 C
ATOM 5152 C GLY B 241 61.137 47.844 80.621 1.00 81.16 C
ATOM 5153 O GLY B 241 60.351 46.916 80.868 1.00 80.63 O
ATOM 5154 N GLY B 242 60.876 49.118 80.903 1.00 79.79 N
ATOM 5155 CA GLY B 242 59.627 49.509 81.520 1.00 77.62 C
ATOM 5156 C GLY B 242 58.529 49.768 80.507 1.00 75.72 C
ATOM 5157 O GLY B 242 58.699 49.564 79.304 1.00 74.07 O
ATOM 5158 N GLU B 243 57.395 50.239 81.005 1.00 74.13 N
ATOM 5159 CA GLU B 243 56.252 50.512 80.159 1.00 72.04 C
ATOM 5160 C GLU B 243 55.461 51.689 80.722 1.00 69.27 C
ATOM 5161 O GLU B 243 54.900 51.609 81.819 1.00 69.80 O
ATOM 5162 CB GLU B 243 55.396 49.240 80.077 1.00 73.73 C
ATOM 5163 CG GLU B 243 54.016 49.400 79.488 1.00 76.18 C
ATOM 5164 CD GLU B 243 53.315 48.064 79.310 1.00 77.34 C
ATOM 5165 OE1 GLU B 243 53.568 47.150 80.126 1.00 76.47 O
ATOM 5166 OE2 GLU B 243 52.503 47.938 78.361 1.00 79.40 O
ATOM 5167 N ILE B 244 55.441 52.785 79.968 1.00 64.91 N
ATOM 5168 CA ILE B 244 54.720 53.996 80.358 1.00 60.17 C
ATOM 5169 C ILE B 244 53.558 54.276 79.392 1.00 59.33 C
ATOM 5170 O ILE B 244 53.742 54.361 78.175 1.00 57.76 O
ATOM 5171 CB ILE B 244 55.665 55.213 80.369 1.00 57.07 C
ATOM 5172 CG1 ILE B 244 56.803 54.981 81.358 1.00 56.07 C
ATOM 5173 CG2 ILE B 244 54.906 56.458 80.748 1.00 55.58 C
ATOM 5174 CD1 ILE B 244 57.887 56.043 81.302 1.00 52.73 C
ATOM 5175 N ARG B 245 52.359 54.419 79.937 1.00 58.63 N
ATOM 5176 CA ARG B 245 51.192 54.678 79.110 1.00 59.06 C
ATOM 5177 C ARG B 245 50.515 55.979 79.512 1.00 60.28 C
ATOM 5178 O ARG B 245 50.092 56.131 80.655 1.00 61.49 O
ATOM 5179 CB ARG B 245 50.194 53.526 79.244 1.00 57.59 C
ATOM 5180 CG ARG B 245 50.769 52.163 78.902 1.00 54.43 C
ATOM 5181 CD ARG B 245 49.933 51.064 79.509 1.00 51.74 C
ATOM 5182 NE ARG B 245 48.582 50.993 78.956 1.00 51.48 N
ATOM 5183 CZ ARG B 245 48.268 50.423 77.794 1.00 49.57 C
ATOM 5184 NH1 ARG B 245 49.208 49.866 77.038 1.00 48.89 N
ATOM 5185 NH2 ARG B 245 47.006 50.389 77.399 1.00 47.95 N
ATOM 5186 N GLU B 246 50.409 56.910 78.567 1.00 60.75 N
ATOM 5187 CA GLU B 246 49.772 58.194 78.820 1.00 60.13 C
ATOM 5188 C GLU B 246 48.385 58.276 78.178 1.00 59.68 C
ATOM 5189 O GLU B 246 48.248 58.526 76.977 1.00 58.74 O
ATOM 5190 CB GLU B 246 50.661 59.315 78.297 1.00 61.74 C
ATOM 5191 CG GLU B 246 50.026 60.691 78.375 1.00 66.84 C
ATOM 5192 CD GLU B 246 50.926 61.797 77.823 1.00 69.94 C
ATOM 5193 OE1 GLU B 246 50.377 62.770 77.251 1.00 70.93 O
ATOM 5194 OE2 GLU B 246 52.172 61.702 77.970 1.00 70.54 O
ATOM 5195 N GLN B 247 47.355 58.045 78.985 1.00 59.42 N
ATOM 5196 CA GLN B 247 45.978 58.101 78.502 1.00 59.74 C
ATOM 5197 C GLN B 247 45.583 59.564 78.444 1.00 60.45 C
ATOM 5198 O GLN B 247 45.315 60.177 79.481 1.00 61.38 O
ATOM 5199 CB GLN B 247 45.054 57.347 79.460 1.00 58.48 C
ATOM 5200 CG GLN B 247 43.563 57.575 79.247 1.00 57.72 C
ATOM 5201 CD GLN B 247 43.053 57.036 77.927 1.00 58.32 C
ATOM 5202 OE1 GLN B 247 43.315 55.892 77.565 1.00 60.57 O
ATOM 5203 NE2 GLN B 247 42.307 57.855 77.208 1.00 58.45 N
ATOM 5204 N ASN B 248 45.550 60.127 77.240 1.00 60.45 N
ATOM 5205 CA ASN B 248 45.206 61.534 77.087 1.00 61.35 C
ATOM 5206 C ASN B 248 44.039 61.775 76.135 1.00 62.53 C
ATOM 5207 O ASN B 248 43.711 62.918 75.796 1.00 62.01 O
ATOM 5208 CB ASN B 248 46.439 62.319 76.639 1.00 60.02 C
ATOM 5209 CG ASN B 248 46.879 61.970 75.239 1.00 58.89 C
ATOM 5210 OD1 ASN B 248 48.018 62.231 74.864 1.00 59.04 O
ATOM 5211 ND2 ASN B 248 45.977 61.396 74.448 1.00 58.79 N
ATOM 5212 N GLY B 249 43.428 60.685 75.693 1.00 63.61 N
ATOM 5213 CA GLY B 249 42.275 60.784 74.820 1.00 66.42 C
ATOM 5214 C GLY B 249 42.393 61.137 73.347 1.00 67.82 C
ATOM 5215 O GLY B 249 41.361 61.171 72.678 1.00 67.82 O
ATOM 5216 N HIS B 250 43.593 61.397 72.826 1.00 69.50 N
ATOM 5217 CA HIS B 250 43.728 61.737 71.400 1.00 71.23 C
ATOM 5218 C HIS B 250 43.235 60.649 70.446 1.00 70.71 C
ATOM 5219 O HIS B 250 43.428 59.456 70.685 1.00 70.03 O
ATOM 5220 CB HIS B 250 45.175 62.077 71.045 1.00 73.99 C
ATOM 5221 CG HIS B 250 45.639 63.374 71.620 1.00 77.91 C
ATOM 5222 ND1 HIS B 250 44.825 64.486 71.682 1.00 79.72 N
ATOM 5223 CD2 HIS B 250 46.829 63.745 72.149 1.00 78.41 C
ATOM 5224 CE1 HIS B 250 45.495 65.487 72.227 1.00 80.02 C
ATOM 5225 NE2 HIS B 250 46.712 65.064 72.519 1.00 80.19 N
ATOM 5226 N SER B 251 42.607 61.079 69.355 1.00 70.82 N
ATOM 5227 CA SER B 251 42.069 60.166 68.344 1.00 69.95 C
ATOM 5228 C SER B 251 43.158 59.249 67.782 1.00 67.62 C
ATOM 5229 O SER B 251 42.883 58.121 67.363 1.00 67.67 O
ATOM 5230 CB SER B 251 41.423 60.967 67.209 1.00 71.18 C
ATOM 5231 OG SER B 251 42.348 61.896 66.661 1.00 75.22 O
ATOM 5232 N LEU B 252 44.391 59.742 67.773 1.00 64.21 N
ATOM 5233 CA LEU B 252 45.507 58.956 67.286 1.00 61.40 C
ATOM 5234 C LEU B 252 46.335 58.415 68.447 1.00 60.61 C
ATOM 5235 O LEU B 252 46.566 59.109 69.438 1.00 62.07 O
ATOM 5236 CB LEU B 252 46.403 59.799 66.375 1.00 60.07 C
ATOM 5237 CG LEU B 252 45.817 60.340 65.073 1.00 58.01 C
ATOM 5238 CD1 LEU B 252 46.956 60.774 64.184 1.00 57.43 C
ATOM 5239 CD2 LEU B 252 45.012 59.267 64.371 1.00 58.71 C
ATOM 5240 N VAL B 253 46.774 57.169 68.323 1.00 58.51 N
ATOM 5241 CA VAL B 253 47.601 56.552 69.345 1.00 56.28 C
ATOM 5242 C VAL B 253 49.013 56.324 68.816 1.00 56.19 C
ATOM 5243 O VAL B 253 49.223 55.637 67.806 1.00 56.20 O
ATOM 5244 CB VAL B 253 47.033 55.201 69.796 1.00 55.84 C
ATOM 5245 CG1 VAL B 253 47.975 54.556 70.791 1.00 53.48 C
ATOM 5246 CG2 VAL B 253 45.667 55.394 70.406 1.00 54.94 C
ATOM 5247 N HIS B 254 49.979 56.929 69.491 1.00 55.14 N
ATOM 5248 CA HIS B 254 51.369 56.771 69.115 1.00 54.83 C
ATOM 5249 C HIS B 254 51.949 55.735 70.048 1.00 54.75 C
ATOM 5250 O HIS B 254 51.776 55.825 71.255 1.00 55.57 O
ATOM 5251 CB HIS B 254 52.139 58.081 69.285 1.00 54.55 C
ATOM 5252 CG HIS B 254 51.859 59.093 68.222 1.00 54.69 C
ATOM 5253 ND1 HIS B 254 52.856 59.664 67.463 1.00 54.46 N
ATOM 5254 CD2 HIS B 254 50.699 59.655 67.806 1.00 54.95 C
ATOM 5255 CE1 HIS B 254 52.324 60.535 66.624 1.00 55.48 C
ATOM 5256 NE2 HIS B 254 51.017 60.549 66.813 1.00 55.63 N
ATOM 5257 N ALA B 255 52.630 54.745 69.494 1.00 55.02 N
ATOM 5258 CA ALA B 255 53.245 53.721 70.320 1.00 55.53 C
ATOM 5259 C ALA B 255 54.632 53.352 69.795 1.00 56.20 C
ATOM 5260 O ALA B 255 54.892 53.383 68.584 1.00 56.58 O
ATOM 5261 CB ALA B 255 52.355 52.498 70.377 1.00 54.57 C
ATOM 5262 N ALA B 256 55.530 53.029 70.716 1.00 55.75 N
ATOM 5263 CA ALA B 256 56.874 52.637 70.343 1.00 56.72 C
ATOM 5264 C ALA B 256 57.277 51.455 71.203 1.00 58.35 C
ATOM 5265 O ALA B 256 57.098 51.476 72.420 1.00 58.84 O
ATOM 5266 CB ALA B 256 57.827 53.776 70.546 1.00 55.08 C
ATOM 5267 N VAL B 257 57.781 50.407 70.561 1.00 60.57 N
ATOM 5268 CA VAL B 257 58.232 49.217 71.271 1.00 61.82 C
ATOM 5269 C VAL B 257 59.682 49.017 70.884 1.00 63.37 C
ATOM 5270 O VAL B 257 60.021 49.009 69.697 1.00 63.37 O
ATOM 5271 CB VAL B 257 57.444 47.965 70.872 1.00 60.86 C
ATOM 5272 CG1 VAL B 257 58.003 46.771 71.604 1.00 60.18 C
ATOM 5273 CG2 VAL B 257 55.981 48.135 71.210 1.00 60.80 C
ATOM 5274 N VAL B 258 60.545 48.872 71.878 1.00 64.93 N
ATOM 5275 CA VAL B 258 61.950 48.692 71.578 1.00 67.39 C
ATOM 5276 C VAL B 258 62.640 47.690 72.468 1.00 69.28 C
ATOM 5277 O VAL B 258 62.072 47.168 73.425 1.00 69.57 O
ATOM 5278 CB VAL B 258 62.732 50.013 71.689 1.00 67.54 C
ATOM 5279 CG1 VAL B 258 62.222 51.010 70.671 1.00 67.76 C
ATOM 5280 CG2 VAL B 258 62.612 50.561 73.102 1.00 67.40 C
ATOM 5281 N THR B 259 63.898 47.459 72.130 1.00 71.29 N
ATOM 5282 CA THR B 259 64.769 46.542 72.832 1.00 72.78 C
ATOM 5283 C THR B 259 66.138 47.200 72.816 1.00 74.05 C
ATOM 5284 O THR B 259 66.402 48.062 71.976 1.00 74.67 O
ATOM 5285 CB THR B 259 64.837 45.204 72.080 1.00 72.70 C
ATOM 5286 OG1 THR B 259 63.659 44.437 72.367 1.00 74.20 O
ATOM 5287 CG2 THR B 259 66.078 44.429 72.465 1.00 73.28 C
ATOM 5288 N GLU B 260 67.005 46.821 73.745 1.00 75.44 N
ATOM 5289 CA GLU B 260 68.345 47.385 73.766 1.00 76.18 C
ATOM 5290 C GLU B 260 69.041 46.962 72.463 1.00 76.45 C
ATOM 5291 O GLU B 260 69.133 45.778 72.149 1.00 77.15 O
ATOM 5292 CB GLU B 260 69.098 46.868 74.994 1.00 76.84 C
ATOM 5293 CG GLU B 260 70.557 47.295 75.081 1.00 79.69 C
ATOM 5294 CD GLU B 260 71.123 47.175 76.495 1.00 81.67 C
ATOM 5295 OE1 GLU B 260 70.685 46.271 77.250 1.00 81.55 O
ATOM 5296 OE2 GLU B 260 72.014 47.981 76.848 1.00 82.67 O
ATOM 5297 N GLY B 261 69.499 47.934 71.687 1.00 76.44 N
ATOM 5298 CA GLY B 261 70.163 47.616 70.439 1.00 76.24 C
ATOM 5299 C GLY B 261 71.635 47.964 70.500 1.00 77.22 C
ATOM 5300 O GLY B 261 72.178 48.212 71.575 1.00 76.77 O
ATOM 5301 N ALA B 262 72.283 47.994 69.342 1.00 78.51 N
ATOM 5302 CA ALA B 262 73.707 48.302 69.270 1.00 79.70 C
ATOM 5303 C ALA B 262 73.990 49.743 69.650 1.00 80.15 C
ATOM 5304 O ALA B 262 73.123 50.607 69.521 1.00 80.97 O
ATOM 5305 CB ALA B 262 74.235 48.022 67.861 1.00 80.31 C
ATOM 5306 N ALA B 263 75.212 49.990 70.116 1.00 80.40 N
ATOM 5307 CA ALA B 263 75.634 51.321 70.515 1.00 81.12 C
ATOM 5308 C ALA B 263 76.448 51.935 69.391 1.00 82.47 C
ATOM 5309 O ALA B 263 76.654 51.304 68.359 1.00 81.98 O
ATOM 5310 CB ALA B 263 76.471 51.243 71.778 1.00 80.27 C
ATOM 5311 N VAL B 264 76.899 53.169 69.595 1.00 84.93 N
ATOM 5312 CA VAL B 264 77.710 53.870 68.603 1.00 86.22 C
ATOM 5313 C VAL B 264 78.987 53.069 68.408 1.00 87.19 C
ATOM 5314 O VAL B 264 79.609 52.637 69.382 1.00 86.93 O
ATOM 5315 CB VAL B 264 78.119 55.284 69.081 1.00 86.63 C
ATOM 5316 CG1 VAL B 264 78.881 56.004 67.979 1.00 85.53 C
ATOM 5317 CG2 VAL B 264 76.896 56.077 69.492 1.00 87.53 C
ATOM 5318 N GLY B 265 79.380 52.882 67.151 1.00 88.06 N
ATOM 5319 CA GLY B 265 80.582 52.125 66.860 1.00 89.13 C
ATOM 5320 C GLY B 265 80.359 50.649 67.127 1.00 90.14 C
ATOM 5321 O GLY B 265 80.617 50.155 68.229 1.00 90.00 O
ATOM 5322 N SER B 266 79.873 49.940 66.118 1.00 90.49 N
ATOM 5323 CA SER B 266 79.612 48.519 66.262 1.00 91.47 C
ATOM 5324 C SER B 266 79.243 47.908 64.919 1.00 92.24 C
ATOM 5325 O SER B 266 78.573 48.541 64.099 1.00 92.89 O
ATOM 5326 CB SER B 266 78.471 48.300 67.263 1.00 90.83 C
ATOM 5327 OG SER B 266 78.142 46.927 67.377 1.00 91.42 O
ATOM 5328 N ALA B 267 79.700 46.682 64.684 1.00 92.79 N
ATOM 5329 CA ALA B 267 79.377 45.993 63.443 1.00 92.85 C
ATOM 5330 C ALA B 267 77.906 45.618 63.578 1.00 92.25 C
ATOM 5331 O ALA B 267 77.217 45.355 62.592 1.00 93.08 O
ATOM 5332 CB ALA B 267 80.239 44.735 63.283 1.00 92.70 C
ATOM 5333 N GLU B 268 77.441 45.611 64.824 1.00 90.78 N
ATOM 5334 CA GLU B 268 76.059 45.287 65.147 1.00 89.44 C
ATOM 5335 C GLU B 268 75.162 46.444 64.691 1.00 87.68 C
ATOM 5336 O GLU B 268 74.042 46.236 64.213 1.00 86.99 O
ATOM 5337 CB GLU B 268 75.942 45.055 66.660 1.00 90.02 C
ATOM 5338 CG GLU B 268 74.572 44.609 67.138 1.00 91.42 C
ATOM 5339 CD GLU B 268 74.589 44.106 68.575 1.00 92.37 C
ATOM 5340 OE1 GLU B 268 75.227 44.764 69.431 1.00 92.41 O
ATOM 5341 OE2 GLU B 268 73.956 43.058 68.845 1.00 92.14 O
ATOM 5342 N ALA B 269 75.680 47.660 64.832 1.00 85.46 N
ATOM 5343 CA ALA B 269 74.964 48.860 64.433 1.00 82.98 C
ATOM 5344 C ALA B 269 74.475 48.693 63.005 1.00 81.64 C
ATOM 5345 O ALA B 269 73.280 48.787 62.736 1.00 81.64 O
ATOM 5346 CB ALA B 269 75.880 50.064 64.531 1.00 82.27 C
ATOM 5347 N ASN B 270 75.411 48.439 62.097 1.00 80.02 N
ATOM 5348 CA ASN B 270 75.102 48.254 60.681 1.00 78.78 C
ATOM 5349 C ASN B 270 74.017 47.221 60.410 1.00 77.20 C
ATOM 5350 O ASN B 270 73.247 47.351 59.456 1.00 75.67 O
ATOM 5351 CB ASN B 270 76.363 47.850 59.920 1.00 80.23 C
ATOM 5352 CG ASN B 270 77.237 49.029 59.576 1.00 81.02 C
ATOM 5353 OD1 ASN B 270 76.878 49.854 58.738 1.00 80.79 O
ATOM 5354 ND2 ASN B 270 78.395 49.121 60.225 1.00 81.81 N
ATOM 5355 N ALA B 271 73.972 46.186 61.239 1.00 76.19 N
ATOM 5356 CA ALA B 271 72.987 45.129 61.078 1.00 76.74 C
ATOM 5357 C ALA B 271 71.596 45.700 61.284 1.00 77.50 C
ATOM 5358 O ALA B 271 70.688 45.493 60.470 1.00 77.49 O
ATOM 5359 CB ALA B 271 73.253 44.009 62.083 1.00 76.91 C
ATOM 5360 N PHE B 272 71.433 46.426 62.383 1.00 78.15 N
ATOM 5361 CA PHE B 272 70.149 47.033 62.690 1.00 78.42 C
ATOM 5362 C PHE B 272 69.764 48.086 61.651 1.00 77.67 C
ATOM 5363 O PHE B 272 68.613 48.148 61.228 1.00 77.69 O
ATOM 5364 CB PHE B 272 70.176 47.633 64.097 1.00 78.52 C
ATOM 5365 CG PHE B 272 70.079 46.603 65.186 1.00 78.78 C
ATOM 5366 CD1 PHE B 272 71.168 46.324 66.001 1.00 79.11 C
ATOM 5367 CD2 PHE B 272 68.892 45.902 65.388 1.00 78.63 C
ATOM 5368 CE1 PHE B 272 71.075 45.361 67.005 1.00 79.47 C
ATOM 5369 CE2 PHE B 272 68.788 44.941 66.385 1.00 78.28 C
ATOM 5370 CZ PHE B 272 69.882 44.669 67.196 1.00 79.18 C
ATOM 5371 N SER B 273 70.726 48.905 61.237 1.00 76.73 N
ATOM 5372 CA SER B 273 70.458 49.923 60.230 1.00 76.71 C
ATOM 5373 C SER B 273 69.806 49.247 59.029 1.00 76.10 C
ATOM 5374 O SER B 273 68.745 49.667 58.561 1.00 76.06 O
ATOM 5375 CB SER B 273 71.758 50.606 59.790 1.00 76.92 C
ATOM 5376 OG SER B 273 72.394 51.257 60.879 1.00 78.16 O
ATOM 5377 N VAL B 274 70.440 48.187 58.542 1.00 75.08 N
ATOM 5378 CA VAL B 274 69.910 47.456 57.403 1.00 73.65 C
ATOM 5379 C VAL B 274 68.539 46.857 57.721 1.00 73.39 C
ATOM 5380 O VAL B 274 67.615 46.970 56.917 1.00 74.55 O
ATOM 5381 CB VAL B 274 70.881 46.341 56.952 1.00 72.75 C
ATOM 5382 CG1 VAL B 274 70.312 45.611 55.754 1.00 71.31 C
ATOM 5383 CG2 VAL B 274 72.229 46.946 56.592 1.00 71.43 C
ATOM 5384 N LEU B 275 68.394 46.227 58.886 1.00 71.96 N
ATOM 5385 CA LEU B 275 67.100 45.643 59.263 1.00 69.92 C
ATOM 5386 C LEU B 275 66.053 46.748 59.310 1.00 69.94 C
ATOM 5387 O LEU B 275 64.882 46.537 58.996 1.00 68.76 O
ATOM 5388 CB LEU B 275 67.182 44.970 60.640 1.00 67.28 C
ATOM 5389 CG LEU B 275 65.832 44.496 61.200 1.00 64.56 C
ATOM 5390 CD1 LEU B 275 65.215 43.471 60.276 1.00 61.93 C
ATOM 5391 CD2 LEU B 275 66.015 43.917 62.582 1.00 62.52 C
ATOM 5392 N GLN B 276 66.498 47.929 59.724 1.00 71.13 N
ATOM 5393 CA GLN B 276 65.641 49.101 59.821 1.00 71.62 C
ATOM 5394 C GLN B 276 65.055 49.373 58.445 1.00 71.72 C
ATOM 5395 O GLN B 276 63.836 49.432 58.279 1.00 70.82 O
ATOM 5396 CB GLN B 276 66.464 50.306 60.275 1.00 72.24 C
ATOM 5397 CG GLN B 276 65.679 51.594 60.459 1.00 72.31 C
ATOM 5398 CD GLN B 276 66.569 52.783 60.823 1.00 72.52 C
ATOM 5399 OE1 GLN B 276 66.070 53.852 61.181 1.00 72.88 O
ATOM 5400 NE2 GLN B 276 67.889 52.601 60.727 1.00 70.71 N
ATOM 5401 N HIS B 277 65.939 49.529 57.461 1.00 71.54 N
ATOM 5402 CA HIS B 277 65.530 49.794 56.087 1.00 72.11 C
ATOM 5403 C HIS B 277 64.793 48.608 55.462 1.00 71.63 C
ATOM 5404 O HIS B 277 64.017 48.770 54.521 1.00 71.69 O
ATOM 5405 CB HIS B 277 66.748 50.157 55.234 1.00 73.61 C
ATOM 5406 CG HIS B 277 67.286 51.531 55.492 1.00 75.60 C
ATOM 5407 ND1 HIS B 277 66.580 52.677 55.192 1.00 77.15 N
ATOM 5408 CD2 HIS B 277 68.470 51.944 56.005 1.00 76.14 C
ATOM 5409 CE1 HIS B 277 67.306 53.735 55.508 1.00 77.16 C
ATOM 5410 NE2 HIS B 277 68.457 53.318 56.003 1.00 76.23 N
ATOM 5411 N VAL B 278 65.035 47.412 55.980 1.00 70.98 N
ATOM 5412 CA VAL B 278 64.366 46.235 55.454 1.00 70.62 C
ATOM 5413 C VAL B 278 62.927 46.216 55.943 1.00 70.28 C
ATOM 5414 O VAL B 278 62.024 45.791 55.227 1.00 71.04 O
ATOM 5415 CB VAL B 278 65.065 44.930 55.913 1.00 71.38 C
ATOM 5416 CG1 VAL B 278 64.185 43.719 55.575 1.00 69.07 C
ATOM 5417 CG2 VAL B 278 66.433 44.807 55.244 1.00 70.29 C
ATOM 5418 N LEU B 279 62.726 46.683 57.171 1.00 69.93 N
ATOM 5419 CA LEU B 279 61.404 46.722 57.787 1.00 69.07 C
ATOM 5420 C LEU B 279 60.553 47.909 57.330 1.00 68.91 C
ATOM 5421 O LEU B 279 59.340 47.783 57.137 1.00 67.58 O
ATOM 5422 CB LEU B 279 61.562 46.757 59.303 1.00 68.00 C
ATOM 5423 CG LEU B 279 61.901 45.427 59.966 1.00 67.14 C
ATOM 5424 CD1 LEU B 279 62.344 45.672 61.399 1.00 66.63 C
ATOM 5425 CD2 LEU B 279 60.678 44.508 59.914 1.00 66.42 C
ATOM 5426 N GLY B 280 61.207 49.056 57.167 1.00 69.25 N
ATOM 5427 CA GLY B 280 60.533 50.272 56.748 1.00 69.65 C
ATOM 5428 C GLY B 280 61.068 51.450 57.543 1.00 70.21 C
ATOM 5429 O GLY B 280 60.760 51.602 58.719 1.00 70.49 O
ATOM 5430 N ALA B 281 61.878 52.286 56.908 1.00 71.23 N
ATOM 5431 CA ALA B 281 62.458 53.435 57.590 1.00 72.71 C
ATOM 5432 C ALA B 281 61.983 54.771 57.016 1.00 74.17 C
ATOM 5433 O ALA B 281 62.800 55.608 56.636 1.00 76.15 O
ATOM 5434 CB ALA B 281 63.981 53.355 57.520 1.00 71.09 C
ATOM 5435 N GLY B 282 60.673 54.980 56.945 1.00 74.06 N
ATOM 5436 CA GLY B 282 60.188 56.239 56.406 1.00 74.27 C
ATOM 5437 C GLY B 282 59.779 56.162 54.948 1.00 74.25 C
ATOM 5438 O GLY B 282 60.249 55.294 54.215 1.00 74.15 O
ATOM 5439 N PRO B 283 58.899 57.069 54.495 1.00 73.98 N
ATOM 5440 CA PRO B 283 58.415 57.107 53.112 1.00 73.65 C
ATOM 5441 C PRO B 283 59.453 57.643 52.114 1.00 72.89 C
ATOM 5442 O PRO B 283 60.367 58.386 52.493 1.00 72.26 O
ATOM 5443 CB PRO B 283 57.180 58.003 53.219 1.00 73.48 C
ATOM 5444 CG PRO B 283 57.619 59.007 54.227 1.00 72.52 C
ATOM 5445 CD PRO B 283 58.288 58.150 55.290 1.00 73.20 C
ATOM 5446 N LEU B 284 59.293 57.263 50.845 1.00 71.37 N
ATOM 5447 CA LEU B 284 60.197 57.679 49.775 1.00 69.92 C
ATOM 5448 C LEU B 284 59.400 58.265 48.617 1.00 68.65 C
ATOM 5449 O LEU B 284 59.954 58.920 47.731 1.00 68.76 O
ATOM 5450 CB LEU B 284 60.986 56.478 49.267 1.00 71.06 C
ATOM 5451 CG LEU B 284 61.777 55.675 50.296 1.00 72.65 C
ATOM 5452 CD1 LEU B 284 61.961 54.254 49.787 1.00 74.51 C
ATOM 5453 CD2 LEU B 284 63.114 56.346 50.567 1.00 72.10 C
ATOM 5454 N ILE B 285 58.096 58.009 48.629 1.00 66.64 N
ATOM 5455 CA ILE B 285 57.194 58.494 47.593 1.00 64.14 C
ATOM 5456 C ILE B 285 56.087 59.301 48.265 1.00 63.30 C
ATOM 5457 O ILE B 285 55.427 58.815 49.189 1.00 61.69 O
ATOM 5458 CB ILE B 285 56.544 57.310 46.808 1.00 64.27 C
ATOM 5459 CG1 ILE B 285 57.628 56.421 46.196 1.00 62.91 C
ATOM 5460 CG2 ILE B 285 55.625 57.834 45.704 1.00 61.94 C
ATOM 5461 CD1 ILE B 285 57.073 55.170 45.560 1.00 61.06 C
ATOM 5462 N LYS B 286 55.890 60.530 47.797 1.00 62.17 N
ATOM 5463 CA LYS B 286 54.854 61.395 48.343 1.00 61.52 C
ATOM 5464 C LYS B 286 53.477 60.745 48.206 1.00 62.00 C
ATOM 5465 O LYS B 286 53.061 60.386 47.101 1.00 61.09 O
ATOM 5466 CB LYS B 286 54.868 62.745 47.623 1.00 60.04 C
ATOM 5467 CG LYS B 286 53.947 63.767 48.250 1.00 60.07 C
ATOM 5468 CD LYS B 286 54.116 65.125 47.626 1.00 60.07 C
ATOM 5469 CE LYS B 286 53.149 66.115 48.240 1.00 60.05 C
ATOM 5470 NZ LYS B 286 53.207 67.433 47.567 1.00 59.91 N
ATOM 5471 N ARG B 287 52.776 60.601 49.332 1.00 63.39 N
ATOM 5472 CA ARG B 287 51.441 59.985 49.364 1.00 64.87 C
ATOM 5473 C ARG B 287 51.482 58.563 48.831 1.00 66.22 C
ATOM 5474 O ARG B 287 50.465 57.885 48.751 1.00 66.85 O
ATOM 5475 CB ARG B 287 50.433 60.787 48.531 1.00 63.64 C
ATOM 5476 CG ARG B 287 50.172 62.198 49.034 1.00 63.73 C
ATOM 5477 CD ARG B 287 48.908 62.783 48.394 1.00 63.41 C
ATOM 5478 NE ARG B 287 48.739 64.203 48.687 1.00 60.24 N
ATOM 5479 CZ ARG B 287 49.502 65.165 48.177 1.00 59.26 C
ATOM 5480 NH1 ARG B 287 50.488 64.873 47.341 1.00 56.22 N
ATOM 5481 NH2 ARG B 287 49.287 66.425 48.519 1.00 59.52 N
ATOM 5482 N GLY B 288 52.669 58.112 48.465 1.00 68.13 N
ATOM 5483 CA GLY B 288 52.790 56.775 47.931 1.00 69.62 C
ATOM 5484 C GLY B 288 52.949 55.742 49.018 1.00 70.34 C
ATOM 5485 O GLY B 288 53.431 56.042 50.112 1.00 70.13 O
ATOM 5486 N SER B 289 52.529 54.520 48.714 1.00 70.99 N
ATOM 5487 CA SER B 289 52.648 53.423 49.654 1.00 72.14 C
ATOM 5488 C SER B 289 54.107 52.985 49.659 1.00 73.64 C
ATOM 5489 O SER B 289 54.863 53.272 48.721 1.00 74.45 O
ATOM 5490 CB SER B 289 51.759 52.250 49.228 1.00 71.34 C
ATOM 5491 OG SER B 289 51.931 51.149 50.104 1.00 71.58 O
ATOM 5492 N SER B 290 54.511 52.307 50.723 1.00 74.30 N
ATOM 5493 CA SER B 290 55.872 51.826 50.814 1.00 74.91 C
ATOM 5494 C SER B 290 55.795 50.318 50.645 1.00 75.79 C
ATOM 5495 O SER B 290 55.390 49.602 51.567 1.00 76.22 O
ATOM 5496 CB SER B 290 56.476 52.197 52.170 1.00 75.31 C
ATOM 5497 OG SER B 290 56.610 53.603 52.301 1.00 74.12 O
ATOM 5498 N VAL B 291 56.159 49.840 49.457 1.00 75.86 N
ATOM 5499 CA VAL B 291 56.118 48.407 49.170 1.00 76.22 C
ATOM 5500 C VAL B 291 57.355 47.699 49.719 1.00 75.19 C
ATOM 5501 O VAL B 291 57.268 46.600 50.263 1.00 74.28 O
ATOM 5502 CB VAL B 291 56.018 48.158 47.665 1.00 76.51 C
ATOM 5503 CG1 VAL B 291 55.740 46.686 47.405 1.00 77.17 C
ATOM 5504 CG2 VAL B 291 54.918 49.029 47.077 1.00 76.40 C
ATOM 5505 N THR B 292 58.499 48.357 49.574 1.00 75.07 N
ATOM 5506 CA THR B 292 59.782 47.857 50.053 1.00 74.67 C
ATOM 5507 C THR B 292 59.803 47.869 51.583 1.00 74.76 C
ATOM 5508 O THR B 292 60.850 47.662 52.201 1.00 74.69 O
ATOM 5509 CB THR B 292 60.928 48.758 49.535 1.00 74.96 C
ATOM 5510 OG1 THR B 292 60.891 48.778 48.106 1.00 75.38 O
ATOM 5511 CG2 THR B 292 62.299 48.258 50.000 1.00 75.12 C
ATOM 5512 N SER B 293 58.649 48.118 52.197 1.00 74.07 N
ATOM 5513 CA SER B 293 58.578 48.160 53.652 1.00 73.62 C
ATOM 5514 C SER B 293 57.798 46.986 54.215 1.00 72.52 C
ATOM 5515 O SER B 293 56.567 46.981 54.204 1.00 71.71 O
ATOM 5516 CB SER B 293 57.944 49.469 54.116 1.00 74.79 C
ATOM 5517 OG SER B 293 57.852 49.507 55.532 1.00 77.91 O
ATOM 5518 N LYS B 294 58.530 45.991 54.705 1.00 71.54 N
ATOM 5519 CA LYS B 294 57.920 44.797 55.277 1.00 71.30 C
ATOM 5520 C LYS B 294 56.905 45.185 56.343 1.00 71.06 C
ATOM 5521 O LYS B 294 55.754 44.743 56.323 1.00 71.03 O
ATOM 5522 CB LYS B 294 58.989 43.918 55.924 1.00 71.20 C
ATOM 5523 CG LYS B 294 59.967 43.270 54.971 1.00 71.00 C
ATOM 5524 CD LYS B 294 59.374 42.024 54.373 1.00 69.89 C
ATOM 5525 CE LYS B 294 60.426 41.230 53.647 1.00 70.16 C
ATOM 5526 NZ LYS B 294 59.844 39.962 53.145 1.00 71.95 N
ATOM 5527 N LEU B 295 57.356 46.020 57.273 1.00 70.09 N
ATOM 5528 CA LEU B 295 56.541 46.473 58.386 1.00 68.91 C
ATOM 5529 C LEU B 295 55.275 47.228 57.968 1.00 69.24 C
ATOM 5530 O LEU B 295 54.172 46.893 58.408 1.00 68.48 O
ATOM 5531 CB LEU B 295 57.408 47.332 59.301 1.00 66.91 C
ATOM 5532 CG LEU B 295 56.806 47.809 60.615 1.00 66.04 C
ATOM 5533 CD1 LEU B 295 56.174 46.663 61.379 1.00 64.02 C
ATOM 5534 CD2 LEU B 295 57.907 48.455 61.421 1.00 66.22 C
ATOM 5535 N TYR B 296 55.432 48.239 57.119 1.00 69.43 N
ATOM 5536 CA TYR B 296 54.292 49.029 56.658 1.00 70.56 C
ATOM 5537 C TYR B 296 53.289 48.128 55.930 1.00 69.67 C
ATOM 5538 O TYR B 296 52.108 48.079 56.275 1.00 69.34 O
ATOM 5539 CB TYR B 296 54.780 50.143 55.726 1.00 72.32 C
ATOM 5540 CG TYR B 296 53.820 51.305 55.532 1.00 75.10 C
ATOM 5541 CD1 TYR B 296 52.574 51.125 54.924 1.00 75.95 C
ATOM 5542 CD2 TYR B 296 54.189 52.604 55.903 1.00 76.65 C
ATOM 5543 CE1 TYR B 296 51.720 52.211 54.682 1.00 76.64 C
ATOM 5544 CE2 TYR B 296 53.346 53.696 55.666 1.00 77.77 C
ATOM 5545 CZ TYR B 296 52.114 53.493 55.053 1.00 77.91 C
ATOM 5546 OH TYR B 296 51.289 54.573 54.805 1.00 78.26 O
ATOM 5547 N GLN B 297 53.778 47.411 54.927 1.00 69.02 N
ATOM 5548 CA GLN B 297 52.952 46.503 54.143 1.00 67.97 C
ATOM 5549 C GLN B 297 52.184 45.521 55.011 1.00 68.31 C
ATOM 5550 O GLN B 297 51.057 45.155 54.688 1.00 67.25 O
ATOM 5551 CB GLN B 297 53.823 45.737 53.154 1.00 66.56 C
ATOM 5552 CG GLN B 297 54.292 46.576 51.986 1.00 65.63 C
ATOM 5553 CD GLN B 297 53.133 47.047 51.140 1.00 64.92 C
ATOM 5554 OE1 GLN B 297 52.254 46.261 50.782 1.00 64.37 O
ATOM 5555 NE2 GLN B 297 53.121 48.331 50.812 1.00 64.66 N
ATOM 5556 N GLY B 298 52.800 45.098 56.113 1.00 69.63 N
ATOM 5557 CA GLY B 298 52.158 44.154 57.011 1.00 70.77 C
ATOM 5558 C GLY B 298 51.006 44.783 57.767 1.00 71.48 C
ATOM 5559 O GLY B 298 49.904 44.231 57.818 1.00 71.90 O
ATOM 5560 N VAL B 299 51.263 45.945 58.356 1.00 71.42 N
ATOM 5561 CA VAL B 299 50.240 46.662 59.100 1.00 71.87 C
ATOM 5562 C VAL B 299 49.078 47.003 58.160 1.00 72.23 C
ATOM 5563 O VAL B 299 47.908 46.895 58.527 1.00 71.04 O
ATOM 5564 CB VAL B 299 50.809 47.971 59.684 1.00 71.93 C
ATOM 5565 CG1 VAL B 299 49.729 48.712 60.442 1.00 72.17 C
ATOM 5566 CG2 VAL B 299 51.988 47.668 60.588 1.00 70.83 C
ATOM 5567 N ALA B 300 49.421 47.414 56.943 1.00 73.17 N
ATOM 5568 CA ALA B 300 48.431 47.774 55.940 1.00 74.70 C
ATOM 5569 C ALA B 300 47.463 46.626 55.703 1.00 76.46 C
ATOM 5570 O ALA B 300 46.263 46.835 55.550 1.00 76.66 O
ATOM 5571 CB ALA B 300 49.123 48.154 54.636 1.00 73.23 C
ATOM 5572 N LYS B 301 47.985 45.407 55.684 1.00 79.83 N
ATOM 5573 CA LYS B 301 47.150 44.232 55.452 1.00 83.30 C
ATOM 5574 C LYS B 301 46.202 43.992 56.628 1.00 84.40 C
ATOM 5575 O LYS B 301 45.120 43.424 56.466 1.00 84.34 O
ATOM 5576 CB LYS B 301 48.028 42.986 55.235 1.00 84.13 C
ATOM 5577 CG LYS B 301 49.086 43.122 54.140 1.00 85.38 C
ATOM 5578 CD LYS B 301 50.027 41.915 54.132 1.00 87.90 C
ATOM 5579 CE LYS B 301 51.294 42.141 53.287 1.00 88.42 C
ATOM 5580 NZ LYS B 301 51.026 42.336 51.833 1.00 88.56 N
ATOM 5581 N ALA B 302 46.607 44.444 57.809 1.00 85.70 N
ATOM 5582 CA ALA B 302 45.806 44.243 59.008 1.00 87.21 C
ATOM 5583 C ALA B 302 44.695 45.257 59.248 1.00 88.02 C
ATOM 5584 O ALA B 302 43.612 44.889 59.696 1.00 87.96 O
ATOM 5585 CB ALA B 302 46.717 44.189 60.224 1.00 87.51 C
ATOM 5586 N THR B 303 44.952 46.527 58.962 1.00 88.78 N
ATOM 5587 CA THR B 303 43.942 47.544 59.202 1.00 90.13 C
ATOM 5588 C THR B 303 43.520 48.288 57.939 1.00 91.32 C
ATOM 5589 O THR B 303 44.296 48.425 56.992 1.00 91.56 O
ATOM 5590 CB THR B 303 44.441 48.555 60.248 1.00 90.04 C
ATOM 5591 OG1 THR B 303 43.376 49.447 60.596 1.00 90.77 O
ATOM 5592 CG2 THR B 303 45.620 49.352 59.698 1.00 90.26 C
ATOM 5593 N THR B 304 42.281 48.770 57.937 1.00 92.19 N
ATOM 5594 CA THR B 304 41.723 49.498 56.798 1.00 92.84 C
ATOM 5595 C THR B 304 41.914 51.003 56.941 1.00 92.49 C
ATOM 5596 O THR B 304 41.956 51.739 55.951 1.00 93.41 O
ATOM 5597 CB THR B 304 40.201 49.243 56.665 1.00 93.51 C
ATOM 5598 OG1 THR B 304 39.943 47.833 56.696 1.00 94.54 O
ATOM 5599 CG2 THR B 304 39.667 49.829 55.355 1.00 93.88 C
ATOM 5600 N GLN B 305 42.035 51.455 58.183 1.00 91.43 N
ATOM 5601 CA GLN B 305 42.171 52.871 58.468 1.00 89.88 C
ATOM 5602 C GLN B 305 43.567 53.461 58.355 1.00 88.59 C
ATOM 5603 O GLN B 305 44.560 52.741 58.306 1.00 88.15 O
ATOM 5604 CB GLN B 305 41.604 53.154 59.857 1.00 89.50 C
ATOM 5605 CG GLN B 305 40.156 52.743 59.978 1.00 90.01 C
ATOM 5606 CD GLN B 305 39.323 53.266 58.831 1.00 91.08 C
ATOM 5607 OE1 GLN B 305 39.220 54.480 58.626 1.00 91.22 O
ATOM 5608 NE2 GLN B 305 38.727 52.353 58.066 1.00 91.29 N
ATOM 5609 N PRO B 306 43.648 54.799 58.293 1.00 87.67 N
ATOM 5610 CA PRO B 306 44.919 55.513 58.190 1.00 85.60 C
ATOM 5611 C PRO B 306 45.813 55.144 59.349 1.00 82.79 C
ATOM 5612 O PRO B 306 45.367 55.066 60.493 1.00 81.03 O
ATOM 5613 CB PRO B 306 44.494 56.973 58.237 1.00 86.71 C
ATOM 5614 CG PRO B 306 43.184 56.942 57.527 1.00 87.40 C
ATOM 5615 CD PRO B 306 42.521 55.741 58.161 1.00 87.77 C
ATOM 5616 N PHE B 307 47.081 54.916 59.042 1.00 81.31 N
ATOM 5617 CA PHE B 307 48.049 54.551 60.061 1.00 80.08 C
ATOM 5618 C PHE B 307 49.455 54.891 59.601 1.00 77.53 C
ATOM 5619 O PHE B 307 49.668 55.480 58.537 1.00 76.59 O
ATOM 5620 CB PHE B 307 47.975 53.050 60.339 1.00 81.03 C
ATOM 5621 CG PHE B 307 48.616 52.215 59.269 1.00 82.28 C
ATOM 5622 CD1 PHE B 307 49.984 51.965 59.290 1.00 82.33 C
ATOM 5623 CD2 PHE B 307 47.864 51.734 58.206 1.00 82.94 C
ATOM 5624 CE1 PHE B 307 50.592 51.257 58.270 1.00 82.81 C
ATOM 5625 CE2 PHE B 307 48.463 51.024 57.182 1.00 83.26 C
ATOM 5626 CZ PHE B 307 49.833 50.785 57.213 1.00 83.60 C
ATOM 5627 N ASP B 308 50.414 54.498 60.422 1.00 75.50 N
ATOM 5628 CA ASP B 308 51.805 54.718 60.109 1.00 74.63 C
ATOM 5629 C ASP B 308 52.689 53.873 61.010 1.00 73.51 C
ATOM 5630 O ASP B 308 52.605 53.949 62.235 1.00 73.71 O
ATOM 5631 CB ASP B 308 52.169 56.184 60.273 1.00 74.84 C
ATOM 5632 CG ASP B 308 53.500 56.506 59.653 1.00 76.62 C
ATOM 5633 OD1 ASP B 308 54.355 55.600 59.557 1.00 77.71 O
ATOM 5634 OD2 ASP B 308 53.702 57.666 59.267 1.00 78.25 O
ATOM 5635 N ALA B 309 53.542 53.066 60.393 1.00 72.17 N
ATOM 5636 CA ALA B 309 54.455 52.211 61.132 1.00 70.00 C
ATOM 5637 C ALA B 309 55.867 52.404 60.595 1.00 68.57 C
ATOM 5638 O ALA B 309 56.058 52.614 59.405 1.00 68.28 O
ATOM 5639 CB ALA B 309 54.028 50.760 60.995 1.00 69.20 C
ATOM 5640 N SER B 310 56.853 52.349 61.479 1.00 68.40 N
ATOM 5641 CA SER B 310 58.244 52.511 61.080 1.00 68.82 C
ATOM 5642 C SER B 310 59.211 51.784 61.989 1.00 68.59 C
ATOM 5643 O SER B 310 58.909 51.499 63.146 1.00 68.66 O
ATOM 5644 CB SER B 310 58.635 53.984 61.058 1.00 69.11 C
ATOM 5645 OG SER B 310 58.046 54.639 59.957 1.00 72.89 O
ATOM 5646 N ALA B 311 60.384 51.480 61.451 1.00 68.27 N
ATOM 5647 CA ALA B 311 61.406 50.817 62.230 1.00 66.87 C
ATOM 5648 C ALA B 311 62.094 51.945 62.969 1.00 65.66 C
ATOM 5649 O ALA B 311 62.523 52.924 62.365 1.00 64.77 O
ATOM 5650 CB ALA B 311 62.386 50.099 61.322 1.00 66.41 C
ATOM 5651 N PHE B 312 62.163 51.816 64.284 1.00 65.65 N
ATOM 5652 CA PHE B 312 62.806 52.816 65.117 1.00 64.92 C
ATOM 5653 C PHE B 312 64.225 52.341 65.363 1.00 65.19 C
ATOM 5654 O PHE B 312 64.467 51.140 65.441 1.00 64.93 O
ATOM 5655 CB PHE B 312 62.072 52.938 66.448 1.00 63.94 C
ATOM 5656 CG PHE B 312 62.683 53.934 67.374 1.00 62.63 C
ATOM 5657 CD1 PHE B 312 62.487 55.293 67.173 1.00 61.04 C
ATOM 5658 CD2 PHE B 312 63.475 53.515 68.437 1.00 61.73 C
ATOM 5659 CE1 PHE B 312 63.068 56.226 68.014 1.00 60.78 C
ATOM 5660 CE2 PHE B 312 64.059 54.438 69.283 1.00 62.05 C
ATOM 5661 CZ PHE B 312 63.854 55.802 69.071 1.00 61.76 C
ATOM 5662 N ASN B 313 65.160 53.271 65.500 1.00 65.94 N
ATOM 5663 CA ASN B 313 66.545 52.885 65.727 1.00 67.60 C
ATOM 5664 C ASN B 313 67.417 54.029 66.257 1.00 67.95 C
ATOM 5665 O ASN B 313 67.536 55.074 65.618 1.00 67.79 O
ATOM 5666 CB ASN B 313 67.122 52.326 64.409 1.00 68.77 C
ATOM 5667 CG ASN B 313 68.597 51.930 64.515 1.00 70.02 C
ATOM 5668 OD1 ASN B 313 68.990 51.133 65.371 1.00 70.78 O
ATOM 5669 ND2 ASN B 313 69.414 52.483 63.628 1.00 70.71 N
ATOM 5670 N VAL B 314 68.024 53.831 67.427 1.00 68.32 N
ATOM 5671 CA VAL B 314 68.902 54.850 68.005 1.00 68.94 C
ATOM 5672 C VAL B 314 70.217 54.265 68.486 1.00 69.75 C
ATOM 5673 O VAL B 314 70.247 53.201 69.104 1.00 70.70 O
ATOM 5674 CB VAL B 314 68.284 55.541 69.219 1.00 68.32 C
ATOM 5675 CG1 VAL B 314 69.087 56.779 69.558 1.00 66.83 C
ATOM 5676 CG2 VAL B 314 66.868 55.894 68.945 1.00 68.41 C
ATOM 5677 N ASN B 315 71.306 54.972 68.225 1.00 70.13 N
ATOM 5678 CA ASN B 315 72.605 54.494 68.663 1.00 71.22 C
ATOM 5679 C ASN B 315 73.291 55.503 69.572 1.00 71.27 C
ATOM 5680 O ASN B 315 73.620 56.607 69.154 1.00 70.96 O
ATOM 5681 CB ASN B 315 73.511 54.185 67.458 1.00 72.40 C
ATOM 5682 CG ASN B 315 72.965 53.057 66.569 1.00 73.19 C
ATOM 5683 OD1 ASN B 315 72.392 52.077 67.055 1.00 73.36 O
ATOM 5684 ND2 ASN B 315 73.168 53.189 65.261 1.00 72.85 N
ATOM 5685 N TYR B 316 73.502 55.119 70.823 1.00 71.95 N
ATOM 5686 CA TYR B 316 74.172 55.993 71.774 1.00 72.91 C
ATOM 5687 C TYR B 316 75.567 55.457 72.099 1.00 73.15 C
ATOM 5688 O TYR B 316 75.894 54.314 71.775 1.00 72.60 O
ATOM 5689 CB TYR B 316 73.340 56.122 73.056 1.00 72.92 C
ATOM 5690 CG TYR B 316 72.032 56.853 72.860 1.00 73.40 C
ATOM 5691 CD1 TYR B 316 70.813 56.189 72.996 1.00 73.88 C
ATOM 5692 CD2 TYR B 316 72.015 58.213 72.536 1.00 73.20 C
ATOM 5693 CE1 TYR B 316 69.603 56.862 72.817 1.00 74.56 C
ATOM 5694 CE2 TYR B 316 70.818 58.894 72.353 1.00 73.96 C
ATOM 5695 CZ TYR B 316 69.614 58.215 72.495 1.00 74.84 C
ATOM 5696 OH TYR B 316 68.430 58.895 72.312 1.00 75.73 O
ATOM 5697 N SER B 317 76.385 56.292 72.736 1.00 73.40 N
ATOM 5698 CA SER B 317 77.753 55.928 73.107 1.00 73.35 C
ATOM 5699 C SER B 317 77.881 54.566 73.791 1.00 73.81 C
ATOM 5700 O SER B 317 78.690 53.731 73.379 1.00 73.86 O
ATOM 5701 CB SER B 317 78.346 56.993 74.028 1.00 72.08 C
ATOM 5702 OG SER B 317 77.757 56.923 75.312 1.00 72.47 O
ATOM 5703 N ASP B 318 77.086 54.344 74.834 1.00 73.79 N
ATOM 5704 CA ASP B 318 77.152 53.089 75.568 1.00 73.81 C
ATOM 5705 C ASP B 318 75.878 52.243 75.503 1.00 72.70 C
ATOM 5706 O ASP B 318 75.616 51.425 76.395 1.00 72.98 O
ATOM 5707 CB ASP B 318 77.500 53.366 77.033 1.00 76.47 C
ATOM 5708 CG ASP B 318 76.333 53.958 77.811 1.00 78.83 C
ATOM 5709 OD1 ASP B 318 76.443 54.086 79.053 1.00 80.34 O
ATOM 5710 OD2 ASP B 318 75.306 54.296 77.182 1.00 79.64 O
ATOM 5711 N SER B 319 75.080 52.443 74.464 1.00 70.47 N
ATOM 5712 CA SER B 319 73.856 51.670 74.311 1.00 69.67 C
ATOM 5713 C SER B 319 73.082 52.129 73.084 1.00 68.95 C
ATOM 5714 O SER B 319 73.568 52.948 72.302 1.00 69.92 O
ATOM 5715 CB SER B 319 72.977 51.791 75.564 1.00 69.59 C
ATOM 5716 OG SER B 319 71.878 50.887 75.515 1.00 69.28 O
ATOM 5717 N GLY B 320 71.882 51.590 72.911 1.00 67.16 N
ATOM 5718 CA GLY B 320 71.068 51.965 71.774 1.00 65.13 C
ATOM 5719 C GLY B 320 69.704 51.336 71.936 1.00 64.61 C
ATOM 5720 O GLY B 320 69.507 50.486 72.807 1.00 64.73 O
ATOM 5721 N LEU B 321 68.753 51.751 71.111 1.00 63.21 N
ATOM 5722 CA LEU B 321 67.415 51.197 71.185 1.00 61.73 C
ATOM 5723 C LEU B 321 66.964 50.835 69.783 1.00 60.86 C
ATOM 5724 O LEU B 321 67.299 51.527 68.816 1.00 60.63 O
ATOM 5725 CB LEU B 321 66.450 52.216 71.807 1.00 63.11 C
ATOM 5726 CG LEU B 321 66.749 52.712 73.232 1.00 63.02 C
ATOM 5727 CD1 LEU B 321 65.671 53.694 73.672 1.00 62.93 C
ATOM 5728 CD2 LEU B 321 66.807 51.535 74.194 1.00 62.72 C
ATOM 5729 N PHE B 322 66.217 49.743 69.667 1.00 59.57 N
ATOM 5730 CA PHE B 322 65.726 49.316 68.362 1.00 58.81 C
ATOM 5731 C PHE B 322 64.340 48.717 68.474 1.00 58.63 C
ATOM 5732 O PHE B 322 64.064 47.933 69.380 1.00 59.71 O
ATOM 5733 CB PHE B 322 66.657 48.279 67.730 1.00 57.78 C
ATOM 5734 CG PHE B 322 66.200 47.819 66.376 1.00 55.94 C
ATOM 5735 CD1 PHE B 322 66.600 48.500 65.226 1.00 55.31 C
ATOM 5736 CD2 PHE B 322 65.299 46.760 66.253 1.00 54.84 C
ATOM 5737 CE1 PHE B 322 66.107 48.141 63.978 1.00 53.95 C
ATOM 5738 CE2 PHE B 322 64.798 46.392 65.009 1.00 53.77 C
ATOM 5739 CZ PHE B 322 65.202 47.085 63.870 1.00 54.56 C
ATOM 5740 N GLY B 323 63.472 49.080 67.540 1.00 58.38 N
ATOM 5741 CA GLY B 323 62.119 48.563 67.559 1.00 58.31 C
ATOM 5742 C GLY B 323 61.286 49.231 66.493 1.00 59.44 C
ATOM 5743 O GLY B 323 61.782 49.563 65.416 1.00 58.62 O
ATOM 5744 N PHE B 324 60.015 49.446 66.796 1.00 60.77 N
ATOM 5745 CA PHE B 324 59.117 50.067 65.839 1.00 60.91 C
ATOM 5746 C PHE B 324 58.194 51.099 66.476 1.00 61.20 C
ATOM 5747 O PHE B 324 57.767 50.953 67.619 1.00 61.64 O
ATOM 5748 CB PHE B 324 58.287 48.982 65.153 1.00 60.29 C
ATOM 5749 CG PHE B 324 57.362 48.237 66.084 1.00 60.54 C
ATOM 5750 CD1 PHE B 324 56.102 48.736 66.389 1.00 60.78 C
ATOM 5751 CD2 PHE B 324 57.740 47.017 66.629 1.00 60.91 C
ATOM 5752 CE1 PHE B 324 55.231 48.022 67.220 1.00 61.46 C
ATOM 5753 CE2 PHE B 324 56.876 46.299 67.460 1.00 61.35 C
ATOM 5754 CZ PHE B 324 55.622 46.800 67.754 1.00 61.25 C
ATOM 5755 N TYR B 325 57.879 52.137 65.713 1.00 61.42 N
ATOM 5756 CA TYR B 325 56.998 53.199 66.171 1.00 60.76 C
ATOM 5757 C TYR B 325 55.721 53.206 65.323 1.00 60.85 C
ATOM 5758 O TYR B 325 55.784 53.257 64.094 1.00 61.77 O
ATOM 5759 CB TYR B 325 57.709 54.541 66.025 1.00 60.25 C
ATOM 5760 CG TYR B 325 56.983 55.690 66.672 1.00 61.59 C
ATOM 5761 CD1 TYR B 325 57.433 56.225 67.875 1.00 61.68 C
ATOM 5762 CD2 TYR B 325 55.846 56.249 66.084 1.00 61.17 C
ATOM 5763 CE1 TYR B 325 56.783 57.291 68.481 1.00 62.17 C
ATOM 5764 CE2 TYR B 325 55.178 57.315 66.682 1.00 62.31 C
ATOM 5765 CZ TYR B 325 55.655 57.835 67.887 1.00 63.00 C
ATOM 5766 OH TYR B 325 55.016 58.890 68.508 1.00 62.23 O
ATOM 5767 N THR B 326 54.560 53.151 65.964 1.00 59.73 N
ATOM 5768 CA THR B 326 53.313 53.187 65.207 1.00 58.71 C
ATOM 5769 C THR B 326 52.483 54.434 65.541 1.00 58.44 C
ATOM 5770 O THR B 326 52.784 55.171 66.487 1.00 58.35 O
ATOM 5771 CB THR B 326 52.442 51.947 65.480 1.00 58.18 C
ATOM 5772 OG1 THR B 326 51.996 51.962 66.840 1.00 57.06 O
ATOM 5773 CG2 THR B 326 53.227 50.689 65.225 1.00 58.36 C
ATOM 5774 N ILE B 327 51.450 54.660 64.734 1.00 56.45 N
ATOM 5775 CA ILE B 327 50.516 55.769 64.891 1.00 54.72 C
ATOM 5776 C ILE B 327 49.244 55.260 64.240 1.00 55.05 C
ATOM 5777 O ILE B 327 49.223 55.019 63.031 1.00 53.91 O
ATOM 5778 CB ILE B 327 50.946 57.031 64.122 1.00 52.36 C
ATOM 5779 CG1 ILE B 327 52.344 57.468 64.535 1.00 52.08 C
ATOM 5780 CG2 ILE B 327 49.981 58.152 64.421 1.00 50.97 C
ATOM 5781 CD1 ILE B 327 52.788 58.757 63.880 1.00 51.23 C
ATOM 5782 N SER B 328 48.183 55.092 65.020 1.00 55.91 N
ATOM 5783 CA SER B 328 46.943 54.574 64.454 1.00 57.14 C
ATOM 5784 C SER B 328 45.697 55.091 65.140 1.00 59.01 C
ATOM 5785 O SER B 328 45.764 55.690 66.206 1.00 59.65 O
ATOM 5786 CB SER B 328 46.948 53.050 64.533 1.00 54.96 C
ATOM 5787 OG SER B 328 47.140 52.626 65.869 1.00 52.90 O
ATOM 5788 N GLN B 329 44.549 54.858 64.521 1.00 61.54 N
ATOM 5789 CA GLN B 329 43.308 55.279 65.135 1.00 63.50 C
ATOM 5790 C GLN B 329 43.244 54.478 66.420 1.00 63.09 C
ATOM 5791 O GLN B 329 43.783 53.380 66.493 1.00 63.04 O
ATOM 5792 CB GLN B 329 42.124 54.951 64.231 1.00 65.87 C
ATOM 5793 CG GLN B 329 41.989 55.887 63.043 1.00 69.08 C
ATOM 5794 CD GLN B 329 40.702 55.653 62.271 1.00 72.89 C
ATOM 5795 OE1 GLN B 329 40.429 56.328 61.267 1.00 74.61 O
ATOM 5796 NE2 GLN B 329 39.895 54.690 62.736 1.00 72.42 N
ATOM 5797 N ALA B 330 42.596 55.026 67.437 1.00 63.69 N
ATOM 5798 CA ALA B 330 42.511 54.347 68.725 1.00 62.76 C
ATOM 5799 C ALA B 330 41.935 52.940 68.662 1.00 61.71 C
ATOM 5800 O ALA B 330 42.501 52.011 69.223 1.00 61.08 O
ATOM 5801 CB ALA B 330 41.706 55.193 69.698 1.00 62.42 C
ATOM 5802 N ALA B 331 40.813 52.785 67.976 1.00 62.02 N
ATOM 5803 CA ALA B 331 40.156 51.490 67.884 1.00 63.61 C
ATOM 5804 C ALA B 331 40.967 50.402 67.193 1.00 65.07 C
ATOM 5805 O ALA B 331 40.790 49.216 67.473 1.00 65.92 O
ATOM 5806 CB ALA B 331 38.818 51.648 67.193 1.00 62.99 C
ATOM 5807 N HIS B 332 41.865 50.794 66.303 1.00 66.44 N
ATOM 5808 CA HIS B 332 42.658 49.816 65.578 1.00 67.84 C
ATOM 5809 C HIS B 332 44.100 49.707 66.052 1.00 68.40 C
ATOM 5810 O HIS B 332 44.916 49.037 65.420 1.00 69.54 O
ATOM 5811 CB HIS B 332 42.625 50.145 64.087 1.00 68.94 C
ATOM 5812 CG HIS B 332 41.242 50.304 63.544 1.00 69.30 C
ATOM 5813 ND1 HIS B 332 40.268 49.340 63.695 1.00 70.41 N
ATOM 5814 CD2 HIS B 332 40.662 51.320 62.867 1.00 70.34 C
ATOM 5815 CE1 HIS B 332 39.147 49.758 63.136 1.00 70.72 C
ATOM 5816 NE2 HIS B 332 39.359 50.957 62.626 1.00 70.72 N
ATOM 5817 N ALA B 333 44.412 50.357 67.166 1.00 68.25 N
ATOM 5818 CA ALA B 333 45.765 50.322 67.711 1.00 67.53 C
ATOM 5819 C ALA B 333 46.193 48.894 68.006 1.00 67.44 C
ATOM 5820 O ALA B 333 47.319 48.491 67.694 1.00 66.58 O
ATOM 5821 CB ALA B 333 45.831 51.147 68.983 1.00 68.41 C
ATOM 5822 N GLY B 334 45.284 48.137 68.615 1.00 67.51 N
ATOM 5823 CA GLY B 334 45.575 46.759 68.959 1.00 67.21 C
ATOM 5824 C GLY B 334 46.144 45.992 67.788 1.00 66.79 C
ATOM 5825 O GLY B 334 47.294 45.555 67.813 1.00 66.30 O
ATOM 5826 N GLU B 335 45.332 45.840 66.750 1.00 67.28 N
ATOM 5827 CA GLU B 335 45.748 45.116 65.565 1.00 67.39 C
ATOM 5828 C GLU B 335 46.990 45.699 64.909 1.00 66.14 C
ATOM 5829 O GLU B 335 47.881 44.957 64.510 1.00 67.10 O
ATOM 5830 CB GLU B 335 44.596 45.055 64.565 1.00 69.12 C
ATOM 5831 CG GLU B 335 43.772 46.315 64.503 1.00 74.06 C
ATOM 5832 CD GLU B 335 42.691 46.258 63.431 1.00 77.73 C
ATOM 5833 OE1 GLU B 335 43.023 46.388 62.223 1.00 79.08 O
ATOM 5834 OE2 GLU B 335 41.507 46.077 63.802 1.00 78.88 O
ATOM 5835 N VAL B 336 47.059 47.020 64.805 1.00 64.80 N
ATOM 5836 CA VAL B 336 48.210 47.673 64.184 1.00 63.06 C
ATOM 5837 C VAL B 336 49.520 47.394 64.900 1.00 63.93 C
ATOM 5838 O VAL B 336 50.561 47.243 64.263 1.00 63.91 O
ATOM 5839 CB VAL B 336 48.014 49.191 64.119 1.00 61.37 C
ATOM 5840 CG1 VAL B 336 49.313 49.886 63.717 1.00 57.39 C
ATOM 5841 CG2 VAL B 336 46.914 49.499 63.137 1.00 60.32 C
ATOM 5842 N ILE B 337 49.476 47.338 66.223 1.00 64.37 N
ATOM 5843 CA ILE B 337 50.683 47.077 66.981 1.00 64.96 C
ATOM 5844 C ILE B 337 51.083 45.607 66.897 1.00 65.03 C
ATOM 5845 O ILE B 337 52.266 45.284 66.759 1.00 65.10 O
ATOM 5846 CB ILE B 337 50.499 47.493 68.440 1.00 65.86 C
ATOM 5847 CG1 ILE B 337 50.115 48.974 68.487 1.00 64.89 C
ATOM 5848 CG2 ILE B 337 51.792 47.242 69.229 1.00 65.76 C
ATOM 5849 CD1 ILE B 337 49.829 49.490 69.876 1.00 65.20 C
ATOM 5850 N ARG B 338 50.103 44.712 66.973 1.00 65.42 N
ATOM 5851 CA ARG B 338 50.399 43.290 66.886 1.00 65.93 C
ATOM 5852 C ARG B 338 50.934 42.947 65.506 1.00 66.24 C
ATOM 5853 O ARG B 338 51.906 42.209 65.381 1.00 66.61 O
ATOM 5854 CB ARG B 338 49.159 42.457 67.205 1.00 66.39 C
ATOM 5855 CG ARG B 338 48.999 42.207 68.694 1.00 68.40 C
ATOM 5856 CD ARG B 338 47.899 41.211 69.012 1.00 71.25 C
ATOM 5857 NE ARG B 338 46.662 41.862 69.433 1.00 75.42 N
ATOM 5858 CZ ARG B 338 45.903 42.607 68.636 1.00 78.72 C
ATOM 5859 NH1 ARG B 338 46.259 42.796 67.373 1.00 81.67 N
ATOM 5860 NH2 ARG B 338 44.782 43.155 69.094 1.00 79.58 N
ATOM 5861 N ALA B 339 50.313 43.498 64.471 1.00 67.13 N
ATOM 5862 CA ALA B 339 50.757 43.254 63.103 1.00 68.11 C
ATOM 5863 C ALA B 339 52.237 43.620 62.961 1.00 68.80 C
ATOM 5864 O ALA B 339 53.012 42.893 62.339 1.00 69.35 O
ATOM 5865 CB ALA B 339 49.913 44.076 62.119 1.00 67.80 C
ATOM 5866 N ALA B 340 52.623 44.750 63.543 1.00 69.34 N
ATOM 5867 CA ALA B 340 54.003 45.207 63.483 1.00 70.08 C
ATOM 5868 C ALA B 340 54.919 44.223 64.199 1.00 71.06 C
ATOM 5869 O ALA B 340 56.084 44.077 63.835 1.00 71.74 O
ATOM 5870 CB ALA B 340 54.125 46.586 64.114 1.00 69.55 C
ATOM 5871 N MET B 341 54.392 43.554 65.219 1.00 71.82 N
ATOM 5872 CA MET B 341 55.172 42.580 65.975 1.00 73.44 C
ATOM 5873 C MET B 341 55.464 41.321 65.171 1.00 74.10 C
ATOM 5874 O MET B 341 56.579 40.793 65.211 1.00 73.34 O
ATOM 5875 CB MET B 341 54.439 42.201 67.255 1.00 74.61 C
ATOM 5876 CG MET B 341 54.810 43.052 68.436 1.00 77.39 C
ATOM 5877 SD MET B 341 56.133 42.287 69.383 1.00 80.50 S
ATOM 5878 CE MET B 341 57.443 42.323 68.227 1.00 79.72 C
ATOM 5879 N ASN B 342 54.456 40.845 64.442 1.00 74.66 N
ATOM 5880 CA ASN B 342 54.599 39.643 63.625 1.00 75.66 C
ATOM 5881 C ASN B 342 55.631 39.857 62.539 1.00 75.01 C
ATOM 5882 O ASN B 342 56.358 38.938 62.177 1.00 74.70 O
ATOM 5883 CB ASN B 342 53.270 39.267 62.973 1.00 77.71 C
ATOM 5884 CG ASN B 342 52.166 39.076 63.985 1.00 80.58 C
ATOM 5885 OD1 ASN B 342 52.319 38.325 64.956 1.00 81.98 O
ATOM 5886 ND2 ASN B 342 51.038 39.756 63.769 1.00 81.39 N
ATOM 5887 N GLN B 343 55.681 41.074 62.013 1.00 74.63 N
ATOM 5888 CA GLN B 343 56.631 41.396 60.967 1.00 74.26 C
ATOM 5889 C GLN B 343 58.049 41.288 61.495 1.00 74.17 C
ATOM 5890 O GLN B 343 58.991 41.071 60.732 1.00 73.34 O
ATOM 5891 CB GLN B 343 56.355 42.794 60.419 1.00 73.85 C
ATOM 5892 CG GLN B 343 55.212 42.813 59.426 1.00 75.06 C
ATOM 5893 CD GLN B 343 55.520 42.006 58.163 1.00 76.47 C
ATOM 5894 OE1 GLN B 343 54.623 41.682 57.387 1.00 78.10 O
ATOM 5895 NE2 GLN B 343 56.794 41.691 57.949 1.00 76.12 N
ATOM 5896 N LEU B 344 58.196 41.429 62.807 1.00 74.58 N
ATOM 5897 CA LEU B 344 59.508 41.325 63.423 1.00 76.57 C
ATOM 5898 C LEU B 344 59.857 39.871 63.687 1.00 77.76 C
ATOM 5899 O LEU B 344 61.003 39.459 63.501 1.00 78.38 O
ATOM 5900 CB LEU B 344 59.554 42.129 64.714 1.00 76.08 C
ATOM 5901 CG LEU B 344 59.945 43.577 64.437 1.00 76.89 C
ATOM 5902 CD1 LEU B 344 59.381 44.446 65.517 1.00 77.85 C
ATOM 5903 CD2 LEU B 344 61.461 43.717 64.341 1.00 75.45 C
ATOM 5904 N LYS B 345 58.870 39.094 64.126 1.00 78.49 N
ATOM 5905 CA LYS B 345 59.093 37.679 64.369 1.00 78.62 C
ATOM 5906 C LYS B 345 59.381 37.092 62.994 1.00 78.05 C
ATOM 5907 O LYS B 345 60.469 36.587 62.730 1.00 78.14 O
ATOM 5908 CB LYS B 345 57.842 37.019 64.952 1.00 80.41 C
ATOM 5909 CG LYS B 345 57.307 37.670 66.222 1.00 84.80 C
ATOM 5910 CD LYS B 345 56.335 36.742 66.955 1.00 87.87 C
ATOM 5911 CE LYS B 345 55.222 36.243 66.032 1.00 90.49 C
ATOM 5912 NZ LYS B 345 54.390 35.163 66.657 1.00 91.93 N
ATOM 5913 N ALA B 346 58.393 37.193 62.112 1.00 77.32 N
ATOM 5914 CA ALA B 346 58.500 36.686 60.752 1.00 76.19 C
ATOM 5915 C ALA B 346 59.858 36.969 60.122 1.00 75.78 C
ATOM 5916 O ALA B 346 60.317 36.217 59.264 1.00 76.15 O
ATOM 5917 CB ALA B 346 57.391 37.284 59.891 1.00 74.87 C
ATOM 5918 N ALA B 347 60.500 38.049 60.550 1.00 75.74 N
ATOM 5919 CA ALA B 347 61.798 38.416 60.010 1.00 77.18 C
ATOM 5920 C ALA B 347 62.917 37.714 60.765 1.00 78.80 C
ATOM 5921 O ALA B 347 63.963 37.412 60.194 1.00 78.67 O
ATOM 5922 CB ALA B 347 61.979 39.914 60.085 1.00 77.17 C
ATOM 5923 N ALA B 348 62.688 37.468 62.052 1.00 80.93 N
ATOM 5924 CA ALA B 348 63.660 36.791 62.908 1.00 83.30 C
ATOM 5925 C ALA B 348 63.746 35.321 62.497 1.00 85.04 C
ATOM 5926 O ALA B 348 64.754 34.648 62.731 1.00 84.87 O
ATOM 5927 CB ALA B 348 63.236 36.905 64.373 1.00 82.47 C
ATOM 5928 N GLN B 349 62.675 34.839 61.873 1.00 86.52 N
ATOM 5929 CA GLN B 349 62.600 33.464 61.409 1.00 87.99 C
ATOM 5930 C GLN B 349 62.941 33.383 59.919 1.00 89.65 C
ATOM 5931 O GLN B 349 62.136 32.916 59.112 1.00 90.94 O
ATOM 5932 CB GLN B 349 61.198 32.920 61.656 1.00 87.14 C
ATOM 5933 CG GLN B 349 60.734 33.115 63.083 1.00 87.58 C
ATOM 5934 CD GLN B 349 59.293 32.710 63.276 1.00 87.84 C
ATOM 5935 OE1 GLN B 349 58.420 33.114 62.508 1.00 89.46 O
ATOM 5936 NE2 GLN B 349 59.031 31.913 64.305 1.00 87.70 N
ATOM 5937 N GLY B 350 64.132 33.861 59.565 1.00 90.61 N
ATOM 5938 CA GLY B 350 64.590 33.827 58.184 1.00 91.20 C
ATOM 5939 C GLY B 350 63.724 34.451 57.098 1.00 91.58 C
ATOM 5940 O GLY B 350 64.107 34.430 55.922 1.00 92.03 O
ATOM 5941 N GLY B 351 62.571 35.004 57.472 1.00 91.31 N
ATOM 5942 CA GLY B 351 61.686 35.623 56.496 1.00 90.59 C
ATOM 5943 C GLY B 351 62.256 36.879 55.853 1.00 90.52 C
ATOM 5944 O GLY B 351 61.533 37.854 55.628 1.00 90.79 O
ATOM 5945 N VAL B 352 63.554 36.846 55.555 1.00 89.69 N
ATOM 5946 CA VAL B 352 64.257 37.962 54.934 1.00 88.84 C
ATOM 5947 C VAL B 352 64.949 37.515 53.650 1.00 89.16 C
ATOM 5948 O VAL B 352 65.889 36.725 53.694 1.00 88.70 O
ATOM 5949 CB VAL B 352 65.332 38.520 55.875 1.00 87.89 C
ATOM 5950 CG1 VAL B 352 66.102 39.635 55.186 1.00 86.78 C
ATOM 5951 CG2 VAL B 352 64.685 39.003 57.153 1.00 88.21 C
ATOM 5952 N THR B 353 64.482 38.020 52.511 1.00 89.43 N
ATOM 5953 CA THR B 353 65.070 37.682 51.214 1.00 89.25 C
ATOM 5954 C THR B 353 66.502 38.199 51.167 1.00 88.87 C
ATOM 5955 O THR B 353 66.888 39.066 51.953 1.00 88.70 O
ATOM 5956 CB THR B 353 64.279 38.329 50.042 1.00 89.98 C
ATOM 5957 OG1 THR B 353 62.963 37.769 49.979 1.00 90.46 O
ATOM 5958 CG2 THR B 353 64.984 38.098 48.710 1.00 90.04 C
ATOM 5959 N GLU B 354 67.291 37.659 50.245 1.00 88.82 N
ATOM 5960 CA GLU B 354 68.674 38.079 50.097 1.00 88.62 C
ATOM 5961 C GLU B 354 68.676 39.346 49.250 1.00 88.57 C
ATOM 5962 O GLU B 354 69.624 40.130 49.277 1.00 87.98 O
ATOM 5963 CB GLU B 354 69.485 36.974 49.416 1.00 87.96 C
ATOM 5964 CG GLU B 354 70.985 37.205 49.418 1.00 87.92 C
ATOM 5965 CD GLU B 354 71.568 37.229 50.815 1.00 88.25 C
ATOM 5966 OE1 GLU B 354 71.253 36.314 51.606 1.00 87.99 O
ATOM 5967 OE2 GLU B 354 72.348 38.154 51.120 1.00 87.98 O
ATOM 5968 N GLU B 355 67.594 39.537 48.499 1.00 89.19 N
ATOM 5969 CA GLU B 355 67.439 40.707 47.648 1.00 89.71 C
ATOM 5970 C GLU B 355 66.940 41.854 48.514 1.00 88.69 C
ATOM 5971 O GLU B 355 67.217 43.023 48.241 1.00 88.58 O
ATOM 5972 CB GLU B 355 66.425 40.432 46.539 1.00 92.19 C
ATOM 5973 CG GLU B 355 66.208 41.620 45.616 1.00 95.94 C
ATOM 5974 CD GLU B 355 64.935 41.507 44.789 1.00 97.66 C
ATOM 5975 OE1 GLU B 355 63.845 41.362 45.389 1.00 98.70 O
ATOM 5976 OE2 GLU B 355 65.022 41.573 43.541 1.00 98.73 O
ATOM 5977 N ASP B 356 66.186 41.504 49.552 1.00 86.91 N
ATOM 5978 CA ASP B 356 65.667 42.491 50.485 1.00 85.09 C
ATOM 5979 C ASP B 356 66.858 43.214 51.086 1.00 84.04 C
ATOM 5980 O ASP B 356 66.892 44.444 51.149 1.00 84.35 O
ATOM 5981 CB ASP B 356 64.878 41.808 51.605 1.00 84.97 C
ATOM 5982 CG ASP B 356 63.566 41.224 51.122 1.00 84.83 C
ATOM 5983 OD1 ASP B 356 63.301 41.287 49.900 1.00 85.00 O
ATOM 5984 OD2 ASP B 356 62.806 40.700 51.968 1.00 83.47 O
ATOM 5985 N VAL B 357 67.838 42.432 51.523 1.00 82.67 N
ATOM 5986 CA VAL B 357 69.045 42.976 52.128 1.00 82.01 C
ATOM 5987 C VAL B 357 69.839 43.805 51.121 1.00 81.92 C
ATOM 5988 O VAL B 357 70.572 44.719 51.488 1.00 80.49 O
ATOM 5989 CB VAL B 357 69.934 41.841 52.687 1.00 80.83 C
ATOM 5990 CG1 VAL B 357 71.224 42.407 53.235 1.00 79.88 C
ATOM 5991 CG2 VAL B 357 69.184 41.092 53.780 1.00 80.32 C
ATOM 5992 N THR B 358 69.679 43.489 49.844 1.00 83.04 N
ATOM 5993 CA THR B 358 70.390 44.215 48.804 1.00 85.08 C
ATOM 5994 C THR B 358 69.763 45.593 48.638 1.00 85.92 C
ATOM 5995 O THR B 358 70.459 46.609 48.628 1.00 85.78 O
ATOM 5996 CB THR B 358 70.338 43.457 47.447 1.00 85.67 C
ATOM 5997 OG1 THR B 358 70.928 42.157 47.598 1.00 86.15 O
ATOM 5998 CG2 THR B 358 71.100 44.228 46.369 1.00 85.17 C
ATOM 5999 N LYS B 359 68.439 45.617 48.516 1.00 87.23 N
ATOM 6000 CA LYS B 359 67.706 46.865 48.343 1.00 87.85 C
ATOM 6001 C LYS B 359 67.914 47.790 49.533 1.00 87.22 C
ATOM 6002 O LYS B 359 68.291 48.949 49.365 1.00 87.30 O
ATOM 6003 CB LYS B 359 66.216 46.575 48.149 1.00 89.41 C
ATOM 6004 CG LYS B 359 65.910 45.811 46.863 1.00 90.93 C
ATOM 6005 CD LYS B 359 64.414 45.647 46.644 1.00 92.04 C
ATOM 6006 CE LYS B 359 64.129 45.051 45.275 1.00 93.03 C
ATOM 6007 NZ LYS B 359 62.669 44.951 45.004 1.00 94.46 N
ATOM 6008 N ALA B 360 67.675 47.273 50.733 1.00 86.08 N
ATOM 6009 CA ALA B 360 67.851 48.059 51.943 1.00 85.78 C
ATOM 6010 C ALA B 360 69.236 48.711 51.968 1.00 85.86 C
ATOM 6011 O ALA B 360 69.381 49.873 52.357 1.00 86.80 O
ATOM 6012 CB ALA B 360 67.667 47.173 53.164 1.00 85.53 C
ATOM 6013 N LYS B 361 70.250 47.966 51.541 1.00 85.29 N
ATOM 6014 CA LYS B 361 71.614 48.482 51.522 1.00 84.33 C
ATOM 6015 C LYS B 361 71.754 49.696 50.615 1.00 83.98 C
ATOM 6016 O LYS B 361 72.611 50.547 50.841 1.00 83.71 O
ATOM 6017 CB LYS B 361 72.591 47.391 51.080 1.00 84.40 C
ATOM 6018 CG LYS B 361 72.825 46.297 52.114 1.00 83.20 C
ATOM 6019 CD LYS B 361 73.731 45.218 51.557 1.00 82.90 C
ATOM 6020 CE LYS B 361 73.951 44.083 52.542 1.00 82.35 C
ATOM 6021 NZ LYS B 361 74.655 42.946 51.880 1.00 82.08 N
ATOM 6022 N ASN B 362 70.921 49.773 49.585 1.00 84.23 N
ATOM 6023 CA ASN B 362 70.968 50.911 48.672 1.00 85.26 C
ATOM 6024 C ASN B 362 70.356 52.116 49.357 1.00 84.98 C
ATOM 6025 O ASN B 362 70.957 53.189 49.403 1.00 85.34 O
ATOM 6026 CB ASN B 362 70.186 50.626 47.387 1.00 86.71 C
ATOM 6027 CG ASN B 362 70.890 49.640 46.488 1.00 88.70 C
ATOM 6028 OD1 ASN B 362 72.049 49.842 46.110 1.00 88.67 O
ATOM 6029 ND2 ASN B 362 70.195 48.561 46.135 1.00 89.67 N
ATOM 6030 N GLN B 363 69.150 51.926 49.887 1.00 84.15 N
ATOM 6031 CA GLN B 363 68.432 52.983 50.576 1.00 82.31 C
ATOM 6032 C GLN B 363 69.317 53.527 51.683 1.00 82.05 C
ATOM 6033 O GLN B 363 69.383 54.739 51.902 1.00 82.87 O
ATOM 6034 CB GLN B 363 67.123 52.430 51.137 1.00 81.19 C
ATOM 6035 CG GLN B 363 66.255 51.818 50.053 1.00 80.01 C
ATOM 6036 CD GLN B 363 65.004 51.167 50.586 1.00 79.64 C
ATOM 6037 OE1 GLN B 363 65.021 50.547 51.644 1.00 80.71 O
ATOM 6038 NE2 GLN B 363 63.913 51.284 49.840 1.00 79.11 N
ATOM 6039 N LEU B 364 70.024 52.630 52.360 1.00 80.85 N
ATOM 6040 CA LEU B 364 70.914 53.038 53.436 1.00 80.28 C
ATOM 6041 C LEU B 364 72.081 53.867 52.888 1.00 79.91 C
ATOM 6042 O LEU B 364 72.375 54.955 53.390 1.00 79.18 O
ATOM 6043 CB LEU B 364 71.417 51.802 54.180 1.00 79.16 C
ATOM 6044 CG LEU B 364 72.149 52.026 55.504 1.00 79.68 C
ATOM 6045 CD1 LEU B 364 71.707 53.320 56.174 1.00 78.97 C
ATOM 6046 CD2 LEU B 364 71.873 50.832 56.403 1.00 79.82 C
ATOM 6047 N LYS B 365 72.738 53.359 51.851 1.00 79.79 N
ATOM 6048 CA LYS B 365 73.850 54.078 51.240 1.00 79.68 C
ATOM 6049 C LYS B 365 73.366 55.420 50.703 1.00 79.03 C
ATOM 6050 O LYS B 365 74.041 56.443 50.848 1.00 78.17 O
ATOM 6051 CB LYS B 365 74.436 53.287 50.072 1.00 81.23 C
ATOM 6052 CG LYS B 365 75.148 51.996 50.414 1.00 82.90 C
ATOM 6053 CD LYS B 365 75.778 51.451 49.142 1.00 84.27 C
ATOM 6054 CE LYS B 365 76.339 50.058 49.314 1.00 85.23 C
ATOM 6055 NZ LYS B 365 76.863 49.563 48.012 1.00 85.15 N
ATOM 6056 N ALA B 366 72.198 55.399 50.061 1.00 78.49 N
ATOM 6057 CA ALA B 366 71.608 56.603 49.485 1.00 78.02 C
ATOM 6058 C ALA B 366 71.348 57.612 50.589 1.00 78.24 C
ATOM 6059 O ALA B 366 71.900 58.717 50.579 1.00 78.18 O
ATOM 6060 CB ALA B 366 70.306 56.264 48.763 1.00 76.72 C
ATOM 6061 N THR B 367 70.512 57.218 51.544 1.00 78.21 N
ATOM 6062 CA THR B 367 70.172 58.073 52.670 1.00 78.45 C
ATOM 6063 C THR B 367 71.415 58.766 53.193 1.00 78.23 C
ATOM 6064 O THR B 367 71.523 59.982 53.131 1.00 78.60 O
ATOM 6065 CB THR B 367 69.533 57.264 53.814 1.00 79.03 C
ATOM 6066 OG1 THR B 367 68.222 56.831 53.422 1.00 79.04 O
ATOM 6067 CG2 THR B 367 69.438 58.109 55.074 1.00 78.52 C
ATOM 6068 N TYR B 368 72.353 57.984 53.704 1.00 78.99 N
ATOM 6069 CA TYR B 368 73.590 58.543 54.228 1.00 80.19 C
ATOM 6070 C TYR B 368 74.176 59.588 53.281 1.00 80.14 C
ATOM 6071 O TYR B 368 74.553 60.687 53.703 1.00 80.19 O
ATOM 6072 CB TYR B 368 74.623 57.436 54.445 1.00 81.24 C
ATOM 6073 CG TYR B 368 76.031 57.970 54.590 1.00 82.69 C
ATOM 6074 CD1 TYR B 368 76.459 58.551 55.785 1.00 82.69 C
ATOM 6075 CD2 TYR B 368 76.918 57.948 53.508 1.00 82.93 C
ATOM 6076 CE1 TYR B 368 77.741 59.104 55.901 1.00 83.08 C
ATOM 6077 CE2 TYR B 368 78.200 58.497 53.612 1.00 83.70 C
ATOM 6078 CZ TYR B 368 78.607 59.077 54.811 1.00 83.61 C
ATOM 6079 OH TYR B 368 79.865 59.640 54.911 1.00 83.12 O
ATOM 6080 N LEU B 369 74.257 59.234 52.003 1.00 79.71 N
ATOM 6081 CA LEU B 369 74.816 60.128 51.001 1.00 79.63 C
ATOM 6082 C LEU B 369 74.048 61.415 50.805 1.00 78.09 C
ATOM 6083 O LEU B 369 74.640 62.456 50.526 1.00 78.25 O
ATOM 6084 CB LEU B 369 74.941 59.410 49.660 1.00 81.54 C
ATOM 6085 CG LEU B 369 76.242 58.625 49.476 1.00 83.32 C
ATOM 6086 CD1 LEU B 369 76.274 58.019 48.072 1.00 83.30 C
ATOM 6087 CD2 LEU B 369 77.445 59.558 49.693 1.00 82.99 C
ATOM 6088 N MET B 370 72.730 61.342 50.936 1.00 76.52 N
ATOM 6089 CA MET B 370 71.903 62.523 50.778 1.00 75.23 C
ATOM 6090 C MET B 370 72.025 63.395 52.021 1.00 75.20 C
ATOM 6091 O MET B 370 72.103 64.616 51.924 1.00 75.30 O
ATOM 6092 CB MET B 370 70.453 62.112 50.523 1.00 73.98 C
ATOM 6093 CG MET B 370 70.302 61.302 49.236 1.00 74.06 C
ATOM 6094 SD MET B 370 68.622 60.990 48.592 1.00 74.44 S
ATOM 6095 CE MET B 370 68.192 59.484 49.467 1.00 74.43 C
ATOM 6096 N SER B 371 72.079 62.750 53.183 1.00 75.71 N
ATOM 6097 CA SER B 371 72.200 63.425 54.475 1.00 75.79 C
ATOM 6098 C SER B 371 73.242 64.522 54.505 1.00 75.51 C
ATOM 6099 O SER B 371 73.104 65.494 55.242 1.00 75.46 O
ATOM 6100 CB SER B 371 72.555 62.414 55.563 1.00 76.82 C
ATOM 6101 OG SER B 371 71.573 61.397 55.664 1.00 79.62 O
ATOM 6102 N VAL B 372 74.287 64.364 53.705 1.00 76.10 N
ATOM 6103 CA VAL B 372 75.373 65.337 53.681 1.00 77.00 C
ATOM 6104 C VAL B 372 75.295 66.432 52.620 1.00 77.31 C
ATOM 6105 O VAL B 372 76.247 67.193 52.446 1.00 77.83 O
ATOM 6106 CB VAL B 372 76.727 64.617 53.548 1.00 77.04 C
ATOM 6107 CG1 VAL B 372 77.114 64.008 54.892 1.00 76.40 C
ATOM 6108 CG2 VAL B 372 76.634 63.527 52.468 1.00 76.10 C
ATOM 6109 N GLU B 373 74.168 66.520 51.921 1.00 77.50 N
ATOM 6110 CA GLU B 373 73.984 67.539 50.883 1.00 77.59 C
ATOM 6111 C GLU B 373 73.934 68.960 51.457 1.00 77.34 C
ATOM 6112 O GLU B 373 74.485 69.898 50.876 1.00 76.39 O
ATOM 6113 CB GLU B 373 72.692 67.274 50.106 1.00 77.56 C
ATOM 6114 CG GLU B 373 72.761 66.137 49.114 1.00 78.17 C
ATOM 6115 CD GLU B 373 71.401 65.813 48.526 1.00 80.56 C
ATOM 6116 OE1 GLU B 373 71.342 65.056 47.527 1.00 79.95 O
ATOM 6117 OE2 GLU B 373 70.387 66.311 49.071 1.00 82.15 O
ATOM 6118 N THR B 374 73.265 69.101 52.598 1.00 77.14 N
ATOM 6119 CA THR B 374 73.106 70.386 53.275 1.00 76.12 C
ATOM 6120 C THR B 374 74.256 70.693 54.236 1.00 75.54 C
ATOM 6121 O THR B 374 74.778 69.800 54.893 1.00 76.03 O
ATOM 6122 CB THR B 374 71.791 70.410 54.082 1.00 76.16 C
ATOM 6123 OG1 THR B 374 71.868 69.461 55.156 1.00 74.97 O
ATOM 6124 CG2 THR B 374 70.615 70.057 53.186 1.00 75.52 C
ATOM 6125 N ALA B 375 74.636 71.963 54.325 1.00 74.79 N
ATOM 6126 CA ALA B 375 75.708 72.379 55.216 1.00 74.72 C
ATOM 6127 C ALA B 375 75.507 71.855 56.639 1.00 75.29 C
ATOM 6128 O ALA B 375 76.461 71.440 57.294 1.00 74.92 O
ATOM 6129 CB ALA B 375 75.806 73.901 55.227 1.00 74.18 C
ATOM 6130 N GLN B 376 74.269 71.871 57.119 1.00 76.91 N
ATOM 6131 CA GLN B 376 73.987 71.402 58.471 1.00 79.59 C
ATOM 6132 C GLN B 376 74.296 69.918 58.591 1.00 79.91 C
ATOM 6133 O GLN B 376 74.790 69.456 59.621 1.00 79.75 O
ATOM 6134 CB GLN B 376 72.515 71.647 58.842 1.00 81.60 C
ATOM 6135 CG GLN B 376 72.210 71.455 60.343 1.00 85.15 C
ATOM 6136 CD GLN B 376 70.714 71.553 60.689 1.00 86.93 C
ATOM 6137 OE1 GLN B 376 70.045 72.527 60.338 1.00 87.40 O
ATOM 6138 NE2 GLN B 376 70.196 70.544 61.392 1.00 87.27 N
ATOM 6139 N GLY B 377 73.996 69.175 57.530 1.00 80.68 N
ATOM 6140 CA GLY B 377 74.235 67.741 57.534 1.00 81.65 C
ATOM 6141 C GLY B 377 75.702 67.375 57.418 1.00 81.65 C
ATOM 6142 O GLY B 377 76.206 66.519 58.147 1.00 81.72 O
ATOM 6143 N LEU B 378 76.391 68.023 56.489 1.00 81.28 N
ATOM 6144 CA LEU B 378 77.804 67.765 56.293 1.00 80.35 C
ATOM 6145 C LEU B 378 78.561 68.062 57.580 1.00 79.39 C
ATOM 6146 O LEU B 378 79.312 67.228 58.077 1.00 78.33 O
ATOM 6147 CB LEU B 378 78.348 68.638 55.162 1.00 80.39 C
ATOM 6148 CG LEU B 378 79.846 68.475 54.912 1.00 81.14 C
ATOM 6149 CD1 LEU B 378 80.165 67.005 54.699 1.00 81.17 C
ATOM 6150 CD2 LEU B 378 80.261 69.302 53.707 1.00 81.24 C
ATOM 6151 N LEU B 379 78.347 69.254 58.120 1.00 79.13 N
ATOM 6152 CA LEU B 379 79.020 69.661 59.340 1.00 79.42 C
ATOM 6153 C LEU B 379 78.737 68.716 60.488 1.00 79.93 C
ATOM 6154 O LEU B 379 79.624 68.424 61.292 1.00 80.82 O
ATOM 6155 CB LEU B 379 78.592 71.064 59.759 1.00 79.04 C
ATOM 6156 CG LEU B 379 79.250 71.509 61.067 1.00 79.15 C
ATOM 6157 CD1 LEU B 379 80.683 71.938 60.796 1.00 80.05 C
ATOM 6158 CD2 LEU B 379 78.472 72.652 61.668 1.00 80.15 C
ATOM 6159 N ASN B 380 77.500 68.245 60.581 1.00 79.69 N
ATOM 6160 CA ASN B 380 77.168 67.353 61.672 1.00 80.03 C
ATOM 6161 C ASN B 380 77.846 66.012 61.501 1.00 79.99 C
ATOM 6162 O ASN B 380 78.281 65.415 62.481 1.00 80.39 O
ATOM 6163 CB ASN B 380 75.660 67.150 61.802 1.00 80.65 C
ATOM 6164 CG ASN B 380 75.302 66.269 62.996 1.00 81.21 C
ATOM 6165 OD1 ASN B 380 75.742 66.520 64.123 1.00 80.96 O
ATOM 6166 ND2 ASN B 380 74.506 65.235 62.754 1.00 80.67 N
ATOM 6167 N GLU B 381 77.943 65.534 60.265 1.00 79.81 N
ATOM 6168 CA GLU B 381 78.597 64.254 60.025 1.00 79.24 C
ATOM 6169 C GLU B 381 80.076 64.342 60.407 1.00 78.17 C
ATOM 6170 O GLU B 381 80.578 63.500 61.152 1.00 77.76 O
ATOM 6171 CB GLU B 381 78.458 63.835 58.560 1.00 80.68 C
ATOM 6172 CG GLU B 381 79.017 62.449 58.286 1.00 84.03 C
ATOM 6173 CD GLU B 381 78.331 61.366 59.115 1.00 86.38 C
ATOM 6174 OE1 GLU B 381 78.091 61.589 60.328 1.00 87.02 O
ATOM 6175 OE2 GLU B 381 78.042 60.283 58.556 1.00 87.17 O
ATOM 6176 N ILE B 382 80.763 65.368 59.906 1.00 76.40 N
ATOM 6177 CA ILE B 382 82.171 65.568 60.213 1.00 75.24 C
ATOM 6178 C ILE B 382 82.396 65.619 61.717 1.00 76.05 C
ATOM 6179 O ILE B 382 83.021 64.729 62.290 1.00 76.76 O
ATOM 6180 CB ILE B 382 82.695 66.870 59.592 1.00 73.90 C
ATOM 6181 CG1 ILE B 382 82.704 66.738 58.068 1.00 74.02 C
ATOM 6182 CG2 ILE B 382 84.077 67.185 60.127 1.00 73.13 C
ATOM 6183 CD1 ILE B 382 83.146 67.985 57.327 1.00 73.49 C
ATOM 6184 N GLY B 383 81.872 66.657 62.356 1.00 76.65 N
ATOM 6185 CA GLY B 383 82.043 66.810 63.790 1.00 78.21 C
ATOM 6186 C GLY B 383 81.635 65.645 64.679 1.00 79.59 C
ATOM 6187 O GLY B 383 82.294 65.367 65.681 1.00 79.55 O
ATOM 6188 N SER B 384 80.549 64.964 64.336 1.00 81.02 N
ATOM 6189 CA SER B 384 80.083 63.847 65.148 1.00 83.26 C
ATOM 6190 C SER B 384 81.170 62.804 65.306 1.00 84.83 C
ATOM 6191 O SER B 384 81.480 62.369 66.419 1.00 84.86 O
ATOM 6192 CB SER B 384 78.851 63.204 64.513 1.00 84.03 C
ATOM 6193 OG SER B 384 77.752 64.096 64.531 1.00 86.07 O
ATOM 6194 N GLU B 385 81.740 62.405 64.175 1.00 86.33 N
ATOM 6195 CA GLU B 385 82.805 61.417 64.150 1.00 87.03 C
ATOM 6196 C GLU B 385 84.088 62.044 64.696 1.00 86.41 C
ATOM 6197 O GLU B 385 84.741 61.477 65.568 1.00 86.24 O
ATOM 6198 CB GLU B 385 83.000 60.929 62.717 1.00 89.09 C
ATOM 6199 CG GLU B 385 84.133 59.950 62.531 1.00 93.75 C
ATOM 6200 CD GLU B 385 84.167 59.389 61.125 1.00 96.05 C
ATOM 6201 OE1 GLU B 385 84.156 60.194 60.166 1.00 97.17 O
ATOM 6202 OE2 GLU B 385 84.202 58.147 60.980 1.00 97.90 O
ATOM 6203 N ALA B 386 84.435 63.224 64.195 1.00 85.22 N
ATOM 6204 CA ALA B 386 85.625 63.919 64.656 1.00 85.13 C
ATOM 6205 C ALA B 386 85.575 64.162 66.166 1.00 85.47 C
ATOM 6206 O ALA B 386 86.522 64.690 66.749 1.00 85.66 O
ATOM 6207 CB ALA B 386 85.766 65.242 63.925 1.00 84.61 C
ATOM 6208 N LEU B 387 84.472 63.781 66.800 1.00 85.72 N
ATOM 6209 CA LEU B 387 84.336 63.978 68.233 1.00 87.01 C
ATOM 6210 C LEU B 387 84.478 62.669 68.987 1.00 88.47 C
ATOM 6211 O LEU B 387 85.109 62.616 70.043 1.00 88.91 O
ATOM 6212 CB LEU B 387 82.975 64.595 68.573 1.00 85.96 C
ATOM 6213 CG LEU B 387 82.792 64.907 70.065 1.00 85.19 C
ATOM 6214 CD1 LEU B 387 83.638 66.121 70.446 1.00 84.11 C
ATOM 6215 CD2 LEU B 387 81.332 65.166 70.371 1.00 84.33 C
ATOM 6216 N LEU B 388 83.887 61.613 68.439 1.00 89.94 N
ATOM 6217 CA LEU B 388 83.925 60.304 69.079 1.00 91.75 C
ATOM 6218 C LEU B 388 85.101 59.421 68.651 1.00 92.67 C
ATOM 6219 O LEU B 388 85.092 58.208 68.896 1.00 92.77 O
ATOM 6220 CB LEU B 388 82.609 59.563 68.815 1.00 92.60 C
ATOM 6221 CG LEU B 388 81.311 60.285 69.202 1.00 93.64 C
ATOM 6222 CD1 LEU B 388 80.128 59.373 68.917 1.00 93.83 C
ATOM 6223 CD2 LEU B 388 81.334 60.674 70.679 1.00 93.86 C
ATOM 6224 N SER B 389 86.107 60.021 68.016 1.00 93.17 N
ATOM 6225 CA SER B 389 87.281 59.271 67.568 1.00 93.14 C
ATOM 6226 C SER B 389 88.253 60.104 66.736 1.00 93.23 C
ATOM 6227 O SER B 389 89.005 59.561 65.939 1.00 93.07 O
ATOM 6228 CB SER B 389 86.853 58.039 66.758 1.00 92.93 C
ATOM 6229 OG SER B 389 86.239 58.403 65.534 1.00 93.41 O
ATOM 6230 N GLY B 390 88.236 61.419 66.925 1.00 94.08 N
ATOM 6231 CA GLY B 390 89.128 62.300 66.187 1.00 94.80 C
ATOM 6232 C GLY B 390 89.592 61.816 64.823 1.00 95.70 C
ATOM 6233 O GLY B 390 90.761 61.977 64.475 1.00 95.73 O
ATOM 6234 N THR B 391 88.685 61.226 64.050 1.00 96.56 N
ATOM 6235 CA THR B 391 89.022 60.729 62.719 1.00 97.99 C
ATOM 6236 C THR B 391 87.915 61.012 61.721 1.00 99.02 C
ATOM 6237 O THR B 391 86.961 61.720 62.022 1.00 99.22 O
ATOM 6238 CB THR B 391 89.254 59.210 62.711 1.00 97.90 C
ATOM 6239 OG1 THR B 391 88.061 58.545 63.142 1.00 97.55 O
ATOM 6240 CG2 THR B 391 90.418 58.841 63.614 1.00 97.77 C
ATOM 6241 N HIS B 392 88.053 60.441 60.530 1.00100.61 N
ATOM 6242 CA HIS B 392 87.069 60.617 59.474 1.00102.39 C
ATOM 6243 C HIS B 392 87.071 59.474 58.464 1.00102.98 C
ATOM 6244 O HIS B 392 87.967 59.370 57.631 1.00103.83 O
ATOM 6245 CB HIS B 392 87.295 61.939 58.734 1.00103.40 C
ATOM 6246 CG HIS B 392 86.463 62.079 57.496 1.00104.98 C
ATOM 6247 ND1 HIS B 392 86.901 61.669 56.254 1.00105.66 N
ATOM 6248 CD2 HIS B 392 85.198 62.527 57.318 1.00105.78 C
ATOM 6249 CE1 HIS B 392 85.942 61.858 55.364 1.00105.81 C
ATOM 6250 NE2 HIS B 392 84.898 62.377 55.984 1.00106.55 N
ATOM 6251 N THR B 393 86.050 58.628 58.543 1.00103.34 N
ATOM 6252 CA THR B 393 85.904 57.495 57.638 1.00103.92 C
ATOM 6253 C THR B 393 85.527 57.968 56.236 1.00104.80 C
ATOM 6254 O THR B 393 84.649 58.815 56.074 1.00105.45 O
ATOM 6255 CB THR B 393 84.811 56.526 58.144 1.00103.82 C
ATOM 6256 OG1 THR B 393 85.259 55.875 59.339 1.00104.25 O
ATOM 6257 CG2 THR B 393 84.489 55.480 57.091 1.00103.88 C
ATOM 6258 N ALA B 394 86.196 57.424 55.225 1.00105.70 N
ATOM 6259 CA ALA B 394 85.910 57.790 53.844 1.00106.51 C
ATOM 6260 C ALA B 394 84.515 57.288 53.487 1.00107.29 C
ATOM 6261 O ALA B 394 84.124 56.186 53.880 1.00107.04 O
ATOM 6262 CB ALA B 394 86.945 57.169 52.914 1.00106.31 C
ATOM 6263 N PRO B 395 83.740 58.093 52.741 1.00108.10 N
ATOM 6264 CA PRO B 395 82.386 57.677 52.359 1.00108.48 C
ATOM 6265 C PRO B 395 82.362 56.337 51.623 1.00108.81 C
ATOM 6266 O PRO B 395 81.295 55.786 51.347 1.00108.79 O
ATOM 6267 CB PRO B 395 81.897 58.842 51.495 1.00108.40 C
ATOM 6268 CG PRO B 395 83.169 59.421 50.938 1.00108.35 C
ATOM 6269 CD PRO B 395 84.081 59.390 52.133 1.00108.23 C
ATOM 6270 N SER B 396 83.547 55.816 51.319 1.00109.45 N
ATOM 6271 CA SER B 396 83.677 54.538 50.626 1.00109.98 C
ATOM 6272 C SER B 396 83.858 53.413 51.637 1.00109.67 C
ATOM 6273 O SER B 396 83.390 52.295 51.426 1.00109.29 O
ATOM 6274 CB SER B 396 84.874 54.571 49.672 1.00110.39 C
ATOM 6275 OG SER B 396 86.082 54.823 50.371 1.00111.43 O
ATOM 6276 N VAL B 397 84.549 53.718 52.731 1.00109.85 N
ATOM 6277 CA VAL B 397 84.787 52.747 53.791 1.00109.83 C
ATOM 6278 C VAL B 397 83.466 52.505 54.517 1.00110.47 C
ATOM 6279 O VAL B 397 83.153 51.378 54.911 1.00110.29 O
ATOM 6280 CB VAL B 397 85.838 53.269 54.798 1.00109.17 C
ATOM 6281 CG1 VAL B 397 86.087 52.239 55.886 1.00108.38 C
ATOM 6282 CG2 VAL B 397 87.126 53.600 54.070 1.00108.34 C
ATOM 6283 N VAL B 398 82.692 53.575 54.686 1.00110.78 N
ATOM 6284 CA VAL B 398 81.401 53.476 55.350 1.00111.11 C
ATOM 6285 C VAL B 398 80.472 52.630 54.488 1.00111.50 C
ATOM 6286 O VAL B 398 79.715 51.814 55.005 1.00111.90 O
ATOM 6287 CB VAL B 398 80.775 54.871 55.578 1.00110.86 C
ATOM 6288 CG1 VAL B 398 80.670 55.612 54.268 1.00111.23 C
ATOM 6289 CG2 VAL B 398 79.407 54.732 56.215 1.00109.82 C
ATOM 6290 N ALA B 399 80.537 52.824 53.172 1.00111.92 N
ATOM 6291 CA ALA B 399 79.712 52.055 52.243 1.00112.75 C
ATOM 6292 C ALA B 399 80.241 50.624 52.215 1.00113.53 C
ATOM 6293 O ALA B 399 79.481 49.660 52.143 1.00113.65 O
ATOM 6294 CB ALA B 399 79.780 52.663 50.852 1.00112.50 C
ATOM 6295 N GLN B 400 81.562 50.511 52.272 1.00114.44 N
ATOM 6296 CA GLN B 400 82.262 49.230 52.276 1.00114.61 C
ATOM 6297 C GLN B 400 81.863 48.422 53.513 1.00113.95 C
ATOM 6298 O GLN B 400 81.721 47.198 53.456 1.00114.10 O
ATOM 6299 CB GLN B 400 83.768 49.501 52.275 1.00115.58 C
ATOM 6300 CG GLN B 400 84.659 48.344 52.660 1.00116.22 C
ATOM 6301 CD GLN B 400 86.065 48.815 52.986 1.00116.50 C
ATOM 6302 OE1 GLN B 400 86.725 49.452 52.162 1.00116.45 O
ATOM 6303 NE2 GLN B 400 86.527 48.513 54.197 1.00116.06 N
ATOM 6304 N LYS B 401 81.681 49.125 54.626 1.00112.66 N
ATOM 6305 CA LYS B 401 81.298 48.502 55.886 1.00111.49 C
ATOM 6306 C LYS B 401 79.828 48.107 55.908 1.00109.98 C
ATOM 6307 O LYS B 401 79.459 47.089 56.492 1.00109.78 O
ATOM 6308 CB LYS B 401 81.567 49.461 57.048 1.00112.36 C
ATOM 6309 CG LYS B 401 83.034 49.719 57.334 1.00113.64 C
ATOM 6310 CD LYS B 401 83.695 48.500 57.958 1.00114.66 C
ATOM 6311 CE LYS B 401 85.147 48.777 58.320 1.00114.90 C
ATOM 6312 NZ LYS B 401 85.794 47.612 58.987 1.00114.58 N
ATOM 6313 N ILE B 402 78.990 48.914 55.268 1.00108.42 N
ATOM 6314 CA ILE B 402 77.557 48.651 55.262 1.00107.20 C
ATOM 6315 C ILE B 402 77.137 47.436 54.427 1.00106.14 C
ATOM 6316 O ILE B 402 76.554 46.495 54.968 1.00105.40 O
ATOM 6317 CB ILE B 402 76.757 49.939 54.839 1.00106.68 C
ATOM 6318 CG1 ILE B 402 75.248 49.703 54.964 1.00106.27 C
ATOM 6319 CG2 ILE B 402 77.125 50.364 53.433 1.00107.28 C
ATOM 6320 CD1 ILE B 402 74.623 48.882 53.848 1.00106.09 C
ATOM 6321 N ASP B 403 77.430 47.440 53.127 1.00104.91 N
ATOM 6322 CA ASP B 403 77.044 46.316 52.271 1.00103.11 C
ATOM 6323 C ASP B 403 77.703 45.010 52.705 1.00102.05 C
ATOM 6324 O ASP B 403 77.218 43.925 52.382 1.00101.92 O
ATOM 6325 CB ASP B 403 77.377 46.603 50.805 1.00102.14 C
ATOM 6326 CG ASP B 403 78.785 47.094 50.621 1.00102.11 C
ATOM 6327 OD1 ASP B 403 79.659 46.671 51.405 1.00102.70 O
ATOM 6328 OD2 ASP B 403 79.021 47.892 49.689 1.00101.77 O
ATOM 6329 N SER B 404 78.813 45.115 53.430 1.00100.59 N
ATOM 6330 CA SER B 404 79.502 43.930 53.923 1.00 98.51 C
ATOM 6331 C SER B 404 78.772 43.493 55.193 1.00 96.95 C
ATOM 6332 O SER B 404 79.355 43.404 56.276 1.00 95.72 O
ATOM 6333 CB SER B 404 80.975 44.245 54.223 1.00 99.16 C
ATOM 6334 OG SER B 404 81.114 45.203 55.258 1.00 98.98 O
ATOM 6335 N VAL B 405 77.476 43.242 55.031 1.00 95.64 N
ATOM 6336 CA VAL B 405 76.591 42.823 56.111 1.00 94.98 C
ATOM 6337 C VAL B 405 75.708 41.698 55.581 1.00 94.58 C
ATOM 6338 O VAL B 405 74.778 41.934 54.812 1.00 94.64 O
ATOM 6339 CB VAL B 405 75.697 44.000 56.580 1.00 94.88 C
ATOM 6340 CG1 VAL B 405 74.574 43.491 57.458 1.00 94.42 C
ATOM 6341 CG2 VAL B 405 76.533 45.015 57.345 1.00 94.77 C
ATOM 6342 N THR B 406 76.001 40.476 56.005 1.00 94.47 N
ATOM 6343 CA THR B 406 75.262 39.303 55.551 1.00 93.71 C
ATOM 6344 C THR B 406 73.788 39.294 55.918 1.00 91.92 C
ATOM 6345 O THR B 406 73.348 39.968 56.846 1.00 91.05 O
ATOM 6346 CB THR B 406 75.888 37.986 56.101 1.00 94.88 C
ATOM 6347 OG1 THR B 406 75.319 37.672 57.380 1.00 95.68 O
ATOM 6348 CG2 THR B 406 77.397 38.139 56.263 1.00 95.65 C
ATOM 6349 N SER B 407 73.037 38.504 55.167 1.00 90.91 N
ATOM 6350 CA SER B 407 71.616 38.338 55.392 1.00 90.91 C
ATOM 6351 C SER B 407 71.433 37.734 56.773 1.00 90.92 C
ATOM 6352 O SER B 407 70.402 37.916 57.413 1.00 91.32 O
ATOM 6353 CB SER B 407 71.034 37.396 54.338 1.00 90.99 C
ATOM 6354 OG SER B 407 69.766 36.897 54.725 1.00 91.46 O
ATOM 6355 N ALA B 408 72.443 37.005 57.226 1.00 91.35 N
ATOM 6356 CA ALA B 408 72.381 36.373 58.534 1.00 91.66 C
ATOM 6357 C ALA B 408 72.336 37.453 59.603 1.00 91.48 C
ATOM 6358 O ALA B 408 71.416 37.493 60.420 1.00 91.69 O
ATOM 6359 CB ALA B 408 73.593 35.475 58.739 1.00 92.37 C
ATOM 6360 N ASP B 409 73.333 38.331 59.579 1.00 90.99 N
ATOM 6361 CA ASP B 409 73.431 39.423 60.536 1.00 91.02 C
ATOM 6362 C ASP B 409 72.066 40.034 60.807 1.00 91.29 C
ATOM 6363 O ASP B 409 71.622 40.120 61.958 1.00 92.03 O
ATOM 6364 CB ASP B 409 74.355 40.505 59.993 1.00 90.91 C
ATOM 6365 CG ASP B 409 75.696 39.965 59.592 1.00 91.06 C
ATOM 6366 OD1 ASP B 409 76.228 39.131 60.350 1.00 92.72 O
ATOM 6367 OD2 ASP B 409 76.220 40.377 58.536 1.00 89.12 O
ATOM 6368 N VAL B 410 71.415 40.463 59.731 1.00 90.16 N
ATOM 6369 CA VAL B 410 70.099 41.074 59.808 1.00 88.93 C
ATOM 6370 C VAL B 410 69.118 40.198 60.581 1.00 88.40 C
ATOM 6371 O VAL B 410 68.525 40.643 61.565 1.00 88.07 O
ATOM 6372 CB VAL B 410 69.537 41.331 58.393 1.00 88.90 C
ATOM 6373 CG1 VAL B 410 68.111 41.845 58.481 1.00 88.67 C
ATOM 6374 CG2 VAL B 410 70.417 42.332 57.663 1.00 89.07 C
ATOM 6375 N VAL B 411 68.955 38.953 60.136 1.00 87.73 N
ATOM 6376 CA VAL B 411 68.033 38.028 60.789 1.00 86.89 C
ATOM 6377 C VAL B 411 68.371 37.892 62.268 1.00 86.35 C
ATOM 6378 O VAL B 411 67.481 37.673 63.092 1.00 86.64 O
ATOM 6379 CB VAL B 411 68.062 36.619 60.136 1.00 86.31 C
ATOM 6380 CG1 VAL B 411 66.961 35.739 60.737 1.00 84.40 C
ATOM 6381 CG2 VAL B 411 67.886 36.741 58.629 1.00 85.34 C
ATOM 6382 N ASN B 412 69.654 38.021 62.598 1.00 85.19 N
ATOM 6383 CA ASN B 412 70.084 37.924 63.986 1.00 85.09 C
ATOM 6384 C ASN B 412 69.592 39.142 64.738 1.00 83.81 C
ATOM 6385 O ASN B 412 69.001 39.023 65.810 1.00 83.51 O
ATOM 6386 CB ASN B 412 71.609 37.831 64.087 1.00 86.60 C
ATOM 6387 CG ASN B 412 72.140 36.480 63.634 1.00 87.26 C
ATOM 6388 OD1 ASN B 412 71.562 35.433 63.950 1.00 86.91 O
ATOM 6389 ND2 ASN B 412 73.251 36.497 62.900 1.00 87.32 N
ATOM 6390 N ALA B 413 69.844 40.316 64.173 1.00 82.76 N
ATOM 6391 CA ALA B 413 69.389 41.555 64.780 1.00 81.18 C
ATOM 6392 C ALA B 413 67.911 41.365 65.110 1.00 80.43 C
ATOM 6393 O ALA B 413 67.484 41.599 66.239 1.00 80.78 O
ATOM 6394 CB ALA B 413 69.568 42.703 63.807 1.00 80.69 C
ATOM 6395 N ALA B 414 67.144 40.917 64.120 1.00 79.24 N
ATOM 6396 CA ALA B 414 65.712 40.678 64.288 1.00 78.77 C
ATOM 6397 C ALA B 414 65.417 39.739 65.457 1.00 79.17 C
ATOM 6398 O ALA B 414 64.455 39.938 66.194 1.00 78.66 O
ATOM 6399 CB ALA B 414 65.125 40.105 63.004 1.00 78.49 C
ATOM 6400 N LYS B 415 66.238 38.707 65.622 1.00 80.61 N
ATOM 6401 CA LYS B 415 66.046 37.758 66.717 1.00 80.62 C
ATOM 6402 C LYS B 415 66.337 38.421 68.057 1.00 80.17 C
ATOM 6403 O LYS B 415 65.581 38.257 69.012 1.00 80.26 O
ATOM 6404 CB LYS B 415 66.958 36.537 66.549 1.00 81.80 C
ATOM 6405 CG LYS B 415 66.587 35.621 65.390 1.00 83.72 C
ATOM 6406 CD LYS B 415 67.406 34.337 65.416 1.00 85.17 C
ATOM 6407 CE LYS B 415 67.013 33.405 64.281 1.00 86.77 C
ATOM 6408 NZ LYS B 415 67.772 32.120 64.304 1.00 87.11 N
ATOM 6409 N LYS B 416 67.433 39.173 68.120 1.00 79.32 N
ATOM 6410 CA LYS B 416 67.818 39.854 69.346 1.00 78.99 C
ATOM 6411 C LYS B 416 66.660 40.682 69.872 1.00 79.16 C
ATOM 6412 O LYS B 416 66.529 40.892 71.078 1.00 78.76 O
ATOM 6413 CB LYS B 416 69.022 40.766 69.107 1.00 79.21 C
ATOM 6414 CG LYS B 416 69.497 41.466 70.374 1.00 79.70 C
ATOM 6415 CD LYS B 416 70.736 42.309 70.141 1.00 79.98 C
ATOM 6416 CE LYS B 416 71.126 43.032 71.419 1.00 80.42 C
ATOM 6417 NZ LYS B 416 72.260 43.973 71.211 1.00 81.12 N
ATOM 6418 N PHE B 417 65.820 41.151 68.956 1.00 79.38 N
ATOM 6419 CA PHE B 417 64.670 41.956 69.325 1.00 80.17 C
ATOM 6420 C PHE B 417 63.557 41.104 69.914 1.00 81.36 C
ATOM 6421 O PHE B 417 63.043 41.396 70.995 1.00 81.74 O
ATOM 6422 CB PHE B 417 64.112 42.707 68.109 1.00 80.11 C
ATOM 6423 CG PHE B 417 62.763 43.351 68.362 1.00 79.26 C
ATOM 6424 CD1 PHE B 417 62.669 44.595 68.984 1.00 77.72 C
ATOM 6425 CD2 PHE B 417 61.585 42.670 68.051 1.00 77.97 C
ATOM 6426 CE1 PHE B 417 61.428 45.141 69.296 1.00 76.56 C
ATOM 6427 CE2 PHE B 417 60.344 43.210 68.361 1.00 76.80 C
ATOM 6428 CZ PHE B 417 60.261 44.445 68.984 1.00 76.22 C
ATOM 6429 N VAL B 418 63.179 40.055 69.193 1.00 82.05 N
ATOM 6430 CA VAL B 418 62.096 39.194 69.643 1.00 83.37 C
ATOM 6431 C VAL B 418 62.384 38.502 70.971 1.00 84.50 C
ATOM 6432 O VAL B 418 61.459 38.166 71.719 1.00 84.43 O
ATOM 6433 CB VAL B 418 61.769 38.124 68.589 1.00 82.75 C
ATOM 6434 CG1 VAL B 418 60.414 37.497 68.895 1.00 82.99 C
ATOM 6435 CG2 VAL B 418 61.777 38.741 67.204 1.00 82.47 C
ATOM 6436 N SER B 419 63.666 38.303 71.267 1.00 85.56 N
ATOM 6437 CA SER B 419 64.074 37.633 72.499 1.00 86.42 C
ATOM 6438 C SER B 419 64.438 38.595 73.626 1.00 86.19 C
ATOM 6439 O SER B 419 64.257 38.270 74.802 1.00 87.14 O
ATOM 6440 CB SER B 419 65.265 36.714 72.225 1.00 87.14 C
ATOM 6441 OG SER B 419 66.397 37.470 71.825 1.00 88.70 O
ATOM 6442 N GLY B 420 64.956 39.769 73.275 1.00 84.74 N
ATOM 6443 CA GLY B 420 65.331 40.735 74.293 1.00 83.43 C
ATOM 6444 C GLY B 420 64.156 41.289 75.093 1.00 82.46 C
ATOM 6445 O GLY B 420 63.001 41.227 74.649 1.00 81.50 O
ATOM 6446 N LYS B 421 64.447 41.817 76.285 1.00 81.43 N
ATOM 6447 CA LYS B 421 63.412 42.407 77.132 1.00 79.68 C
ATOM 6448 C LYS B 421 63.029 43.729 76.496 1.00 79.25 C
ATOM 6449 O LYS B 421 63.885 44.561 76.189 1.00 79.16 O
ATOM 6450 CB LYS B 421 63.915 42.656 78.553 1.00 78.00 C
ATOM 6451 CG LYS B 421 62.826 43.178 79.469 1.00 77.41 C
ATOM 6452 CD LYS B 421 63.286 43.317 80.914 1.00 77.25 C
ATOM 6453 CE LYS B 421 62.138 43.801 81.802 1.00 76.91 C
ATOM 6454 NZ LYS B 421 62.545 44.007 83.218 1.00 76.61 N
ATOM 6455 N LYS B 422 61.734 43.922 76.308 1.00 78.38 N
ATOM 6456 CA LYS B 422 61.251 45.121 75.659 1.00 77.77 C
ATOM 6457 C LYS B 422 60.681 46.171 76.601 1.00 76.95 C
ATOM 6458 O LYS B 422 60.205 45.864 77.693 1.00 77.56 O
ATOM 6459 CB LYS B 422 60.204 44.720 74.618 1.00 77.87 C
ATOM 6460 CG LYS B 422 60.728 43.698 73.610 1.00 78.69 C
ATOM 6461 CD LYS B 422 59.602 42.886 72.999 1.00 79.26 C
ATOM 6462 CE LYS B 422 60.126 41.609 72.356 1.00 80.75 C
ATOM 6463 NZ LYS B 422 59.028 40.623 72.074 1.00 82.11 N
ATOM 6464 N SER B 423 60.774 47.423 76.173 1.00 75.22 N
ATOM 6465 CA SER B 423 60.228 48.543 76.917 1.00 72.91 C
ATOM 6466 C SER B 423 59.257 49.195 75.929 1.00 70.74 C
ATOM 6467 O SER B 423 59.487 49.174 74.713 1.00 70.10 O
ATOM 6468 CB SER B 423 61.340 49.513 77.362 1.00 73.04 C
ATOM 6469 OG SER B 423 62.156 49.926 76.283 1.00 73.63 O
ATOM 6470 N MET B 424 58.162 49.746 76.446 1.00 68.01 N
ATOM 6471 CA MET B 424 57.156 50.362 75.591 1.00 64.31 C
ATOM 6472 C MET B 424 56.603 51.681 76.131 1.00 63.30 C
ATOM 6473 O MET B 424 56.582 51.925 77.344 1.00 63.96 O
ATOM 6474 CB MET B 424 56.011 49.372 75.387 1.00 61.44 C
ATOM 6475 CG MET B 424 54.859 49.902 74.591 1.00 57.29 C
ATOM 6476 SD MET B 424 53.419 48.887 74.896 1.00 55.72 S
ATOM 6477 CE MET B 424 52.687 48.811 73.278 1.00 52.88 C
ATOM 6478 N ALA B 425 56.157 52.530 75.214 1.00 60.95 N
ATOM 6479 CA ALA B 425 55.577 53.815 75.566 1.00 58.74 C
ATOM 6480 C ALA B 425 54.484 54.130 74.553 1.00 57.97 C
ATOM 6481 O ALA B 425 54.698 54.028 73.346 1.00 56.83 O
ATOM 6482 CB ALA B 425 56.637 54.887 75.545 1.00 58.33 C
ATOM 6483 N ALA B 426 53.309 54.500 75.049 1.00 58.17 N
ATOM 6484 CA ALA B 426 52.177 54.834 74.191 1.00 57.94 C
ATOM 6485 C ALA B 426 51.330 55.950 74.800 1.00 57.72 C
ATOM 6486 O ALA B 426 51.196 56.038 76.022 1.00 57.72 O
ATOM 6487 CB ALA B 426 51.317 53.597 73.968 1.00 58.66 C
ATOM 6488 N SER B 427 50.759 56.799 73.950 1.00 57.63 N
ATOM 6489 CA SER B 427 49.906 57.895 74.419 1.00 57.73 C
ATOM 6490 C SER B 427 48.681 58.037 73.526 1.00 56.04 C
ATOM 6491 O SER B 427 48.741 57.772 72.329 1.00 55.69 O
ATOM 6492 CB SER B 427 50.682 59.215 74.435 1.00 59.45 C
ATOM 6493 OG SER B 427 50.970 59.651 73.115 1.00 62.72 O
ATOM 6494 N GLY B 428 47.569 58.461 74.109 1.00 55.29 N
ATOM 6495 CA GLY B 428 46.353 58.616 73.332 1.00 55.16 C
ATOM 6496 C GLY B 428 45.235 57.887 74.035 1.00 55.29 C
ATOM 6497 O GLY B 428 45.341 57.612 75.227 1.00 55.85 O
ATOM 6498 N ASP B 429 44.161 57.586 73.318 1.00 56.15 N
ATOM 6499 CA ASP B 429 43.041 56.856 73.906 1.00 58.30 C
ATOM 6500 C ASP B 429 43.462 55.377 73.902 1.00 58.34 C
ATOM 6501 O ASP B 429 43.082 54.603 73.013 1.00 58.77 O
ATOM 6502 CB ASP B 429 41.773 57.053 73.067 1.00 60.33 C
ATOM 6503 CG ASP B 429 40.534 56.511 73.748 1.00 63.94 C
ATOM 6504 OD1 ASP B 429 40.639 55.485 74.458 1.00 68.39 O
ATOM 6505 OD2 ASP B 429 39.448 57.095 73.565 1.00 65.10 O
ATOM 6506 N LEU B 430 44.248 55.001 74.909 1.00 56.96 N
ATOM 6507 CA LEU B 430 44.788 53.654 75.041 1.00 55.73 C
ATOM 6508 C LEU B 430 43.799 52.537 75.377 1.00 56.01 C
ATOM 6509 O LEU B 430 44.203 51.432 75.735 1.00 53.27 O
ATOM 6510 CB LEU B 430 45.907 53.677 76.081 1.00 54.17 C
ATOM 6511 CG LEU B 430 46.934 54.797 75.891 1.00 53.61 C
ATOM 6512 CD1 LEU B 430 48.018 54.653 76.935 1.00 52.92 C
ATOM 6513 CD2 LEU B 430 47.539 54.741 74.491 1.00 51.84 C
ATOM 6514 N GLY B 431 42.508 52.816 75.250 1.00 57.91 N
ATOM 6515 CA GLY B 431 41.510 51.805 75.563 1.00 60.30 C
ATOM 6516 C GLY B 431 41.636 50.484 74.813 1.00 61.82 C
ATOM 6517 O GLY B 431 41.145 49.448 75.277 1.00 60.91 O
ATOM 6518 N SER B 432 42.279 50.516 73.648 1.00 63.47 N
ATOM 6519 CA SER B 432 42.454 49.312 72.844 1.00 64.42 C
ATOM 6520 C SER B 432 43.922 49.009 72.589 1.00 65.24 C
ATOM 6521 O SER B 432 44.256 48.129 71.795 1.00 66.52 O
ATOM 6522 CB SER B 432 41.746 49.468 71.503 1.00 64.98 C
ATOM 6523 OG SER B 432 40.350 49.595 71.681 1.00 68.91 O
ATOM 6524 N THR B 433 44.806 49.749 73.246 1.00 65.72 N
ATOM 6525 CA THR B 433 46.230 49.528 73.067 1.00 64.53 C
ATOM 6526 C THR B 433 46.661 48.412 74.008 1.00 65.80 C
ATOM 6527 O THR B 433 46.360 48.432 75.203 1.00 65.56 O
ATOM 6528 CB THR B 433 47.018 50.802 73.363 1.00 62.90 C
ATOM 6529 OG1 THR B 433 46.400 51.903 72.687 1.00 60.89 O
ATOM 6530 CG2 THR B 433 48.444 50.659 72.877 1.00 62.10 C
ATOM 6531 N PRO B 434 47.355 47.403 73.472 1.00 67.30 N
ATOM 6532 CA PRO B 434 47.821 46.270 74.279 1.00 68.26 C
ATOM 6533 C PRO B 434 49.008 46.573 75.205 1.00 67.89 C
ATOM 6534 O PRO B 434 49.796 47.490 74.950 1.00 66.75 O
ATOM 6535 CB PRO B 434 48.157 45.220 73.217 1.00 68.28 C
ATOM 6536 CG PRO B 434 48.651 46.064 72.078 1.00 67.86 C
ATOM 6537 CD PRO B 434 47.641 47.189 72.041 1.00 67.32 C
ATOM 6538 N PHE B 435 49.119 45.808 76.289 1.00 67.91 N
ATOM 6539 CA PHE B 435 50.225 45.996 77.217 1.00 69.36 C
ATOM 6540 C PHE B 435 51.376 45.141 76.725 1.00 70.03 C
ATOM 6541 O PHE B 435 51.164 44.117 76.085 1.00 70.73 O
ATOM 6542 CB PHE B 435 49.849 45.564 78.633 1.00 69.39 C
ATOM 6543 CG PHE B 435 48.814 46.429 79.279 1.00 69.32 C
ATOM 6544 CD1 PHE B 435 47.496 46.416 78.830 1.00 69.36 C
ATOM 6545 CD2 PHE B 435 49.156 47.259 80.341 1.00 68.95 C
ATOM 6546 CE1 PHE B 435 46.530 47.219 79.431 1.00 69.97 C
ATOM 6547 CE2 PHE B 435 48.200 48.065 80.950 1.00 69.05 C
ATOM 6548 CZ PHE B 435 46.883 48.047 80.495 1.00 69.99 C
ATOM 6549 N LEU B 436 52.592 45.561 77.040 1.00 70.75 N
ATOM 6550 CA LEU B 436 53.798 44.854 76.624 1.00 71.70 C
ATOM 6551 C LEU B 436 53.749 43.328 76.807 1.00 73.36 C
ATOM 6552 O LEU B 436 54.353 42.590 76.030 1.00 73.66 O
ATOM 6553 CB LEU B 436 55.000 45.434 77.375 1.00 69.23 C
ATOM 6554 CG LEU B 436 56.364 45.344 76.699 1.00 67.68 C
ATOM 6555 CD1 LEU B 436 56.294 45.943 75.316 1.00 67.82 C
ATOM 6556 CD2 LEU B 436 57.383 46.084 77.528 1.00 67.21 C
ATOM 6557 N ASP B 437 53.027 42.854 77.820 1.00 75.72 N
ATOM 6558 CA ASP B 437 52.941 41.415 78.074 1.00 77.41 C
ATOM 6559 C ASP B 437 51.834 40.699 77.302 1.00 78.28 C
ATOM 6560 O ASP B 437 51.438 39.590 77.659 1.00 78.90 O
ATOM 6561 CB ASP B 437 52.780 41.132 79.581 1.00 77.59 C
ATOM 6562 CG ASP B 437 51.516 41.747 80.173 1.00 78.57 C
ATOM 6563 OD1 ASP B 437 51.486 42.989 80.336 1.00 80.05 O
ATOM 6564 OD2 ASP B 437 50.558 40.993 80.476 1.00 76.57 O
ATOM 6565 N GLU B 438 51.330 41.328 76.249 1.00 79.09 N
ATOM 6566 CA GLU B 438 50.287 40.708 75.438 1.00 80.42 C
ATOM 6567 C GLU B 438 50.790 40.728 74.007 1.00 81.75 C
ATOM 6568 O GLU B 438 50.059 40.416 73.070 1.00 81.94 O
ATOM 6569 CB GLU B 438 48.978 41.490 75.525 1.00 80.24 C
ATOM 6570 CG GLU B 438 48.637 41.993 76.911 1.00 81.51 C
ATOM 6571 CD GLU B 438 47.310 42.717 76.945 1.00 81.99 C
ATOM 6572 OE1 GLU B 438 46.973 43.381 75.939 1.00 81.36 O
ATOM 6573 OE2 GLU B 438 46.611 42.633 77.979 1.00 82.24 O
ATOM 6574 N LEU B 439 52.049 41.121 73.848 1.00 83.25 N
ATOM 6575 CA LEU B 439 52.671 41.181 72.535 1.00 85.50 C
ATOM 6576 C LEU B 439 53.525 39.936 72.330 1.00 87.41 C
ATOM 6577 O LEU B 439 54.776 40.070 72.275 1.00 88.67 O
ATOM 6578 CB LEU B 439 53.544 42.429 72.410 1.00 84.97 C
ATOM 6579 CG LEU B 439 52.830 43.757 72.635 1.00 85.37 C
ATOM 6580 CD1 LEU B 439 53.796 44.908 72.383 1.00 84.26 C
ATOM 6581 CD2 LEU B 439 51.622 43.841 71.712 1.00 86.22 C
ATOM 6582 OXT LEU B 439 52.923 38.842 72.242 1.00 88.74 O
TER 6583 LEU B 439
ATOM 6584 N MET C 1 54.754 102.574 78.874 1.00102.13 N
ATOM 6585 CA MET C 1 54.108 101.232 78.994 1.00101.87 C
ATOM 6586 C MET C 1 53.556 100.774 77.643 1.00101.35 C
ATOM 6587 O MET C 1 54.049 99.807 77.059 1.00102.30 O
ATOM 6588 CB MET C 1 52.975 101.277 80.028 1.00102.11 C
ATOM 6589 N ALA C 2 52.534 101.472 77.151 1.00 99.32 N
ATOM 6590 CA ALA C 2 51.923 101.131 75.871 1.00 96.40 C
ATOM 6591 C ALA C 2 52.766 101.655 74.712 1.00 94.19 C
ATOM 6592 O ALA C 2 53.436 102.688 74.826 1.00 93.36 O
ATOM 6593 CB ALA C 2 50.502 101.703 75.794 1.00 96.68 C
ATOM 6594 N PRO C 3 52.748 100.939 73.578 1.00 92.14 N
ATOM 6595 CA PRO C 3 53.509 101.331 72.389 1.00 90.71 C
ATOM 6596 C PRO C 3 53.083 102.657 71.750 1.00 89.43 C
ATOM 6597 O PRO C 3 53.911 103.343 71.152 1.00 89.91 O
ATOM 6598 CB PRO C 3 53.327 100.136 71.451 1.00 90.86 C
ATOM 6599 CG PRO C 3 52.012 99.561 71.871 1.00 91.36 C
ATOM 6600 CD PRO C 3 52.086 99.639 73.371 1.00 91.52 C
ATOM 6601 N ASN C 4 51.804 103.020 71.866 1.00 87.66 N
ATOM 6602 CA ASN C 4 51.338 104.280 71.281 1.00 84.75 C
ATOM 6603 C ASN C 4 50.690 105.230 72.277 1.00 82.46 C
ATOM 6604 O ASN C 4 49.792 104.855 73.034 1.00 81.43 O
ATOM 6605 CB ASN C 4 50.390 104.029 70.089 1.00 84.79 C
ATOM 6606 CG ASN C 4 49.055 103.448 70.491 1.00 83.64 C
ATOM 6607 OD1 ASN C 4 48.985 102.420 71.161 1.00 84.64 O
ATOM 6608 ND2 ASN C 4 47.981 104.098 70.064 1.00 82.12 N
ATOM 6609 N ILE C 5 51.174 106.469 72.256 1.00 80.68 N
ATOM 6610 CA ILE C 5 50.714 107.539 73.137 1.00 79.77 C
ATOM 6611 C ILE C 5 49.197 107.715 73.253 1.00 79.77 C
ATOM 6612 O ILE C 5 48.685 107.994 74.342 1.00 79.22 O
ATOM 6613 CB ILE C 5 51.359 108.896 72.715 1.00 79.00 C
ATOM 6614 CG1 ILE C 5 52.672 109.100 73.469 1.00 78.42 C
ATOM 6615 CG2 ILE C 5 50.430 110.055 72.999 1.00 77.95 C
ATOM 6616 CD1 ILE C 5 52.505 109.202 74.974 1.00 78.33 C
ATOM 6617 N ARG C 6 48.485 107.554 72.139 1.00 79.16 N
ATOM 6618 CA ARG C 6 47.035 107.715 72.127 1.00 77.55 C
ATOM 6619 C ARG C 6 46.373 106.931 73.259 1.00 77.41 C
ATOM 6620 O ARG C 6 45.279 107.285 73.708 1.00 76.95 O
ATOM 6621 CB ARG C 6 46.465 107.265 70.777 1.00 76.65 C
ATOM 6622 CG ARG C 6 45.146 107.944 70.412 1.00 76.47 C
ATOM 6623 CD ARG C 6 44.598 107.507 69.049 1.00 73.94 C
ATOM 6624 NE ARG C 6 44.194 106.104 69.042 1.00 72.12 N
ATOM 6625 CZ ARG C 6 44.860 105.145 68.412 1.00 71.78 C
ATOM 6626 NH1 ARG C 6 45.958 105.457 67.737 1.00 73.56 N
ATOM 6627 NH2 ARG C 6 44.440 103.882 68.463 1.00 69.39 N
ATOM 6628 N LYS C 7 47.050 105.883 73.732 1.00 77.12 N
ATOM 6629 CA LYS C 7 46.524 105.040 74.808 1.00 76.83 C
ATOM 6630 C LYS C 7 47.210 105.168 76.180 1.00 76.97 C
ATOM 6631 O LYS C 7 46.559 105.004 77.216 1.00 76.36 O
ATOM 6632 CB LYS C 7 46.556 103.565 74.386 1.00 76.20 C
ATOM 6633 CG LYS C 7 45.685 103.205 73.188 1.00 75.04 C
ATOM 6634 CD LYS C 7 45.753 101.707 72.917 1.00 73.71 C
ATOM 6635 CE LYS C 7 45.023 101.320 71.640 1.00 74.07 C
ATOM 6636 NZ LYS C 7 45.134 99.858 71.339 1.00 72.56 N
ATOM 6637 N SER C 8 48.511 105.445 76.204 1.00 77.22 N
ATOM 6638 CA SER C 8 49.211 105.552 77.483 1.00 77.37 C
ATOM 6639 C SER C 8 49.086 106.910 78.191 1.00 77.93 C
ATOM 6640 O SER C 8 48.833 106.957 79.397 1.00 78.54 O
ATOM 6641 CB SER C 8 50.688 105.178 77.309 1.00 76.56 C
ATOM 6642 OG SER C 8 51.285 105.878 76.235 1.00 76.97 O
ATOM 6643 N HIS C 9 49.252 108.004 77.450 1.00 77.29 N
ATOM 6644 CA HIS C 9 49.158 109.351 78.020 1.00 76.89 C
ATOM 6645 C HIS C 9 47.865 109.488 78.837 1.00 76.79 C
ATOM 6646 O HIS C 9 46.792 109.157 78.345 1.00 78.06 O
ATOM 6647 CB HIS C 9 49.173 110.394 76.893 1.00 76.39 C
ATOM 6648 CG HIS C 9 49.274 111.806 77.378 1.00 76.08 C
ATOM 6649 ND1 HIS C 9 50.469 112.385 77.750 1.00 74.82 N
ATOM 6650 CD2 HIS C 9 48.320 112.740 77.601 1.00 76.81 C
ATOM 6651 CE1 HIS C 9 50.247 113.612 78.183 1.00 74.62 C
ATOM 6652 NE2 HIS C 9 48.951 113.852 78.103 1.00 76.83 N
ATOM 6653 N PRO C 10 47.947 109.992 80.088 1.00 76.15 N
ATOM 6654 CA PRO C 10 46.754 110.150 80.938 1.00 74.71 C
ATOM 6655 C PRO C 10 45.651 111.105 80.449 1.00 72.87 C
ATOM 6656 O PRO C 10 44.522 111.042 80.936 1.00 71.62 O
ATOM 6657 CB PRO C 10 47.343 110.577 82.284 1.00 74.24 C
ATOM 6658 CG PRO C 10 48.571 111.326 81.878 1.00 75.05 C
ATOM 6659 CD PRO C 10 49.155 110.448 80.801 1.00 74.96 C
ATOM 6660 N LEU C 11 45.969 111.989 79.506 1.00 70.97 N
ATOM 6661 CA LEU C 11 44.962 112.911 78.981 1.00 70.07 C
ATOM 6662 C LEU C 11 44.416 112.429 77.637 1.00 69.41 C
ATOM 6663 O LEU C 11 43.204 112.421 77.423 1.00 68.67 O
ATOM 6664 CB LEU C 11 45.530 114.334 78.829 1.00 69.68 C
ATOM 6665 CG LEU C 11 45.667 115.208 80.087 1.00 68.20 C
ATOM 6666 CD1 LEU C 11 46.143 116.596 79.699 1.00 66.37 C
ATOM 6667 CD2 LEU C 11 44.331 115.299 80.810 1.00 66.98 C
ATOM 6668 N LEU C 12 45.312 112.033 76.735 1.00 68.92 N
ATOM 6669 CA LEU C 12 44.901 111.536 75.430 1.00 67.74 C
ATOM 6670 C LEU C 12 44.086 110.283 75.635 1.00 67.92 C
ATOM 6671 O LEU C 12 43.086 110.069 74.959 1.00 67.84 O
ATOM 6672 CB LEU C 12 46.116 111.226 74.576 1.00 67.39 C
ATOM 6673 CG LEU C 12 46.928 112.489 74.318 1.00 68.91 C
ATOM 6674 CD1 LEU C 12 48.130 112.162 73.459 1.00 69.24 C
ATOM 6675 CD2 LEU C 12 46.042 113.524 73.632 1.00 68.88 C
ATOM 6676 N LYS C 13 44.533 109.459 76.578 1.00 68.37 N
ATOM 6677 CA LYS C 13 43.858 108.213 76.932 1.00 68.98 C
ATOM 6678 C LYS C 13 42.367 108.504 77.035 1.00 69.99 C
ATOM 6679 O LYS C 13 41.522 107.740 76.551 1.00 70.46 O
ATOM 6680 CB LYS C 13 44.382 107.715 78.284 1.00 68.74 C
ATOM 6681 CG LYS C 13 43.539 106.654 78.956 1.00 69.84 C
ATOM 6682 CD LYS C 13 44.002 106.401 80.376 1.00 71.26 C
ATOM 6683 CE LYS C 13 45.399 105.793 80.412 1.00 73.29 C
ATOM 6684 NZ LYS C 13 45.883 105.544 81.807 1.00 74.12 N
ATOM 6685 N MET C 14 42.058 109.630 77.664 1.00 70.15 N
ATOM 6686 CA MET C 14 40.682 110.051 77.851 1.00 70.68 C
ATOM 6687 C MET C 14 40.006 110.465 76.549 1.00 69.39 C
ATOM 6688 O MET C 14 38.833 110.165 76.337 1.00 70.07 O
ATOM 6689 CB MET C 14 40.632 111.200 78.842 1.00 73.18 C
ATOM 6690 CG MET C 14 41.049 110.812 80.231 1.00 77.61 C
ATOM 6691 SD MET C 14 40.794 112.204 81.330 1.00 85.02 S
ATOM 6692 CE MET C 14 38.908 112.171 81.468 1.00 84.14 C
ATOM 6693 N ILE C 15 40.734 111.166 75.686 1.00 66.44 N
ATOM 6694 CA ILE C 15 40.170 111.582 74.409 1.00 63.64 C
ATOM 6695 C ILE C 15 39.961 110.362 73.520 1.00 62.72 C
ATOM 6696 O ILE C 15 38.960 110.260 72.805 1.00 61.49 O
ATOM 6697 CB ILE C 15 41.096 112.551 73.692 1.00 62.05 C
ATOM 6698 CG1 ILE C 15 41.327 113.771 74.579 1.00 62.25 C
ATOM 6699 CG2 ILE C 15 40.495 112.950 72.365 1.00 59.07 C
ATOM 6700 CD1 ILE C 15 42.361 114.741 74.041 1.00 63.30 C
ATOM 6701 N ASN C 16 40.910 109.435 73.585 1.00 61.51 N
ATOM 6702 CA ASN C 16 40.850 108.220 72.798 1.00 61.55 C
ATOM 6703 C ASN C 16 39.667 107.355 73.218 1.00 61.50 C
ATOM 6704 O ASN C 16 38.939 106.832 72.368 1.00 60.61 O
ATOM 6705 CB ASN C 16 42.153 107.425 72.952 1.00 61.83 C
ATOM 6706 CG ASN C 16 42.195 106.175 72.067 1.00 62.76 C
ATOM 6707 OD1 ASN C 16 42.157 106.266 70.836 1.00 62.15 O
ATOM 6708 ND2 ASN C 16 42.274 105.005 72.697 1.00 61.81 N
ATOM 6709 N ASN C 17 39.464 107.214 74.526 1.00 61.09 N
ATOM 6710 CA ASN C 17 38.378 106.376 75.022 1.00 61.91 C
ATOM 6711 C ASN C 17 36.981 106.976 74.912 1.00 61.66 C
ATOM 6712 O ASN C 17 35.995 106.322 75.256 1.00 62.61 O
ATOM 6713 CB ASN C 17 38.630 105.975 76.479 1.00 63.58 C
ATOM 6714 CG ASN C 17 39.873 105.112 76.649 1.00 64.94 C
ATOM 6715 OD1 ASN C 17 40.248 104.351 75.750 1.00 65.21 O
ATOM 6716 ND2 ASN C 17 40.504 105.211 77.818 1.00 64.97 N
ATOM 6717 N SER C 18 36.883 108.210 74.430 1.00 60.88 N
ATOM 6718 CA SER C 18 35.580 108.844 74.309 1.00 59.24 C
ATOM 6719 C SER C 18 35.318 109.460 72.942 1.00 57.95 C
ATOM 6720 O SER C 18 34.183 109.798 72.622 1.00 58.97 O
ATOM 6721 CB SER C 18 35.417 109.903 75.401 1.00 59.57 C
ATOM 6722 OG SER C 18 36.436 110.878 75.308 1.00 63.69 O
ATOM 6723 N LEU C 19 36.349 109.606 72.124 1.00 56.36 N
ATOM 6724 CA LEU C 19 36.131 110.188 70.811 1.00 56.42 C
ATOM 6725 C LEU C 19 36.931 109.578 69.669 1.00 55.72 C
ATOM 6726 O LEU C 19 36.910 110.090 68.554 1.00 56.25 O
ATOM 6727 CB LEU C 19 36.394 111.692 70.861 1.00 56.25 C
ATOM 6728 CG LEU C 19 35.325 112.525 71.559 1.00 55.49 C
ATOM 6729 CD1 LEU C 19 35.788 113.971 71.663 1.00 54.88 C
ATOM 6730 CD2 LEU C 19 34.031 112.417 70.780 1.00 53.58 C
ATOM 6731 N ILE C 20 37.630 108.483 69.917 1.00 53.87 N
ATOM 6732 CA ILE C 20 38.402 107.905 68.841 1.00 52.13 C
ATOM 6733 C ILE C 20 38.211 106.406 68.762 1.00 52.07 C
ATOM 6734 O ILE C 20 37.739 105.896 67.752 1.00 52.83 O
ATOM 6735 CB ILE C 20 39.895 108.279 68.991 1.00 51.53 C
ATOM 6736 CG1 ILE C 20 40.040 109.804 68.943 1.00 49.17 C
ATOM 6737 CG2 ILE C 20 40.711 107.692 67.857 1.00 51.37 C
ATOM 6738 CD1 ILE C 20 41.438 110.292 69.189 1.00 48.19 C
ATOM 6739 N ASP C 21 38.548 105.699 69.829 1.00 51.93 N
ATOM 6740 CA ASP C 21 38.400 104.249 69.845 1.00 50.37 C
ATOM 6741 C ASP C 21 37.109 103.819 70.525 1.00 48.00 C
ATOM 6742 O ASP C 21 36.832 102.624 70.638 1.00 48.42 O
ATOM 6743 CB ASP C 21 39.600 103.615 70.554 1.00 54.26 C
ATOM 6744 CG ASP C 21 40.853 103.612 69.689 1.00 56.76 C
ATOM 6745 OD1 ASP C 21 40.991 104.519 68.836 1.00 52.85 O
ATOM 6746 OD2 ASP C 21 41.701 102.703 69.873 1.00 60.47 O
ATOM 6747 N LEU C 22 36.326 104.793 70.979 1.00 44.95 N
ATOM 6748 CA LEU C 22 35.056 104.514 71.638 1.00 42.86 C
ATOM 6749 C LEU C 22 34.187 103.608 70.779 1.00 42.43 C
ATOM 6750 O LEU C 22 33.903 103.917 69.618 1.00 41.82 O
ATOM 6751 CB LEU C 22 34.319 105.816 71.901 1.00 43.87 C
ATOM 6752 CG LEU C 22 32.838 105.733 72.286 1.00 44.71 C
ATOM 6753 CD1 LEU C 22 32.637 104.933 73.564 1.00 44.72 C
ATOM 6754 CD2 LEU C 22 32.317 107.150 72.455 1.00 45.42 C
ATOM 6755 N PRO C 23 33.756 102.469 71.331 1.00 40.83 N
ATOM 6756 CA PRO C 23 32.920 101.563 70.544 1.00 41.10 C
ATOM 6757 C PRO C 23 31.525 102.142 70.377 1.00 39.52 C
ATOM 6758 O PRO C 23 30.883 102.508 71.361 1.00 42.50 O
ATOM 6759 CB PRO C 23 32.920 100.270 71.378 1.00 41.50 C
ATOM 6760 CG PRO C 23 34.202 100.355 72.154 1.00 40.87 C
ATOM 6761 CD PRO C 23 34.183 101.816 72.573 1.00 41.92 C
ATOM 6762 N ALA C 24 31.063 102.235 69.134 1.00 36.13 N
ATOM 6763 CA ALA C 24 29.738 102.767 68.865 1.00 33.95 C
ATOM 6764 C ALA C 24 28.908 101.800 68.027 1.00 33.92 C
ATOM 6765 O ALA C 24 29.438 101.036 67.219 1.00 34.35 O
ATOM 6766 CB ALA C 24 29.845 104.094 68.164 1.00 30.26 C
ATOM 6767 N PRO C 25 27.584 101.800 68.232 1.00 33.08 N
ATOM 6768 CA PRO C 25 26.748 100.895 67.440 1.00 31.95 C
ATOM 6769 C PRO C 25 26.881 101.291 65.973 1.00 32.79 C
ATOM 6770 O PRO C 25 26.900 102.474 65.635 1.00 31.12 O
ATOM 6771 CB PRO C 25 25.353 101.164 67.976 1.00 30.51 C
ATOM 6772 CG PRO C 25 25.620 101.592 69.393 1.00 30.26 C
ATOM 6773 CD PRO C 25 26.797 102.488 69.268 1.00 29.88 C
ATOM 6774 N SER C 26 26.967 100.300 65.100 1.00 34.85 N
ATOM 6775 CA SER C 26 27.106 100.561 63.674 1.00 36.52 C
ATOM 6776 C SER C 26 25.878 101.200 63.040 1.00 36.26 C
ATOM 6777 O SER C 26 26.006 101.929 62.066 1.00 37.34 O
ATOM 6778 CB SER C 26 27.401 99.255 62.938 1.00 38.57 C
ATOM 6779 OG SER C 26 26.361 98.315 63.168 1.00 38.45 O
ATOM 6780 N ASN C 27 24.699 100.946 63.606 1.00 35.89 N
ATOM 6781 CA ASN C 27 23.452 101.450 63.041 1.00 35.25 C
ATOM 6782 C ASN C 27 22.729 102.649 63.659 1.00 35.12 C
ATOM 6783 O ASN C 27 21.542 102.831 63.401 1.00 35.86 O
ATOM 6784 CB ASN C 27 22.462 100.298 62.970 1.00 37.90 C
ATOM 6785 CG ASN C 27 21.961 99.904 64.318 1.00 39.81 C
ATOM 6786 OD1 ASN C 27 22.722 99.886 65.285 1.00 42.60 O
ATOM 6787 ND2 ASN C 27 20.673 99.577 64.405 1.00 43.42 N
ATOM 6788 N ILE C 28 23.390 103.476 64.458 1.00 34.56 N
ATOM 6789 CA ILE C 28 22.655 104.598 65.018 1.00 33.22 C
ATOM 6790 C ILE C 28 22.359 105.605 63.916 1.00 32.21 C
ATOM 6791 O ILE C 28 23.211 105.861 63.071 1.00 29.45 O
ATOM 6792 CB ILE C 28 23.402 105.280 66.198 1.00 33.71 C
ATOM 6793 CG1 ILE C 28 24.810 105.655 65.794 1.00 34.32 C
ATOM 6794 CG2 ILE C 28 23.414 104.372 67.406 1.00 33.03 C
ATOM 6795 CD1 ILE C 28 25.544 106.396 66.879 1.00 35.97 C
ATOM 6796 N SER C 29 21.146 106.165 63.938 1.00 31.64 N
ATOM 6797 CA SER C 29 20.713 107.114 62.922 1.00 32.98 C
ATOM 6798 C SER C 29 20.961 108.587 63.211 1.00 35.19 C
ATOM 6799 O SER C 29 21.716 108.947 64.115 1.00 37.38 O
ATOM 6800 CB SER C 29 19.230 106.915 62.619 1.00 33.73 C
ATOM 6801 OG SER C 29 18.415 107.079 63.765 1.00 36.99 O
ATOM 6802 N ALA C 30 20.320 109.441 62.420 1.00 34.01 N
ATOM 6803 CA ALA C 30 20.469 110.870 62.582 1.00 33.41 C
ATOM 6804 C ALA C 30 19.972 111.311 63.947 1.00 33.18 C
ATOM 6805 O ALA C 30 20.385 112.346 64.450 1.00 33.67 O
ATOM 6806 CB ALA C 30 19.707 111.597 61.495 1.00 34.82 C
ATOM 6807 N TRP C 31 19.088 110.530 64.551 1.00 33.06 N
ATOM 6808 CA TRP C 31 18.567 110.900 65.857 1.00 33.64 C
ATOM 6809 C TRP C 31 19.632 110.845 66.959 1.00 32.34 C
ATOM 6810 O TRP C 31 19.409 111.300 68.082 1.00 32.37 O
ATOM 6811 CB TRP C 31 17.383 110.001 66.223 1.00 33.92 C
ATOM 6812 CG TRP C 31 16.242 110.175 65.316 1.00 32.65 C
ATOM 6813 CD1 TRP C 31 15.741 109.249 64.461 1.00 34.79 C
ATOM 6814 CD2 TRP C 31 15.497 111.373 65.096 1.00 33.77 C
ATOM 6815 NE1 TRP C 31 14.732 109.791 63.708 1.00 34.71 N
ATOM 6816 CE2 TRP C 31 14.557 111.097 64.074 1.00 34.61 C
ATOM 6817 CE3 TRP C 31 15.529 112.655 65.655 1.00 33.11 C
ATOM 6818 CZ2 TRP C 31 13.654 112.059 63.594 1.00 34.15 C
ATOM 6819 CZ3 TRP C 31 14.627 113.618 65.180 1.00 33.41 C
ATOM 6820 CH2 TRP C 31 13.702 113.309 64.156 1.00 32.77 C
ATOM 6821 N TRP C 32 20.789 110.288 66.635 1.00 30.50 N
ATOM 6822 CA TRP C 32 21.868 110.182 67.606 1.00 29.50 C
ATOM 6823 C TRP C 32 22.905 111.289 67.364 1.00 30.14 C
ATOM 6824 O TRP C 32 23.989 111.289 67.933 1.00 30.96 O
ATOM 6825 CB TRP C 32 22.505 108.792 67.512 1.00 26.42 C
ATOM 6826 CG TRP C 32 21.894 107.789 68.439 1.00 24.73 C
ATOM 6827 CD1 TRP C 32 22.414 107.361 69.611 1.00 27.40 C
ATOM 6828 CD2 TRP C 32 20.663 107.071 68.263 1.00 27.89 C
ATOM 6829 NE1 TRP C 32 21.600 106.417 70.190 1.00 29.04 N
ATOM 6830 CE2 TRP C 32 20.514 106.218 69.382 1.00 28.15 C
ATOM 6831 CE3 TRP C 32 19.668 107.059 67.266 1.00 27.65 C
ATOM 6832 CZ2 TRP C 32 19.416 105.357 69.538 1.00 27.52 C
ATOM 6833 CZ3 TRP C 32 18.573 106.199 67.422 1.00 26.11 C
ATOM 6834 CH2 TRP C 32 18.460 105.359 68.553 1.00 24.76 C
ATOM 6835 N ASN C 33 22.530 112.249 66.534 1.00 30.54 N
ATOM 6836 CA ASN C 33 23.385 113.362 66.178 1.00 32.14 C
ATOM 6837 C ASN C 33 23.176 114.554 67.093 1.00 33.23 C
ATOM 6838 O ASN C 33 24.051 115.412 67.203 1.00 36.55 O
ATOM 6839 CB ASN C 33 23.088 113.824 64.736 1.00 34.08 C
ATOM 6840 CG ASN C 33 23.968 113.160 63.713 1.00 34.65 C
ATOM 6841 OD1 ASN C 33 23.852 111.966 63.431 1.00 38.63 O
ATOM 6842 ND2 ASN C 33 24.870 113.932 63.156 1.00 36.71 N
ATOM 6843 N PHE C 34 22.022 114.629 67.742 1.00 31.33 N
ATOM 6844 CA PHE C 34 21.728 115.776 68.593 1.00 29.18 C
ATOM 6845 C PHE C 34 22.543 115.929 69.873 1.00 29.32 C
ATOM 6846 O PHE C 34 22.601 117.032 70.444 1.00 28.93 O
ATOM 6847 CB PHE C 34 20.227 115.805 68.857 1.00 27.43 C
ATOM 6848 CG PHE C 34 19.441 115.996 67.605 1.00 27.06 C
ATOM 6849 CD1 PHE C 34 19.418 117.233 66.979 1.00 26.73 C
ATOM 6850 CD2 PHE C 34 18.858 114.913 66.961 1.00 26.22 C
ATOM 6851 CE1 PHE C 34 18.838 117.384 65.722 1.00 27.76 C
ATOM 6852 CE2 PHE C 34 18.281 115.063 65.707 1.00 25.01 C
ATOM 6853 CZ PHE C 34 18.273 116.293 65.088 1.00 24.62 C
ATOM 6854 N GLY C 35 23.169 114.837 70.317 1.00 28.28 N
ATOM 6855 CA GLY C 35 24.014 114.903 71.493 1.00 27.76 C
ATOM 6856 C GLY C 35 25.194 115.816 71.161 1.00 28.49 C
ATOM 6857 O GLY C 35 25.462 116.817 71.847 1.00 28.00 O
ATOM 6858 N SER C 36 25.901 115.494 70.084 1.00 27.11 N
ATOM 6859 CA SER C 36 27.019 116.321 69.688 1.00 27.53 C
ATOM 6860 C SER C 36 26.565 117.731 69.312 1.00 27.55 C
ATOM 6861 O SER C 36 27.273 118.697 69.592 1.00 29.79 O
ATOM 6862 CB SER C 36 27.778 115.680 68.537 1.00 26.70 C
ATOM 6863 OG SER C 36 26.909 115.425 67.457 1.00 28.76 O
ATOM 6864 N LEU C 37 25.401 117.880 68.682 1.00 26.99 N
ATOM 6865 CA LEU C 37 24.955 119.232 68.340 1.00 26.43 C
ATOM 6866 C LEU C 37 24.689 120.004 69.629 1.00 26.70 C
ATOM 6867 O LEU C 37 25.002 121.196 69.721 1.00 25.87 O
ATOM 6868 CB LEU C 37 23.692 119.218 67.477 1.00 28.11 C
ATOM 6869 CG LEU C 37 23.800 118.566 66.091 1.00 30.13 C
ATOM 6870 CD1 LEU C 37 22.502 118.754 65.332 1.00 27.49 C
ATOM 6871 CD2 LEU C 37 24.936 119.164 65.311 1.00 30.44 C
ATOM 6872 N LEU C 38 24.128 119.327 70.633 1.00 25.57 N
ATOM 6873 CA LEU C 38 23.878 119.991 71.905 1.00 23.27 C
ATOM 6874 C LEU C 38 25.195 120.454 72.494 1.00 22.59 C
ATOM 6875 O LEU C 38 25.299 121.566 72.994 1.00 21.20 O
ATOM 6876 CB LEU C 38 23.162 119.069 72.879 1.00 20.20 C
ATOM 6877 CG LEU C 38 21.671 118.949 72.596 1.00 20.34 C
ATOM 6878 CD1 LEU C 38 21.107 117.787 73.403 1.00 18.62 C
ATOM 6879 CD2 LEU C 38 20.957 120.273 72.938 1.00 16.69 C
ATOM 6880 N ALA C 39 26.215 119.612 72.409 1.00 23.96 N
ATOM 6881 CA ALA C 39 27.519 119.992 72.940 1.00 24.72 C
ATOM 6882 C ALA C 39 28.069 121.212 72.195 1.00 24.98 C
ATOM 6883 O ALA C 39 28.636 122.123 72.807 1.00 26.24 O
ATOM 6884 CB ALA C 39 28.468 118.842 72.832 1.00 23.88 C
ATOM 6885 N VAL C 40 27.896 121.247 70.881 1.00 25.04 N
ATOM 6886 CA VAL C 40 28.378 122.386 70.114 1.00 28.30 C
ATOM 6887 C VAL C 40 27.565 123.666 70.401 1.00 29.88 C
ATOM 6888 O VAL C 40 28.113 124.761 70.372 1.00 31.16 O
ATOM 6889 CB VAL C 40 28.386 122.071 68.590 1.00 30.32 C
ATOM 6890 CG1 VAL C 40 28.520 123.363 67.781 1.00 28.78 C
ATOM 6891 CG2 VAL C 40 29.549 121.137 68.258 1.00 24.05 C
ATOM 6892 N CYS C 41 26.269 123.558 70.669 1.00 30.09 N
ATOM 6893 CA CYS C 41 25.540 124.774 71.004 1.00 33.60 C
ATOM 6894 C CYS C 41 26.139 125.313 72.283 1.00 33.78 C
ATOM 6895 O CYS C 41 26.357 126.515 72.421 1.00 35.77 O
ATOM 6896 CB CYS C 41 24.077 124.520 71.329 1.00 36.99 C
ATOM 6897 SG CYS C 41 23.026 124.185 69.973 1.00 49.47 S
ATOM 6898 N LEU C 42 26.372 124.414 73.233 1.00 31.92 N
ATOM 6899 CA LEU C 42 26.894 124.815 74.511 1.00 31.85 C
ATOM 6900 C LEU C 42 28.187 125.571 74.361 1.00 34.15 C
ATOM 6901 O LEU C 42 28.352 126.648 74.936 1.00 34.46 O
ATOM 6902 CB LEU C 42 27.097 123.605 75.412 1.00 29.46 C
ATOM 6903 CG LEU C 42 27.492 123.965 76.844 1.00 27.29 C
ATOM 6904 CD1 LEU C 42 26.544 125.013 77.403 1.00 23.97 C
ATOM 6905 CD2 LEU C 42 27.466 122.710 77.694 1.00 26.85 C
ATOM 6906 N MET C 43 29.110 125.036 73.577 1.00 36.30 N
ATOM 6907 CA MET C 43 30.366 125.738 73.433 1.00 38.90 C
ATOM 6908 C MET C 43 30.165 127.016 72.652 1.00 37.40 C
ATOM 6909 O MET C 43 30.773 128.038 72.949 1.00 38.56 O
ATOM 6910 CB MET C 43 31.401 124.827 72.804 1.00 43.63 C
ATOM 6911 CG MET C 43 31.842 123.748 73.793 1.00 50.64 C
ATOM 6912 SD MET C 43 32.832 122.436 73.033 1.00 62.32 S
ATOM 6913 CE MET C 43 34.585 123.019 73.388 1.00 58.34 C
ATOM 6914 N THR C 44 29.277 126.973 71.675 1.00 35.81 N
ATOM 6915 CA THR C 44 28.976 128.154 70.882 1.00 34.18 C
ATOM 6916 C THR C 44 28.326 129.249 71.737 1.00 33.33 C
ATOM 6917 O THR C 44 28.688 130.424 71.634 1.00 33.85 O
ATOM 6918 CB THR C 44 28.018 127.796 69.736 1.00 35.09 C
ATOM 6919 OG1 THR C 44 28.743 127.076 68.744 1.00 34.04 O
ATOM 6920 CG2 THR C 44 27.391 129.064 69.111 1.00 36.57 C
ATOM 6921 N GLN C 45 27.347 128.870 72.555 1.00 29.60 N
ATOM 6922 CA GLN C 45 26.673 129.832 73.399 1.00 28.27 C
ATOM 6923 C GLN C 45 27.640 130.515 74.361 1.00 28.70 C
ATOM 6924 O GLN C 45 27.626 131.739 74.515 1.00 26.93 O
ATOM 6925 CB GLN C 45 25.562 129.149 74.187 1.00 29.46 C
ATOM 6926 CG GLN C 45 24.289 128.897 73.398 1.00 30.13 C
ATOM 6927 CD GLN C 45 23.731 130.162 72.805 1.00 30.43 C
ATOM 6928 OE1 GLN C 45 23.994 130.485 71.646 1.00 34.27 O
ATOM 6929 NE2 GLN C 45 22.981 130.908 73.605 1.00 31.42 N
ATOM 6930 N ILE C 46 28.478 129.715 75.013 1.00 29.19 N
ATOM 6931 CA ILE C 46 29.459 130.235 75.961 1.00 27.72 C
ATOM 6932 C ILE C 46 30.394 131.233 75.293 1.00 28.01 C
ATOM 6933 O ILE C 46 30.685 132.304 75.830 1.00 30.90 O
ATOM 6934 CB ILE C 46 30.297 129.091 76.564 1.00 24.61 C
ATOM 6935 CG1 ILE C 46 29.480 128.351 77.625 1.00 20.71 C
ATOM 6936 CG2 ILE C 46 31.560 129.640 77.167 1.00 25.23 C
ATOM 6937 CD1 ILE C 46 30.033 126.978 77.981 1.00 15.44 C
ATOM 6938 N LEU C 47 30.854 130.887 74.109 1.00 27.59 N
ATOM 6939 CA LEU C 47 31.765 131.750 73.394 1.00 29.38 C
ATOM 6940 C LEU C 47 31.121 133.073 73.014 1.00 29.55 C
ATOM 6941 O LEU C 47 31.694 134.140 73.232 1.00 32.22 O
ATOM 6942 CB LEU C 47 32.288 131.022 72.152 1.00 32.68 C
ATOM 6943 CG LEU C 47 33.280 131.795 71.283 1.00 36.71 C
ATOM 6944 CD1 LEU C 47 34.510 132.134 72.116 1.00 38.06 C
ATOM 6945 CD2 LEU C 47 33.661 130.972 70.058 1.00 37.12 C
ATOM 6946 N THR C 48 29.922 133.017 72.456 1.00 28.84 N
ATOM 6947 CA THR C 48 29.247 134.242 72.057 1.00 27.54 C
ATOM 6948 C THR C 48 28.816 135.017 73.283 1.00 26.06 C
ATOM 6949 O THR C 48 28.820 136.241 73.283 1.00 25.68 O
ATOM 6950 CB THR C 48 28.008 133.951 71.136 1.00 27.72 C
ATOM 6951 OG1 THR C 48 27.123 133.026 71.770 1.00 28.89 O
ATOM 6952 CG2 THR C 48 28.452 133.346 69.822 1.00 26.92 C
ATOM 6953 N GLY C 49 28.454 134.294 74.335 1.00 26.05 N
ATOM 6954 CA GLY C 49 28.032 134.935 75.568 1.00 26.88 C
ATOM 6955 C GLY C 49 29.139 135.746 76.216 1.00 27.66 C
ATOM 6956 O GLY C 49 28.906 136.883 76.629 1.00 27.21 O
ATOM 6957 N LEU C 50 30.339 135.171 76.325 1.00 28.12 N
ATOM 6958 CA LEU C 50 31.469 135.907 76.898 1.00 28.22 C
ATOM 6959 C LEU C 50 31.675 137.163 76.067 1.00 28.20 C
ATOM 6960 O LEU C 50 31.796 138.272 76.598 1.00 29.09 O
ATOM 6961 CB LEU C 50 32.748 135.078 76.848 1.00 30.25 C
ATOM 6962 CG LEU C 50 32.891 133.891 77.798 1.00 32.33 C
ATOM 6963 CD1 LEU C 50 34.077 133.040 77.367 1.00 32.69 C
ATOM 6964 CD2 LEU C 50 33.071 134.398 79.224 1.00 32.34 C
ATOM 6965 N LEU C 51 31.711 136.984 74.751 1.00 27.59 N
ATOM 6966 CA LEU C 51 31.900 138.113 73.868 1.00 28.43 C
ATOM 6967 C LEU C 51 30.865 139.209 74.112 1.00 28.36 C
ATOM 6968 O LEU C 51 31.226 140.388 74.118 1.00 28.50 O
ATOM 6969 CB LEU C 51 31.901 137.651 72.403 1.00 29.14 C
ATOM 6970 CG LEU C 51 33.164 136.844 72.026 1.00 28.36 C
ATOM 6971 CD1 LEU C 51 33.027 136.321 70.598 1.00 28.13 C
ATOM 6972 CD2 LEU C 51 34.421 137.713 72.157 1.00 24.84 C
ATOM 6973 N LEU C 52 29.600 138.839 74.336 1.00 27.78 N
ATOM 6974 CA LEU C 52 28.567 139.849 74.606 1.00 27.61 C
ATOM 6975 C LEU C 52 28.772 140.424 75.997 1.00 29.52 C
ATOM 6976 O LEU C 52 28.676 141.636 76.193 1.00 30.54 O
ATOM 6977 CB LEU C 52 27.154 139.272 74.531 1.00 26.10 C
ATOM 6978 CG LEU C 52 26.627 138.778 73.182 1.00 27.59 C
ATOM 6979 CD1 LEU C 52 25.196 138.316 73.326 1.00 25.18 C
ATOM 6980 CD2 LEU C 52 26.723 139.890 72.167 1.00 28.94 C
ATOM 6981 N ALA C 53 29.065 139.550 76.959 1.00 30.78 N
ATOM 6982 CA ALA C 53 29.280 139.964 78.334 1.00 31.05 C
ATOM 6983 C ALA C 53 30.352 141.029 78.445 1.00 33.60 C
ATOM 6984 O ALA C 53 30.324 141.847 79.364 1.00 35.92 O
ATOM 6985 CB ALA C 53 29.648 138.787 79.163 1.00 29.42 C
ATOM 6986 N MET C 54 31.295 141.040 77.510 1.00 35.78 N
ATOM 6987 CA MET C 54 32.365 142.039 77.552 1.00 37.08 C
ATOM 6988 C MET C 54 31.974 143.461 77.162 1.00 35.18 C
ATOM 6989 O MET C 54 32.812 144.365 77.184 1.00 35.49 O
ATOM 6990 CB MET C 54 33.543 141.558 76.716 1.00 40.20 C
ATOM 6991 CG MET C 54 34.146 140.318 77.342 1.00 44.72 C
ATOM 6992 SD MET C 54 35.415 139.539 76.388 1.00 49.74 S
ATOM 6993 CE MET C 54 36.033 138.405 77.607 1.00 48.48 C
ATOM 6994 N HIS C 55 30.706 143.656 76.807 1.00 33.21 N
ATOM 6995 CA HIS C 55 30.203 144.980 76.459 1.00 29.64 C
ATOM 6996 C HIS C 55 28.865 145.229 77.127 1.00 30.89 C
ATOM 6997 O HIS C 55 28.243 146.273 76.922 1.00 32.73 O
ATOM 6998 CB HIS C 55 30.025 145.127 74.970 1.00 26.23 C
ATOM 6999 CG HIS C 55 31.275 144.912 74.188 1.00 25.69 C
ATOM 7000 ND1 HIS C 55 31.658 143.674 73.727 1.00 25.61 N
ATOM 7001 CD2 HIS C 55 32.223 145.782 73.767 1.00 25.17 C
ATOM 7002 CE1 HIS C 55 32.788 143.788 73.049 1.00 25.96 C
ATOM 7003 NE2 HIS C 55 33.150 145.057 73.058 1.00 25.97 N
ATOM 7004 N TYR C 56 28.428 144.269 77.933 1.00 30.71 N
ATOM 7005 CA TYR C 56 27.156 144.373 78.621 1.00 30.79 C
ATOM 7006 C TYR C 56 27.324 145.117 79.933 1.00 31.41 C
ATOM 7007 O TYR C 56 28.415 145.171 80.474 1.00 33.87 O
ATOM 7008 CB TYR C 56 26.604 142.976 78.881 1.00 29.52 C
ATOM 7009 CG TYR C 56 25.285 142.980 79.597 1.00 29.62 C
ATOM 7010 CD1 TYR C 56 24.161 143.589 79.022 1.00 27.67 C
ATOM 7011 CD2 TYR C 56 25.161 142.417 80.879 1.00 28.97 C
ATOM 7012 CE1 TYR C 56 22.938 143.645 79.715 1.00 28.79 C
ATOM 7013 CE2 TYR C 56 23.942 142.468 81.582 1.00 28.57 C
ATOM 7014 CZ TYR C 56 22.839 143.086 80.996 1.00 28.44 C
ATOM 7015 OH TYR C 56 21.659 143.169 81.699 1.00 27.20 O
ATOM 7016 N THR C 57 26.247 145.704 80.434 1.00 31.44 N
ATOM 7017 CA THR C 57 26.282 146.424 81.689 1.00 30.85 C
ATOM 7018 C THR C 57 25.008 146.130 82.455 1.00 30.62 C
ATOM 7019 O THR C 57 23.947 146.588 82.089 1.00 30.65 O
ATOM 7020 CB THR C 57 26.407 147.921 81.464 1.00 32.79 C
ATOM 7021 OG1 THR C 57 27.713 148.220 80.950 1.00 38.85 O
ATOM 7022 CG2 THR C 57 26.230 148.659 82.766 1.00 35.70 C
ATOM 7023 N ALA C 58 25.128 145.348 83.522 1.00 32.65 N
ATOM 7024 CA ALA C 58 23.992 144.962 84.351 1.00 32.78 C
ATOM 7025 C ALA C 58 23.571 146.031 85.345 1.00 33.75 C
ATOM 7026 O ALA C 58 24.053 146.078 86.483 1.00 34.58 O
ATOM 7027 CB ALA C 58 24.302 143.664 85.091 1.00 32.68 C
ATOM 7028 N ASP C 59 22.671 146.891 84.891 1.00 34.85 N
ATOM 7029 CA ASP C 59 22.104 147.963 85.694 1.00 34.67 C
ATOM 7030 C ASP C 59 20.901 148.403 84.889 1.00 36.37 C
ATOM 7031 O ASP C 59 21.007 148.648 83.672 1.00 36.99 O
ATOM 7032 CB ASP C 59 23.067 149.117 85.822 1.00 37.20 C
ATOM 7033 CG ASP C 59 22.607 150.125 86.831 1.00 40.50 C
ATOM 7034 OD1 ASP C 59 22.857 149.909 88.043 1.00 43.78 O
ATOM 7035 OD2 ASP C 59 21.979 151.120 86.414 1.00 41.44 O
ATOM 7036 N THR C 60 19.752 148.495 85.547 1.00 36.02 N
ATOM 7037 CA THR C 60 18.518 148.863 84.850 1.00 33.70 C
ATOM 7038 C THR C 60 18.622 150.137 84.007 1.00 34.20 C
ATOM 7039 O THR C 60 17.973 150.262 82.975 1.00 33.78 O
ATOM 7040 CB THR C 60 17.365 149.006 85.833 1.00 30.83 C
ATOM 7041 OG1 THR C 60 17.716 149.960 86.835 1.00 29.89 O
ATOM 7042 CG2 THR C 60 17.063 147.675 86.489 1.00 28.58 C
ATOM 7043 N SER C 61 19.458 151.074 84.418 1.00 33.74 N
ATOM 7044 CA SER C 61 19.577 152.305 83.656 1.00 33.18 C
ATOM 7045 C SER C 61 20.511 152.146 82.469 1.00 31.93 C
ATOM 7046 O SER C 61 20.538 153.005 81.593 1.00 31.96 O
ATOM 7047 CB SER C 61 20.095 153.435 84.546 1.00 34.17 C
ATOM 7048 OG SER C 61 21.461 153.219 84.888 1.00 37.94 O
ATOM 7049 N LEU C 62 21.269 151.053 82.419 1.00 29.94 N
ATOM 7050 CA LEU C 62 22.202 150.877 81.315 1.00 27.71 C
ATOM 7051 C LEU C 62 22.068 149.574 80.524 1.00 27.82 C
ATOM 7052 O LEU C 62 22.589 149.458 79.422 1.00 27.83 O
ATOM 7053 CB LEU C 62 23.629 151.039 81.843 1.00 28.10 C
ATOM 7054 CG LEU C 62 24.004 152.392 82.511 1.00 27.46 C
ATOM 7055 CD1 LEU C 62 25.360 152.263 83.210 1.00 25.58 C
ATOM 7056 CD2 LEU C 62 24.068 153.505 81.479 1.00 22.84 C
ATOM 7057 N ALA C 63 21.352 148.597 81.064 1.00 27.89 N
ATOM 7058 CA ALA C 63 21.175 147.319 80.373 1.00 26.95 C
ATOM 7059 C ALA C 63 20.758 147.423 78.909 1.00 27.02 C
ATOM 7060 O ALA C 63 21.492 147.029 78.003 1.00 26.04 O
ATOM 7061 CB ALA C 63 20.160 146.491 81.109 1.00 28.09 C
ATOM 7062 N PHE C 64 19.547 147.930 78.690 1.00 27.27 N
ATOM 7063 CA PHE C 64 18.987 148.071 77.351 1.00 24.66 C
ATOM 7064 C PHE C 64 19.952 148.795 76.413 1.00 25.27 C
ATOM 7065 O PHE C 64 20.242 148.316 75.313 1.00 27.77 O
ATOM 7066 CB PHE C 64 17.658 148.832 77.426 1.00 23.98 C
ATOM 7067 CG PHE C 64 16.882 148.871 76.124 1.00 22.93 C
ATOM 7068 CD1 PHE C 64 15.982 147.859 75.796 1.00 21.53 C
ATOM 7069 CD2 PHE C 64 17.056 149.917 75.223 1.00 20.62 C
ATOM 7070 CE1 PHE C 64 15.272 147.895 74.593 1.00 19.69 C
ATOM 7071 CE2 PHE C 64 16.345 149.952 74.018 1.00 18.96 C
ATOM 7072 CZ PHE C 64 15.459 148.944 73.708 1.00 17.97 C
ATOM 7073 N SER C 65 20.471 149.931 76.838 1.00 23.37 N
ATOM 7074 CA SER C 65 21.365 150.661 75.958 1.00 26.12 C
ATOM 7075 C SER C 65 22.752 150.022 75.733 1.00 24.87 C
ATOM 7076 O SER C 65 23.367 150.212 74.680 1.00 25.12 O
ATOM 7077 CB SER C 65 21.496 152.108 76.442 1.00 26.03 C
ATOM 7078 OG SER C 65 22.015 152.136 77.750 1.00 34.45 O
ATOM 7079 N SER C 66 23.252 149.264 76.698 1.00 24.71 N
ATOM 7080 CA SER C 66 24.547 148.618 76.505 1.00 23.44 C
ATOM 7081 C SER C 66 24.395 147.560 75.406 1.00 24.02 C
ATOM 7082 O SER C 66 25.314 147.325 74.608 1.00 25.84 O
ATOM 7083 CB SER C 66 25.034 147.977 77.808 1.00 21.90 C
ATOM 7084 OG SER C 66 24.437 146.725 78.031 1.00 24.85 O
ATOM 7085 N VAL C 67 23.228 146.929 75.358 1.00 21.35 N
ATOM 7086 CA VAL C 67 22.968 145.943 74.337 1.00 20.18 C
ATOM 7087 C VAL C 67 22.875 146.666 72.990 1.00 23.05 C
ATOM 7088 O VAL C 67 23.366 146.187 71.957 1.00 22.14 O
ATOM 7089 CB VAL C 67 21.671 145.208 74.652 1.00 18.81 C
ATOM 7090 CG1 VAL C 67 21.302 144.258 73.526 1.00 16.24 C
ATOM 7091 CG2 VAL C 67 21.846 144.441 75.940 1.00 16.16 C
ATOM 7092 N ALA C 68 22.248 147.835 73.016 1.00 24.74 N
ATOM 7093 CA ALA C 68 22.090 148.636 71.820 1.00 26.18 C
ATOM 7094 C ALA C 68 23.479 149.069 71.402 1.00 27.83 C
ATOM 7095 O ALA C 68 23.818 149.002 70.220 1.00 29.50 O
ATOM 7096 CB ALA C 68 21.207 149.858 72.100 1.00 25.60 C
ATOM 7097 N HIS C 69 24.288 149.499 72.373 1.00 28.92 N
ATOM 7098 CA HIS C 69 25.653 149.930 72.086 1.00 28.00 C
ATOM 7099 C HIS C 69 26.399 148.763 71.423 1.00 28.93 C
ATOM 7100 O HIS C 69 27.134 148.962 70.442 1.00 25.72 O
ATOM 7101 CB HIS C 69 26.362 150.360 73.380 1.00 30.09 C
ATOM 7102 CG HIS C 69 27.863 150.470 73.254 1.00 35.05 C
ATOM 7103 ND1 HIS C 69 28.730 149.525 73.773 1.00 32.18 N
ATOM 7104 CD2 HIS C 69 28.642 151.387 72.622 1.00 34.65 C
ATOM 7105 CE1 HIS C 69 29.972 149.852 73.461 1.00 33.06 C
ATOM 7106 NE2 HIS C 69 29.946 150.976 72.761 1.00 35.66 N
ATOM 7107 N THR C 70 26.190 147.552 71.954 1.00 28.07 N
ATOM 7108 CA THR C 70 26.832 146.367 71.415 1.00 27.66 C
ATOM 7109 C THR C 70 26.443 146.150 69.959 1.00 28.81 C
ATOM 7110 O THR C 70 27.316 145.971 69.106 1.00 28.62 O
ATOM 7111 CB THR C 70 26.453 145.089 72.201 1.00 28.45 C
ATOM 7112 OG1 THR C 70 26.882 145.208 73.560 1.00 30.07 O
ATOM 7113 CG2 THR C 70 27.128 143.870 71.595 1.00 26.41 C
ATOM 7114 N CYS C 71 25.141 146.168 69.665 1.00 29.25 N
ATOM 7115 CA CYS C 71 24.676 145.937 68.288 1.00 27.61 C
ATOM 7116 C CYS C 71 25.011 147.088 67.356 1.00 28.91 C
ATOM 7117 O CYS C 71 25.261 146.879 66.178 1.00 32.17 O
ATOM 7118 CB CYS C 71 23.160 145.682 68.242 1.00 23.44 C
ATOM 7119 SG CYS C 71 22.588 144.232 69.216 1.00 22.46 S
ATOM 7120 N ARG C 72 25.039 148.303 67.877 1.00 26.97 N
ATOM 7121 CA ARG C 72 25.320 149.437 67.024 1.00 27.24 C
ATOM 7122 C ARG C 72 26.785 149.868 66.872 1.00 28.92 C
ATOM 7123 O ARG C 72 27.165 150.343 65.806 1.00 31.16 O
ATOM 7124 CB ARG C 72 24.493 150.643 67.482 1.00 26.27 C
ATOM 7125 CG ARG C 72 22.994 150.555 67.195 1.00 23.28 C
ATOM 7126 CD ARG C 72 22.238 151.727 67.846 1.00 24.87 C
ATOM 7127 NE ARG C 72 20.789 151.610 67.690 1.00 28.37 N
ATOM 7128 CZ ARG C 72 20.108 151.894 66.569 1.00 29.29 C
ATOM 7129 NH1 ARG C 72 20.731 152.339 65.476 1.00 26.22 N
ATOM 7130 NH2 ARG C 72 18.795 151.680 66.525 1.00 24.85 N
ATOM 7131 N ASN C 73 27.598 149.713 67.916 1.00 29.42 N
ATOM 7132 CA ASN C 73 29.003 150.146 67.879 1.00 28.05 C
ATOM 7133 C ASN C 73 30.113 149.082 67.838 1.00 27.87 C
ATOM 7134 O ASN C 73 31.157 149.286 67.225 1.00 28.62 O
ATOM 7135 CB ASN C 73 29.273 151.061 69.072 1.00 29.37 C
ATOM 7136 CG ASN C 73 28.403 152.298 69.067 1.00 29.22 C
ATOM 7137 OD1 ASN C 73 28.257 152.957 68.041 1.00 31.01 O
ATOM 7138 ND2 ASN C 73 27.833 152.630 70.218 1.00 27.38 N
ATOM 7139 N VAL C 74 29.905 147.964 68.514 1.00 25.42 N
ATOM 7140 CA VAL C 74 30.899 146.920 68.550 1.00 22.97 C
ATOM 7141 C VAL C 74 31.040 146.221 67.203 1.00 25.70 C
ATOM 7142 O VAL C 74 30.061 145.770 66.630 1.00 28.08 O
ATOM 7143 CB VAL C 74 30.540 145.885 69.656 1.00 21.39 C
ATOM 7144 CG1 VAL C 74 31.489 144.684 69.600 1.00 16.26 C
ATOM 7145 CG2 VAL C 74 30.580 146.566 71.048 1.00 14.44 C
ATOM 7146 N GLN C 75 32.262 146.146 66.690 1.00 27.31 N
ATOM 7147 CA GLN C 75 32.513 145.454 65.431 1.00 27.49 C
ATOM 7148 C GLN C 75 31.812 144.097 65.525 1.00 28.26 C
ATOM 7149 O GLN C 75 32.042 143.346 66.469 1.00 29.49 O
ATOM 7150 CB GLN C 75 34.005 145.224 65.268 1.00 31.55 C
ATOM 7151 CG GLN C 75 34.826 146.467 65.457 1.00 37.68 C
ATOM 7152 CD GLN C 75 34.376 147.559 64.515 1.00 41.76 C
ATOM 7153 OE1 GLN C 75 34.298 147.337 63.304 1.00 44.48 O
ATOM 7154 NE2 GLN C 75 34.076 148.749 65.058 1.00 42.97 N
ATOM 7155 N TYR C 76 30.974 143.784 64.545 1.00 27.11 N
ATOM 7156 CA TYR C 76 30.219 142.538 64.526 1.00 27.57 C
ATOM 7157 C TYR C 76 29.418 142.247 65.791 1.00 28.97 C
ATOM 7158 O TYR C 76 29.001 141.111 66.025 1.00 29.32 O
ATOM 7159 CB TYR C 76 31.136 141.373 64.212 1.00 27.79 C
ATOM 7160 CG TYR C 76 31.803 141.587 62.893 1.00 30.14 C
ATOM 7161 CD1 TYR C 76 33.111 142.078 62.835 1.00 28.69 C
ATOM 7162 CD2 TYR C 76 31.088 141.416 61.692 1.00 28.27 C
ATOM 7163 CE1 TYR C 76 33.698 142.402 61.626 1.00 31.13 C
ATOM 7164 CE2 TYR C 76 31.660 141.746 60.462 1.00 30.35 C
ATOM 7165 CZ TYR C 76 32.973 142.244 60.436 1.00 32.92 C
ATOM 7166 OH TYR C 76 33.560 142.624 59.240 1.00 34.01 O
ATOM 7167 N GLY C 77 29.196 143.275 66.603 1.00 28.77 N
ATOM 7168 CA GLY C 77 28.426 143.086 67.815 1.00 29.37 C
ATOM 7169 C GLY C 77 27.034 142.573 67.471 1.00 30.66 C
ATOM 7170 O GLY C 77 26.518 141.652 68.115 1.00 31.21 O
ATOM 7171 N TRP C 78 26.424 143.162 66.445 1.00 29.62 N
ATOM 7172 CA TRP C 78 25.089 142.753 66.042 1.00 28.73 C
ATOM 7173 C TRP C 78 25.079 141.279 65.660 1.00 28.39 C
ATOM 7174 O TRP C 78 24.173 140.530 66.030 1.00 28.45 O
ATOM 7175 CB TRP C 78 24.584 143.606 64.856 1.00 26.50 C
ATOM 7176 CG TRP C 78 25.391 143.449 63.621 1.00 23.64 C
ATOM 7177 CD1 TRP C 78 26.498 144.162 63.265 1.00 23.46 C
ATOM 7178 CD2 TRP C 78 25.213 142.452 62.611 1.00 23.34 C
ATOM 7179 NE1 TRP C 78 27.029 143.671 62.092 1.00 21.15 N
ATOM 7180 CE2 TRP C 78 26.260 142.618 61.670 1.00 23.02 C
ATOM 7181 CE3 TRP C 78 24.271 141.428 62.410 1.00 22.05 C
ATOM 7182 CZ2 TRP C 78 26.393 141.798 60.546 1.00 20.95 C
ATOM 7183 CZ3 TRP C 78 24.403 140.617 61.298 1.00 23.54 C
ATOM 7184 CH2 TRP C 78 25.465 140.809 60.373 1.00 21.73 C
ATOM 7185 N LEU C 79 26.098 140.856 64.931 1.00 27.43 N
ATOM 7186 CA LEU C 79 26.158 139.474 64.490 1.00 27.56 C
ATOM 7187 C LEU C 79 26.270 138.512 65.661 1.00 28.44 C
ATOM 7188 O LEU C 79 25.618 137.447 65.691 1.00 28.87 O
ATOM 7189 CB LEU C 79 27.350 139.269 63.556 1.00 26.45 C
ATOM 7190 CG LEU C 79 27.615 137.793 63.321 1.00 26.00 C
ATOM 7191 CD1 LEU C 79 26.435 137.242 62.553 1.00 24.99 C
ATOM 7192 CD2 LEU C 79 28.916 137.572 62.600 1.00 25.37 C
ATOM 7193 N ILE C 80 27.128 138.876 66.611 1.00 27.62 N
ATOM 7194 CA ILE C 80 27.347 138.047 67.780 1.00 25.65 C
ATOM 7195 C ILE C 80 26.059 137.983 68.597 1.00 26.63 C
ATOM 7196 O ILE C 80 25.692 136.932 69.107 1.00 26.41 O
ATOM 7197 CB ILE C 80 28.518 138.593 68.594 1.00 23.91 C
ATOM 7198 CG1 ILE C 80 29.804 138.354 67.810 1.00 22.50 C
ATOM 7199 CG2 ILE C 80 28.597 137.922 69.943 1.00 21.41 C
ATOM 7200 CD1 ILE C 80 30.998 139.126 68.355 1.00 27.02 C
ATOM 7201 N ARG C 81 25.342 139.094 68.695 1.00 27.13 N
ATOM 7202 CA ARG C 81 24.100 139.055 69.435 1.00 25.91 C
ATOM 7203 C ARG C 81 23.092 138.140 68.741 1.00 26.92 C
ATOM 7204 O ARG C 81 22.423 137.342 69.398 1.00 27.70 O
ATOM 7205 CB ARG C 81 23.503 140.442 69.579 1.00 25.69 C
ATOM 7206 CG ARG C 81 22.448 140.439 70.653 1.00 27.01 C
ATOM 7207 CD ARG C 81 21.367 141.456 70.438 1.00 26.12 C
ATOM 7208 NE ARG C 81 20.316 141.296 71.435 1.00 25.19 N
ATOM 7209 CZ ARG C 81 19.329 142.163 71.614 1.00 26.40 C
ATOM 7210 NH1 ARG C 81 19.253 143.253 70.851 1.00 25.73 N
ATOM 7211 NH2 ARG C 81 18.430 141.951 72.565 1.00 26.64 N
ATOM 7212 N ASN C 82 22.975 138.240 67.421 1.00 26.75 N
ATOM 7213 CA ASN C 82 22.044 137.377 66.713 1.00 29.24 C
ATOM 7214 C ASN C 82 22.420 135.920 66.946 1.00 29.79 C
ATOM 7215 O ASN C 82 21.556 135.087 67.220 1.00 30.37 O
ATOM 7216 CB ASN C 82 22.037 137.660 65.199 1.00 33.07 C
ATOM 7217 CG ASN C 82 21.482 139.042 64.856 1.00 41.08 C
ATOM 7218 OD1 ASN C 82 21.401 139.418 63.679 1.00 45.25 O
ATOM 7219 ND2 ASN C 82 21.098 139.810 65.884 1.00 44.01 N
ATOM 7220 N LEU C 83 23.707 135.602 66.832 1.00 29.35 N
ATOM 7221 CA LEU C 83 24.123 134.228 67.024 1.00 29.17 C
ATOM 7222 C LEU C 83 23.795 133.754 68.433 1.00 29.13 C
ATOM 7223 O LEU C 83 23.423 132.598 68.631 1.00 29.71 O
ATOM 7224 CB LEU C 83 25.615 134.076 66.739 1.00 29.68 C
ATOM 7225 CG LEU C 83 26.025 134.347 65.284 1.00 30.75 C
ATOM 7226 CD1 LEU C 83 27.543 134.307 65.172 1.00 30.53 C
ATOM 7227 CD2 LEU C 83 25.404 133.309 64.365 1.00 27.42 C
ATOM 7228 N HIS C 84 23.894 134.638 69.420 1.00 28.56 N
ATOM 7229 CA HIS C 84 23.600 134.217 70.784 1.00 28.26 C
ATOM 7230 C HIS C 84 22.095 134.023 70.973 1.00 27.35 C
ATOM 7231 O HIS C 84 21.640 132.990 71.472 1.00 26.52 O
ATOM 7232 CB HIS C 84 24.140 135.238 71.798 1.00 28.48 C
ATOM 7233 CG HIS C 84 24.212 134.713 73.201 1.00 30.04 C
ATOM 7234 ND1 HIS C 84 25.117 133.742 73.580 1.00 30.24 N
ATOM 7235 CD2 HIS C 84 23.482 135.001 74.311 1.00 29.04 C
ATOM 7236 CE1 HIS C 84 24.944 133.455 74.860 1.00 29.68 C
ATOM 7237 NE2 HIS C 84 23.958 134.203 75.330 1.00 29.39 N
ATOM 7238 N ALA C 85 21.314 135.014 70.569 1.00 27.22 N
ATOM 7239 CA ALA C 85 19.865 134.914 70.709 1.00 27.03 C
ATOM 7240 C ALA C 85 19.314 133.707 69.957 1.00 27.30 C
ATOM 7241 O ALA C 85 18.564 132.903 70.514 1.00 28.86 O
ATOM 7242 CB ALA C 85 19.211 136.169 70.208 1.00 25.13 C
ATOM 7243 N ASN C 86 19.693 133.561 68.695 1.00 27.83 N
ATOM 7244 CA ASN C 86 19.190 132.436 67.925 1.00 29.69 C
ATOM 7245 C ASN C 86 19.782 131.099 68.323 1.00 30.13 C
ATOM 7246 O ASN C 86 19.123 130.052 68.191 1.00 29.59 O
ATOM 7247 CB ASN C 86 19.316 132.739 66.435 1.00 28.39 C
ATOM 7248 CG ASN C 86 18.306 133.811 66.005 1.00 32.18 C
ATOM 7249 OD1 ASN C 86 18.657 134.849 65.415 1.00 30.90 O
ATOM 7250 ND2 ASN C 86 17.033 133.577 66.348 1.00 30.56 N
ATOM 7251 N GLY C 87 21.005 131.145 68.857 1.00 30.26 N
ATOM 7252 CA GLY C 87 21.659 129.941 69.337 1.00 27.32 C
ATOM 7253 C GLY C 87 20.841 129.351 70.481 1.00 26.60 C
ATOM 7254 O GLY C 87 20.742 128.119 70.619 1.00 27.49 O
ATOM 7255 N ALA C 88 20.230 130.209 71.301 1.00 23.97 N
ATOM 7256 CA ALA C 88 19.421 129.697 72.404 1.00 24.48 C
ATOM 7257 C ALA C 88 18.279 128.832 71.869 1.00 26.23 C
ATOM 7258 O ALA C 88 17.960 127.798 72.459 1.00 27.43 O
ATOM 7259 CB ALA C 88 18.877 130.834 73.247 1.00 21.41 C
ATOM 7260 N SER C 89 17.684 129.250 70.747 1.00 27.60 N
ATOM 7261 CA SER C 89 16.589 128.514 70.104 1.00 27.67 C
ATOM 7262 C SER C 89 17.036 127.178 69.531 1.00 27.48 C
ATOM 7263 O SER C 89 16.371 126.164 69.735 1.00 27.87 O
ATOM 7264 CB SER C 89 15.963 129.341 68.972 1.00 28.77 C
ATOM 7265 OG SER C 89 14.911 130.162 69.451 1.00 31.24 O
ATOM 7266 N PHE C 90 18.143 127.191 68.788 1.00 27.68 N
ATOM 7267 CA PHE C 90 18.708 125.986 68.173 1.00 28.35 C
ATOM 7268 C PHE C 90 19.004 125.024 69.322 1.00 26.97 C
ATOM 7269 O PHE C 90 18.890 123.804 69.187 1.00 24.36 O
ATOM 7270 CB PHE C 90 19.995 126.377 67.436 1.00 33.67 C
ATOM 7271 CG PHE C 90 20.729 125.230 66.746 1.00 41.19 C
ATOM 7272 CD1 PHE C 90 20.583 125.002 65.365 1.00 43.39 C
ATOM 7273 CD2 PHE C 90 21.665 124.444 67.447 1.00 41.66 C
ATOM 7274 CE1 PHE C 90 21.386 124.001 64.699 1.00 44.83 C
ATOM 7275 CE2 PHE C 90 22.460 123.453 66.787 1.00 41.97 C
ATOM 7276 CZ PHE C 90 22.318 123.238 65.415 1.00 40.93 C
ATOM 7277 N PHE C 91 19.359 125.597 70.471 1.00 26.80 N
ATOM 7278 CA PHE C 91 19.672 124.803 71.650 1.00 27.10 C
ATOM 7279 C PHE C 91 18.426 124.031 72.083 1.00 26.65 C
ATOM 7280 O PHE C 91 18.496 122.839 72.367 1.00 27.84 O
ATOM 7281 CB PHE C 91 20.178 125.707 72.790 1.00 26.93 C
ATOM 7282 CG PHE C 91 21.142 125.021 73.743 1.00 24.31 C
ATOM 7283 CD1 PHE C 91 20.901 123.736 74.205 1.00 23.67 C
ATOM 7284 CD2 PHE C 91 22.286 125.675 74.182 1.00 23.60 C
ATOM 7285 CE1 PHE C 91 21.784 123.114 75.085 1.00 22.65 C
ATOM 7286 CE2 PHE C 91 23.170 125.057 75.061 1.00 22.70 C
ATOM 7287 CZ PHE C 91 22.917 123.778 75.512 1.00 20.91 C
ATOM 7288 N PHE C 92 17.284 124.709 72.133 1.00 27.05 N
ATOM 7289 CA PHE C 92 16.036 124.038 72.508 1.00 26.92 C
ATOM 7290 C PHE C 92 15.511 123.089 71.416 1.00 27.27 C
ATOM 7291 O PHE C 92 14.998 122.007 71.719 1.00 26.42 O
ATOM 7292 CB PHE C 92 14.973 125.066 72.872 1.00 25.50 C
ATOM 7293 CG PHE C 92 15.149 125.633 74.235 1.00 23.43 C
ATOM 7294 CD1 PHE C 92 15.845 126.818 74.429 1.00 23.82 C
ATOM 7295 CD2 PHE C 92 14.692 124.930 75.344 1.00 22.55 C
ATOM 7296 CE1 PHE C 92 16.085 127.291 75.721 1.00 25.89 C
ATOM 7297 CE2 PHE C 92 14.927 125.384 76.634 1.00 21.87 C
ATOM 7298 CZ PHE C 92 15.622 126.560 76.832 1.00 24.04 C
ATOM 7299 N ILE C 93 15.644 123.482 70.150 1.00 25.69 N
ATOM 7300 CA ILE C 93 15.198 122.604 69.083 1.00 25.14 C
ATOM 7301 C ILE C 93 15.954 121.301 69.256 1.00 25.55 C
ATOM 7302 O ILE C 93 15.361 120.226 69.267 1.00 25.05 O
ATOM 7303 CB ILE C 93 15.493 123.186 67.669 1.00 24.71 C
ATOM 7304 CG1 ILE C 93 14.604 124.412 67.422 1.00 25.28 C
ATOM 7305 CG2 ILE C 93 15.203 122.148 66.610 1.00 17.14 C
ATOM 7306 CD1 ILE C 93 14.839 125.141 66.084 1.00 24.83 C
ATOM 7307 N CYS C 94 17.270 121.400 69.411 1.00 25.51 N
ATOM 7308 CA CYS C 94 18.082 120.210 69.580 1.00 26.04 C
ATOM 7309 C CYS C 94 17.783 119.449 70.857 1.00 26.56 C
ATOM 7310 O CYS C 94 17.830 118.220 70.864 1.00 27.96 O
ATOM 7311 CB CYS C 94 19.564 120.562 69.565 1.00 27.70 C
ATOM 7312 SG CYS C 94 20.170 121.187 67.989 1.00 33.26 S
ATOM 7313 N ILE C 95 17.482 120.142 71.951 1.00 25.75 N
ATOM 7314 CA ILE C 95 17.222 119.385 73.166 1.00 24.71 C
ATOM 7315 C ILE C 95 15.893 118.657 73.048 1.00 24.88 C
ATOM 7316 O ILE C 95 15.769 117.521 73.516 1.00 25.98 O
ATOM 7317 CB ILE C 95 17.275 120.263 74.465 1.00 25.38 C
ATOM 7318 CG1 ILE C 95 17.735 119.387 75.623 1.00 23.38 C
ATOM 7319 CG2 ILE C 95 15.905 120.846 74.813 1.00 23.78 C
ATOM 7320 CD1 ILE C 95 17.830 120.096 76.917 1.00 27.17 C
ATOM 7321 N PHE C 96 14.910 119.282 72.400 1.00 23.29 N
ATOM 7322 CA PHE C 96 13.610 118.630 72.220 1.00 22.83 C
ATOM 7323 C PHE C 96 13.691 117.377 71.354 1.00 21.34 C
ATOM 7324 O PHE C 96 13.086 116.358 71.672 1.00 22.28 O
ATOM 7325 CB PHE C 96 12.595 119.598 71.617 1.00 23.48 C
ATOM 7326 CG PHE C 96 12.174 120.686 72.556 1.00 25.56 C
ATOM 7327 CD1 PHE C 96 12.133 120.460 73.931 1.00 26.81 C
ATOM 7328 CD2 PHE C 96 11.778 121.926 72.071 1.00 26.11 C
ATOM 7329 CE1 PHE C 96 11.697 121.460 74.808 1.00 27.35 C
ATOM 7330 CE2 PHE C 96 11.340 122.929 72.935 1.00 26.46 C
ATOM 7331 CZ PHE C 96 11.297 122.695 74.303 1.00 26.31 C
ATOM 7332 N LEU C 97 14.430 117.451 70.257 1.00 20.90 N
ATOM 7333 CA LEU C 97 14.592 116.296 69.387 1.00 20.63 C
ATOM 7334 C LEU C 97 15.411 115.210 70.098 1.00 22.29 C
ATOM 7335 O LEU C 97 15.157 114.016 69.891 1.00 22.16 O
ATOM 7336 CB LEU C 97 15.268 116.714 68.072 1.00 20.98 C
ATOM 7337 CG LEU C 97 14.504 117.763 67.217 1.00 21.67 C
ATOM 7338 CD1 LEU C 97 15.288 118.101 65.963 1.00 20.28 C
ATOM 7339 CD2 LEU C 97 13.134 117.237 66.822 1.00 18.97 C
ATOM 7340 N HIS C 98 16.364 115.621 70.955 1.00 21.96 N
ATOM 7341 CA HIS C 98 17.227 114.690 71.702 1.00 20.97 C
ATOM 7342 C HIS C 98 16.321 113.903 72.647 1.00 20.55 C
ATOM 7343 O HIS C 98 16.438 112.675 72.762 1.00 21.50 O
ATOM 7344 CB HIS C 98 18.307 115.490 72.471 1.00 23.66 C
ATOM 7345 CG HIS C 98 19.354 114.664 73.192 1.00 25.12 C
ATOM 7346 ND1 HIS C 98 20.309 113.911 72.536 1.00 24.85 N
ATOM 7347 CD2 HIS C 98 19.694 114.616 74.506 1.00 24.67 C
ATOM 7348 CE1 HIS C 98 21.193 113.451 73.408 1.00 23.47 C
ATOM 7349 NE2 HIS C 98 20.850 113.866 74.619 1.00 25.41 N
ATOM 7350 N ILE C 99 15.391 114.606 73.289 1.00 19.78 N
ATOM 7351 CA ILE C 99 14.456 113.977 74.227 1.00 18.59 C
ATOM 7352 C ILE C 99 13.507 113.045 73.480 1.00 19.09 C
ATOM 7353 O ILE C 99 13.266 111.899 73.904 1.00 16.96 O
ATOM 7354 CB ILE C 99 13.655 115.046 74.991 1.00 18.61 C
ATOM 7355 CG1 ILE C 99 14.605 115.881 75.850 1.00 18.25 C
ATOM 7356 CG2 ILE C 99 12.659 114.409 75.910 1.00 16.27 C
ATOM 7357 CD1 ILE C 99 13.938 117.070 76.481 1.00 18.67 C
ATOM 7358 N GLY C 100 12.992 113.541 72.355 1.00 20.17 N
ATOM 7359 CA GLY C 100 12.088 112.763 71.516 1.00 22.38 C
ATOM 7360 C GLY C 100 12.697 111.431 71.135 1.00 23.45 C
ATOM 7361 O GLY C 100 12.070 110.381 71.295 1.00 24.49 O
ATOM 7362 N ARG C 101 13.920 111.485 70.613 1.00 24.62 N
ATOM 7363 CA ARG C 101 14.678 110.291 70.258 1.00 24.86 C
ATOM 7364 C ARG C 101 14.752 109.403 71.504 1.00 25.36 C
ATOM 7365 O ARG C 101 14.536 108.198 71.430 1.00 27.79 O
ATOM 7366 CB ARG C 101 16.102 110.690 69.828 1.00 24.94 C
ATOM 7367 CG ARG C 101 17.082 109.541 69.569 1.00 27.02 C
ATOM 7368 CD ARG C 101 17.477 108.770 70.840 1.00 31.70 C
ATOM 7369 NE ARG C 101 18.187 109.610 71.805 1.00 36.21 N
ATOM 7370 CZ ARG C 101 19.467 109.952 71.697 1.00 37.46 C
ATOM 7371 NH1 ARG C 101 20.179 109.522 70.662 1.00 41.18 N
ATOM 7372 NH2 ARG C 101 20.036 110.719 72.616 1.00 36.16 N
ATOM 7373 N GLY C 102 15.054 110.001 72.648 1.00 24.04 N
ATOM 7374 CA GLY C 102 15.173 109.213 73.858 1.00 27.07 C
ATOM 7375 C GLY C 102 13.947 108.415 74.246 1.00 28.41 C
ATOM 7376 O GLY C 102 14.040 107.224 74.612 1.00 26.71 O
ATOM 7377 N LEU C 103 12.793 109.080 74.176 1.00 29.22 N
ATOM 7378 CA LEU C 103 11.522 108.456 74.523 1.00 29.02 C
ATOM 7379 C LEU C 103 11.161 107.369 73.525 1.00 30.39 C
ATOM 7380 O LEU C 103 10.748 106.270 73.895 1.00 32.36 O
ATOM 7381 CB LEU C 103 10.429 109.513 74.550 1.00 28.29 C
ATOM 7382 CG LEU C 103 8.980 109.040 74.646 1.00 29.82 C
ATOM 7383 CD1 LEU C 103 8.738 108.320 75.956 1.00 29.21 C
ATOM 7384 CD2 LEU C 103 8.057 110.244 74.525 1.00 28.91 C
ATOM 7385 N TYR C 104 11.339 107.673 72.248 1.00 30.41 N
ATOM 7386 CA TYR C 104 11.004 106.727 71.196 1.00 29.80 C
ATOM 7387 C TYR C 104 11.833 105.456 71.231 1.00 30.09 C
ATOM 7388 O TYR C 104 11.310 104.347 71.068 1.00 30.47 O
ATOM 7389 CB TYR C 104 11.195 107.386 69.842 1.00 30.22 C
ATOM 7390 CG TYR C 104 10.581 106.629 68.695 1.00 30.78 C
ATOM 7391 CD1 TYR C 104 9.236 106.796 68.367 1.00 32.17 C
ATOM 7392 CD2 TYR C 104 11.345 105.761 67.924 1.00 30.82 C
ATOM 7393 CE1 TYR C 104 8.665 106.118 67.295 1.00 32.59 C
ATOM 7394 CE2 TYR C 104 10.788 105.080 66.849 1.00 33.74 C
ATOM 7395 CZ TYR C 104 9.449 105.259 66.536 1.00 34.10 C
ATOM 7396 OH TYR C 104 8.898 104.576 65.468 1.00 35.39 O
ATOM 7397 N TYR C 105 13.134 105.609 71.418 1.00 28.18 N
ATOM 7398 CA TYR C 105 13.998 104.445 71.420 1.00 27.32 C
ATOM 7399 C TYR C 105 14.285 103.849 72.791 1.00 26.93 C
ATOM 7400 O TYR C 105 15.143 102.985 72.925 1.00 27.52 O
ATOM 7401 CB TYR C 105 15.287 104.776 70.684 1.00 22.88 C
ATOM 7402 CG TYR C 105 15.021 105.085 69.242 1.00 23.65 C
ATOM 7403 CD1 TYR C 105 14.924 106.414 68.786 1.00 25.27 C
ATOM 7404 CD2 TYR C 105 14.846 104.051 68.314 1.00 22.05 C
ATOM 7405 CE1 TYR C 105 14.668 106.703 67.416 1.00 23.74 C
ATOM 7406 CE2 TYR C 105 14.583 104.315 66.961 1.00 21.33 C
ATOM 7407 CZ TYR C 105 14.501 105.636 66.511 1.00 24.62 C
ATOM 7408 OH TYR C 105 14.303 105.872 65.161 1.00 24.30 O
ATOM 7409 N GLY C 106 13.564 104.312 73.803 1.00 25.58 N
ATOM 7410 CA GLY C 106 13.756 103.776 75.133 1.00 24.35 C
ATOM 7411 C GLY C 106 15.159 103.999 75.654 1.00 25.47 C
ATOM 7412 O GLY C 106 15.694 103.157 76.381 1.00 22.75 O
ATOM 7413 N SER C 107 15.761 105.126 75.276 1.00 24.98 N
ATOM 7414 CA SER C 107 17.097 105.452 75.734 1.00 26.44 C
ATOM 7415 C SER C 107 17.051 105.673 77.237 1.00 27.69 C
ATOM 7416 O SER C 107 18.065 105.539 77.935 1.00 27.42 O
ATOM 7417 CB SER C 107 17.589 106.719 75.067 1.00 25.98 C
ATOM 7418 OG SER C 107 17.619 106.537 73.682 1.00 32.31 O
ATOM 7419 N TYR C 108 15.861 106.001 77.732 1.00 28.04 N
ATOM 7420 CA TYR C 108 15.676 106.258 79.148 1.00 28.96 C
ATOM 7421 C TYR C 108 15.923 105.062 80.036 1.00 28.65 C
ATOM 7422 O TYR C 108 15.966 105.215 81.250 1.00 30.82 O
ATOM 7423 CB TYR C 108 14.278 106.801 79.419 1.00 28.73 C
ATOM 7424 CG TYR C 108 13.187 105.962 78.840 1.00 27.70 C
ATOM 7425 CD1 TYR C 108 12.834 104.747 79.421 1.00 25.77 C
ATOM 7426 CD2 TYR C 108 12.505 106.390 77.698 1.00 29.69 C
ATOM 7427 CE1 TYR C 108 11.819 103.971 78.882 1.00 30.23 C
ATOM 7428 CE2 TYR C 108 11.488 105.631 77.143 1.00 31.87 C
ATOM 7429 CZ TYR C 108 11.140 104.425 77.735 1.00 32.64 C
ATOM 7430 OH TYR C 108 10.081 103.721 77.198 1.00 34.48 O
ATOM 7431 N LEU C 109 16.064 103.874 79.457 1.00 28.07 N
ATOM 7432 CA LEU C 109 16.330 102.717 80.293 1.00 28.19 C
ATOM 7433 C LEU C 109 17.749 102.835 80.867 1.00 29.84 C
ATOM 7434 O LEU C 109 18.143 102.059 81.737 1.00 30.36 O
ATOM 7435 CB LEU C 109 16.138 101.414 79.522 1.00 26.25 C
ATOM 7436 CG LEU C 109 14.672 101.076 79.227 1.00 26.15 C
ATOM 7437 CD1 LEU C 109 14.564 99.590 78.831 1.00 25.25 C
ATOM 7438 CD2 LEU C 109 13.812 101.345 80.444 1.00 24.44 C
ATOM 7439 N TYR C 110 18.517 103.801 80.359 1.00 28.85 N
ATOM 7440 CA TYR C 110 19.836 104.083 80.900 1.00 28.47 C
ATOM 7441 C TYR C 110 19.485 105.164 81.909 1.00 30.68 C
ATOM 7442 O TYR C 110 19.738 106.345 81.671 1.00 33.33 O
ATOM 7443 CB TYR C 110 20.751 104.704 79.860 1.00 28.01 C
ATOM 7444 CG TYR C 110 21.221 103.768 78.781 1.00 27.58 C
ATOM 7445 CD1 TYR C 110 21.390 102.417 79.037 1.00 24.58 C
ATOM 7446 CD2 TYR C 110 21.562 104.251 77.519 1.00 26.12 C
ATOM 7447 CE1 TYR C 110 21.875 101.569 78.072 1.00 25.72 C
ATOM 7448 CE2 TYR C 110 22.061 103.416 76.546 1.00 27.44 C
ATOM 7449 CZ TYR C 110 22.207 102.070 76.823 1.00 28.19 C
ATOM 7450 OH TYR C 110 22.606 101.209 75.827 1.00 27.73 O
ATOM 7451 N LYS C 111 18.882 104.762 83.021 1.00 31.19 N
ATOM 7452 CA LYS C 111 18.430 105.693 84.048 1.00 33.29 C
ATOM 7453 C LYS C 111 19.310 106.869 84.506 1.00 32.55 C
ATOM 7454 O LYS C 111 18.802 107.984 84.682 1.00 30.90 O
ATOM 7455 CB LYS C 111 17.972 104.899 85.266 1.00 36.94 C
ATOM 7456 CG LYS C 111 16.731 104.060 85.025 1.00 40.38 C
ATOM 7457 CD LYS C 111 16.295 103.404 86.326 1.00 47.09 C
ATOM 7458 CE LYS C 111 14.867 102.858 86.241 1.00 53.32 C
ATOM 7459 NZ LYS C 111 14.671 101.894 85.094 1.00 57.64 N
ATOM 7460 N GLU C 112 20.607 106.656 84.702 1.00 32.51 N
ATOM 7461 CA GLU C 112 21.451 107.763 85.156 1.00 33.62 C
ATOM 7462 C GLU C 112 21.720 108.746 84.055 1.00 32.64 C
ATOM 7463 O GLU C 112 21.791 109.962 84.287 1.00 32.44 O
ATOM 7464 CB GLU C 112 22.777 107.267 85.725 1.00 37.34 C
ATOM 7465 CG GLU C 112 22.612 106.421 86.975 1.00 46.56 C
ATOM 7466 CD GLU C 112 22.694 104.921 86.697 1.00 53.70 C
ATOM 7467 OE1 GLU C 112 22.051 104.441 85.715 1.00 54.80 O
ATOM 7468 OE2 GLU C 112 23.408 104.231 87.479 1.00 57.89 O
ATOM 7469 N THR C 113 21.877 108.225 82.846 1.00 31.66 N
ATOM 7470 CA THR C 113 22.117 109.095 81.714 1.00 30.62 C
ATOM 7471 C THR C 113 20.847 109.905 81.518 1.00 30.29 C
ATOM 7472 O THR C 113 20.893 111.107 81.266 1.00 31.19 O
ATOM 7473 CB THR C 113 22.435 108.298 80.455 1.00 30.89 C
ATOM 7474 OG1 THR C 113 23.623 107.530 80.675 1.00 30.13 O
ATOM 7475 CG2 THR C 113 22.662 109.236 79.282 1.00 30.96 C
ATOM 7476 N TRP C 114 19.704 109.251 81.659 1.00 29.06 N
ATOM 7477 CA TRP C 114 18.442 109.953 81.508 1.00 27.60 C
ATOM 7478 C TRP C 114 18.257 111.009 82.594 1.00 28.33 C
ATOM 7479 O TRP C 114 18.056 112.176 82.289 1.00 29.39 O
ATOM 7480 CB TRP C 114 17.289 108.953 81.523 1.00 25.97 C
ATOM 7481 CG TRP C 114 15.935 109.562 81.335 1.00 25.50 C
ATOM 7482 CD1 TRP C 114 15.044 109.894 82.315 1.00 25.33 C
ATOM 7483 CD2 TRP C 114 15.305 109.902 80.090 1.00 27.19 C
ATOM 7484 NE1 TRP C 114 13.900 110.414 81.762 1.00 25.49 N
ATOM 7485 CE2 TRP C 114 14.033 110.435 80.397 1.00 26.35 C
ATOM 7486 CE3 TRP C 114 15.692 109.809 78.742 1.00 29.25 C
ATOM 7487 CZ2 TRP C 114 13.142 110.878 79.407 1.00 25.86 C
ATOM 7488 CZ3 TRP C 114 14.801 110.249 77.756 1.00 28.38 C
ATOM 7489 CH2 TRP C 114 13.541 110.776 78.099 1.00 26.08 C
ATOM 7490 N ASN C 115 18.338 110.619 83.863 1.00 29.54 N
ATOM 7491 CA ASN C 115 18.138 111.583 84.945 1.00 29.47 C
ATOM 7492 C ASN C 115 19.038 112.805 84.873 1.00 29.51 C
ATOM 7493 O ASN C 115 18.573 113.944 85.058 1.00 30.77 O
ATOM 7494 CB ASN C 115 18.283 110.909 86.304 1.00 30.51 C
ATOM 7495 CG ASN C 115 17.126 109.972 86.608 1.00 32.83 C
ATOM 7496 OD1 ASN C 115 16.017 110.145 86.104 1.00 34.17 O
ATOM 7497 ND2 ASN C 115 17.378 108.980 87.439 1.00 35.89 N
ATOM 7498 N THR C 116 20.322 112.597 84.616 1.00 28.03 N
ATOM 7499 CA THR C 116 21.204 113.750 84.500 1.00 27.87 C
ATOM 7500 C THR C 116 20.730 114.550 83.280 1.00 27.86 C
ATOM 7501 O THR C 116 20.865 115.780 83.215 1.00 28.33 O
ATOM 7502 CB THR C 116 22.667 113.326 84.301 1.00 27.41 C
ATOM 7503 OG1 THR C 116 22.753 112.358 83.255 1.00 27.76 O
ATOM 7504 CG2 THR C 116 23.202 112.717 85.541 1.00 26.82 C
ATOM 7505 N GLY C 117 20.176 113.830 82.309 1.00 27.10 N
ATOM 7506 CA GLY C 117 19.669 114.468 81.116 1.00 24.57 C
ATOM 7507 C GLY C 117 18.584 115.436 81.527 1.00 24.96 C
ATOM 7508 O GLY C 117 18.542 116.563 81.038 1.00 26.86 O
ATOM 7509 N VAL C 118 17.701 115.024 82.434 1.00 25.07 N
ATOM 7510 CA VAL C 118 16.644 115.934 82.876 1.00 25.11 C
ATOM 7511 C VAL C 118 17.240 117.103 83.662 1.00 27.42 C
ATOM 7512 O VAL C 118 16.770 118.238 83.541 1.00 29.71 O
ATOM 7513 CB VAL C 118 15.582 115.223 83.737 1.00 23.84 C
ATOM 7514 CG1 VAL C 118 14.424 116.172 84.024 1.00 19.61 C
ATOM 7515 CG2 VAL C 118 15.088 113.969 83.018 1.00 21.49 C
ATOM 7516 N ILE C 119 18.267 116.848 84.470 1.00 26.88 N
ATOM 7517 CA ILE C 119 18.884 117.955 85.206 1.00 25.68 C
ATOM 7518 C ILE C 119 19.404 118.963 84.160 1.00 25.32 C
ATOM 7519 O ILE C 119 19.254 120.185 84.305 1.00 24.32 O
ATOM 7520 CB ILE C 119 20.086 117.479 86.088 1.00 27.29 C
ATOM 7521 CG1 ILE C 119 19.619 116.512 87.174 1.00 26.80 C
ATOM 7522 CG2 ILE C 119 20.765 118.668 86.735 1.00 25.26 C
ATOM 7523 CD1 ILE C 119 18.528 117.076 88.042 1.00 29.73 C
ATOM 7524 N LEU C 120 20.016 118.449 83.099 1.00 23.88 N
ATOM 7525 CA LEU C 120 20.529 119.333 82.062 1.00 24.13 C
ATOM 7526 C LEU C 120 19.414 120.207 81.488 1.00 25.44 C
ATOM 7527 O LEU C 120 19.588 121.425 81.335 1.00 26.44 O
ATOM 7528 CB LEU C 120 21.206 118.522 80.956 1.00 22.36 C
ATOM 7529 CG LEU C 120 22.621 118.017 81.283 1.00 20.45 C
ATOM 7530 CD1 LEU C 120 22.953 116.856 80.410 1.00 16.38 C
ATOM 7531 CD2 LEU C 120 23.642 119.137 81.093 1.00 18.19 C
ATOM 7532 N LEU C 121 18.261 119.603 81.198 1.00 24.77 N
ATOM 7533 CA LEU C 121 17.131 120.364 80.659 1.00 24.19 C
ATOM 7534 C LEU C 121 16.782 121.491 81.622 1.00 24.34 C
ATOM 7535 O LEU C 121 16.799 122.661 81.254 1.00 25.32 O
ATOM 7536 CB LEU C 121 15.917 119.456 80.467 1.00 23.68 C
ATOM 7537 CG LEU C 121 14.607 120.097 79.983 1.00 22.84 C
ATOM 7538 CD1 LEU C 121 14.840 120.833 78.685 1.00 19.73 C
ATOM 7539 CD2 LEU C 121 13.547 119.004 79.790 1.00 20.65 C
ATOM 7540 N LEU C 122 16.469 121.129 82.855 1.00 24.44 N
ATOM 7541 CA LEU C 122 16.152 122.100 83.897 1.00 25.41 C
ATOM 7542 C LEU C 122 17.175 123.234 83.983 1.00 25.07 C
ATOM 7543 O LEU C 122 16.812 124.420 84.051 1.00 24.45 O
ATOM 7544 CB LEU C 122 16.087 121.395 85.249 1.00 26.72 C
ATOM 7545 CG LEU C 122 14.890 120.458 85.372 1.00 28.36 C
ATOM 7546 CD1 LEU C 122 14.979 119.701 86.660 1.00 30.01 C
ATOM 7547 CD2 LEU C 122 13.607 121.277 85.318 1.00 27.17 C
ATOM 7548 N THR C 123 18.458 122.886 83.985 1.00 24.21 N
ATOM 7549 CA THR C 123 19.484 123.923 84.071 1.00 23.78 C
ATOM 7550 C THR C 123 19.459 124.805 82.834 1.00 24.19 C
ATOM 7551 O THR C 123 19.595 126.026 82.939 1.00 23.76 O
ATOM 7552 CB THR C 123 20.874 123.304 84.261 1.00 23.97 C
ATOM 7553 OG1 THR C 123 20.857 122.527 85.453 1.00 24.85 O
ATOM 7554 CG2 THR C 123 21.949 124.361 84.415 1.00 22.17 C
ATOM 7555 N LEU C 124 19.280 124.201 81.660 1.00 24.41 N
ATOM 7556 CA LEU C 124 19.218 125.005 80.443 1.00 23.94 C
ATOM 7557 C LEU C 124 18.049 125.984 80.540 1.00 23.09 C
ATOM 7558 O LEU C 124 18.146 127.127 80.119 1.00 21.56 O
ATOM 7559 CB LEU C 124 19.050 124.125 79.206 1.00 23.05 C
ATOM 7560 CG LEU C 124 18.785 124.925 77.928 1.00 24.42 C
ATOM 7561 CD1 LEU C 124 20.013 125.786 77.558 1.00 25.50 C
ATOM 7562 CD2 LEU C 124 18.444 123.977 76.813 1.00 24.16 C
ATOM 7563 N MET C 125 16.943 125.532 81.116 1.00 25.22 N
ATOM 7564 CA MET C 125 15.767 126.385 81.252 1.00 27.44 C
ATOM 7565 C MET C 125 16.070 127.586 82.119 1.00 27.04 C
ATOM 7566 O MET C 125 15.789 128.726 81.749 1.00 27.63 O
ATOM 7567 CB MET C 125 14.609 125.590 81.841 1.00 30.43 C
ATOM 7568 CG MET C 125 14.087 124.534 80.885 1.00 36.03 C
ATOM 7569 SD MET C 125 12.783 123.530 81.628 1.00 46.29 S
ATOM 7570 CE MET C 125 11.241 124.665 81.312 1.00 48.97 C
ATOM 7571 N ALA C 126 16.659 127.337 83.277 1.00 27.18 N
ATOM 7572 CA ALA C 126 16.998 128.431 84.173 1.00 26.05 C
ATOM 7573 C ALA C 126 17.900 129.408 83.444 1.00 26.82 C
ATOM 7574 O ALA C 126 17.688 130.620 83.490 1.00 28.44 O
ATOM 7575 CB ALA C 126 17.706 127.896 85.391 1.00 23.58 C
ATOM 7576 N THR C 127 18.898 128.867 82.752 1.00 25.27 N
ATOM 7577 CA THR C 127 19.860 129.685 82.041 1.00 24.79 C
ATOM 7578 C THR C 127 19.185 130.605 81.030 1.00 25.13 C
ATOM 7579 O THR C 127 19.407 131.827 81.031 1.00 23.03 O
ATOM 7580 CB THR C 127 20.913 128.797 81.317 1.00 26.53 C
ATOM 7581 OG1 THR C 127 21.627 127.994 82.280 1.00 24.76 O
ATOM 7582 CG2 THR C 127 21.890 129.659 80.537 1.00 22.21 C
ATOM 7583 N ALA C 128 18.367 130.015 80.166 1.00 24.52 N
ATOM 7584 CA ALA C 128 17.659 130.781 79.141 1.00 25.55 C
ATOM 7585 C ALA C 128 16.793 131.862 79.800 1.00 26.24 C
ATOM 7586 O ALA C 128 16.712 133.010 79.320 1.00 24.11 O
ATOM 7587 CB ALA C 128 16.787 129.851 78.301 1.00 24.65 C
ATOM 7588 N PHE C 129 16.147 131.498 80.902 1.00 25.00 N
ATOM 7589 CA PHE C 129 15.314 132.462 81.585 1.00 26.46 C
ATOM 7590 C PHE C 129 16.113 133.668 82.088 1.00 25.70 C
ATOM 7591 O PHE C 129 15.846 134.795 81.682 1.00 26.72 O
ATOM 7592 CB PHE C 129 14.568 131.799 82.750 1.00 27.78 C
ATOM 7593 CG PHE C 129 13.876 132.779 83.660 1.00 29.61 C
ATOM 7594 CD1 PHE C 129 12.994 133.736 83.143 1.00 29.54 C
ATOM 7595 CD2 PHE C 129 14.134 132.774 85.031 1.00 27.77 C
ATOM 7596 CE1 PHE C 129 12.385 134.680 83.985 1.00 30.52 C
ATOM 7597 CE2 PHE C 129 13.526 133.709 85.871 1.00 29.79 C
ATOM 7598 CZ PHE C 129 12.651 134.666 85.348 1.00 28.83 C
ATOM 7599 N VAL C 130 17.092 133.454 82.960 1.00 25.04 N
ATOM 7600 CA VAL C 130 17.848 134.601 83.478 1.00 26.00 C
ATOM 7601 C VAL C 130 18.530 135.381 82.364 1.00 25.58 C
ATOM 7602 O VAL C 130 18.708 136.596 82.468 1.00 26.06 O
ATOM 7603 CB VAL C 130 18.915 134.191 84.578 1.00 25.69 C
ATOM 7604 CG1 VAL C 130 18.206 133.681 85.814 1.00 22.73 C
ATOM 7605 CG2 VAL C 130 19.872 133.134 84.055 1.00 23.76 C
ATOM 7606 N GLY C 131 18.892 134.680 81.295 1.00 25.92 N
ATOM 7607 CA GLY C 131 19.549 135.324 80.173 1.00 26.41 C
ATOM 7608 C GLY C 131 18.605 136.233 79.422 1.00 27.06 C
ATOM 7609 O GLY C 131 18.956 137.364 79.077 1.00 26.25 O
ATOM 7610 N TYR C 132 17.396 135.731 79.179 1.00 28.49 N
ATOM 7611 CA TYR C 132 16.364 136.477 78.463 1.00 27.47 C
ATOM 7612 C TYR C 132 16.006 137.791 79.146 1.00 26.64 C
ATOM 7613 O TYR C 132 15.607 138.749 78.479 1.00 26.42 O
ATOM 7614 CB TYR C 132 15.092 135.650 78.330 1.00 27.19 C
ATOM 7615 CG TYR C 132 14.064 136.345 77.483 1.00 28.18 C
ATOM 7616 CD1 TYR C 132 14.282 136.516 76.120 1.00 29.06 C
ATOM 7617 CD2 TYR C 132 12.882 136.843 78.030 1.00 26.70 C
ATOM 7618 CE1 TYR C 132 13.370 137.154 75.322 1.00 27.62 C
ATOM 7619 CE2 TYR C 132 11.946 137.493 77.234 1.00 28.00 C
ATOM 7620 CZ TYR C 132 12.205 137.647 75.869 1.00 30.95 C
ATOM 7621 OH TYR C 132 11.340 138.333 75.027 1.00 35.32 O
ATOM 7622 N VAL C 133 16.157 137.833 80.465 1.00 24.90 N
ATOM 7623 CA VAL C 133 15.835 139.032 81.234 1.00 25.99 C
ATOM 7624 C VAL C 133 16.839 140.180 81.113 1.00 27.09 C
ATOM 7625 O VAL C 133 16.476 141.341 81.296 1.00 27.58 O
ATOM 7626 CB VAL C 133 15.702 138.690 82.736 1.00 25.40 C
ATOM 7627 CG1 VAL C 133 15.419 139.951 83.543 1.00 23.24 C
ATOM 7628 CG2 VAL C 133 14.598 137.649 82.928 1.00 26.05 C
ATOM 7629 N LEU C 134 18.089 139.858 80.781 1.00 27.61 N
ATOM 7630 CA LEU C 134 19.166 140.851 80.722 1.00 26.86 C
ATOM 7631 C LEU C 134 18.998 142.074 79.834 1.00 28.32 C
ATOM 7632 O LEU C 134 19.317 143.179 80.245 1.00 29.11 O
ATOM 7633 CB LEU C 134 20.498 140.155 80.393 1.00 26.43 C
ATOM 7634 CG LEU C 134 20.958 138.976 81.286 1.00 23.99 C
ATOM 7635 CD1 LEU C 134 22.290 138.448 80.783 1.00 22.33 C
ATOM 7636 CD2 LEU C 134 21.101 139.403 82.716 1.00 20.86 C
ATOM 7637 N PRO C 135 18.518 141.900 78.594 1.00 31.19 N
ATOM 7638 CA PRO C 135 18.351 143.078 77.727 1.00 29.27 C
ATOM 7639 C PRO C 135 17.404 144.089 78.329 1.00 28.12 C
ATOM 7640 O PRO C 135 17.408 145.263 77.963 1.00 29.58 O
ATOM 7641 CB PRO C 135 17.862 142.480 76.411 1.00 30.21 C
ATOM 7642 CG PRO C 135 17.283 141.145 76.825 1.00 32.04 C
ATOM 7643 CD PRO C 135 18.218 140.656 77.865 1.00 30.65 C
ATOM 7644 N TRP C 136 16.563 143.624 79.242 1.00 27.50 N
ATOM 7645 CA TRP C 136 15.677 144.524 79.965 1.00 26.19 C
ATOM 7646 C TRP C 136 14.678 145.325 79.115 1.00 26.54 C
ATOM 7647 O TRP C 136 14.503 146.539 79.301 1.00 23.22 O
ATOM 7648 CB TRP C 136 16.542 145.473 80.808 1.00 23.14 C
ATOM 7649 CG TRP C 136 15.925 145.960 82.073 1.00 22.01 C
ATOM 7650 CD1 TRP C 136 15.593 147.248 82.372 1.00 19.47 C
ATOM 7651 CD2 TRP C 136 15.559 145.176 83.218 1.00 21.26 C
ATOM 7652 NE1 TRP C 136 15.036 147.320 83.626 1.00 20.38 N
ATOM 7653 CE2 TRP C 136 14.998 146.064 84.172 1.00 21.25 C
ATOM 7654 CE3 TRP C 136 15.649 143.822 83.531 1.00 22.28 C
ATOM 7655 CZ2 TRP C 136 14.524 145.635 85.420 1.00 19.22 C
ATOM 7656 CZ3 TRP C 136 15.175 143.391 84.784 1.00 24.70 C
ATOM 7657 CH2 TRP C 136 14.618 144.300 85.708 1.00 21.79 C
ATOM 7658 N GLY C 137 14.037 144.630 78.176 1.00 26.67 N
ATOM 7659 CA GLY C 137 12.996 145.241 77.377 1.00 25.04 C
ATOM 7660 C GLY C 137 11.693 144.964 78.133 1.00 27.25 C
ATOM 7661 O GLY C 137 11.709 144.478 79.271 1.00 28.89 O
ATOM 7662 N GLN C 138 10.555 145.255 77.519 1.00 28.36 N
ATOM 7663 CA GLN C 138 9.264 145.033 78.165 1.00 27.08 C
ATOM 7664 C GLN C 138 9.014 143.572 78.421 1.00 28.27 C
ATOM 7665 O GLN C 138 8.540 143.191 79.500 1.00 29.54 O
ATOM 7666 CB GLN C 138 8.136 145.596 77.305 1.00 24.54 C
ATOM 7667 CG GLN C 138 7.826 147.035 77.614 1.00 28.19 C
ATOM 7668 CD GLN C 138 7.139 147.176 78.952 1.00 28.86 C
ATOM 7669 OE1 GLN C 138 7.655 146.741 79.985 1.00 31.59 O
ATOM 7670 NE2 GLN C 138 5.961 147.770 78.943 1.00 27.45 N
ATOM 7671 N MET C 139 9.342 142.744 77.439 1.00 28.24 N
ATOM 7672 CA MET C 139 9.101 141.324 77.580 1.00 30.40 C
ATOM 7673 C MET C 139 10.053 140.702 78.603 1.00 30.04 C
ATOM 7674 O MET C 139 9.673 139.814 79.362 1.00 27.41 O
ATOM 7675 CB MET C 139 9.204 140.637 76.212 1.00 32.81 C
ATOM 7676 CG MET C 139 8.309 139.417 76.112 1.00 38.27 C
ATOM 7677 SD MET C 139 6.665 139.739 76.861 1.00 44.03 S
ATOM 7678 CE MET C 139 5.760 140.212 75.393 1.00 42.62 C
ATOM 7679 N SER C 140 11.289 141.187 78.633 1.00 32.16 N
ATOM 7680 CA SER C 140 12.278 140.704 79.596 1.00 32.43 C
ATOM 7681 C SER C 140 11.743 140.955 81.011 1.00 31.68 C
ATOM 7682 O SER C 140 11.747 140.080 81.880 1.00 29.99 O
ATOM 7683 CB SER C 140 13.597 141.465 79.420 1.00 33.29 C
ATOM 7684 OG SER C 140 14.193 141.170 78.172 1.00 37.97 O
ATOM 7685 N PHE C 141 11.263 142.171 81.221 1.00 31.46 N
ATOM 7686 CA PHE C 141 10.748 142.557 82.516 1.00 31.81 C
ATOM 7687 C PHE C 141 9.502 141.813 82.964 1.00 31.71 C
ATOM 7688 O PHE C 141 9.474 141.227 84.043 1.00 31.22 O
ATOM 7689 CB PHE C 141 10.450 144.042 82.541 1.00 29.51 C
ATOM 7690 CG PHE C 141 10.005 144.518 83.866 1.00 31.35 C
ATOM 7691 CD1 PHE C 141 10.936 144.881 84.831 1.00 33.87 C
ATOM 7692 CD2 PHE C 141 8.650 144.568 84.182 1.00 31.83 C
ATOM 7693 CE1 PHE C 141 10.521 145.290 86.105 1.00 32.83 C
ATOM 7694 CE2 PHE C 141 8.234 144.972 85.440 1.00 32.06 C
ATOM 7695 CZ PHE C 141 9.176 145.334 86.404 1.00 32.06 C
ATOM 7696 N TRP C 142 8.465 141.836 82.143 1.00 31.80 N
ATOM 7697 CA TRP C 142 7.233 141.185 82.538 1.00 31.90 C
ATOM 7698 C TRP C 142 7.319 139.669 82.601 1.00 31.15 C
ATOM 7699 O TRP C 142 6.683 139.050 83.453 1.00 30.61 O
ATOM 7700 CB TRP C 142 6.098 141.679 81.642 1.00 34.27 C
ATOM 7701 CG TRP C 142 5.839 143.157 81.899 1.00 36.59 C
ATOM 7702 CD1 TRP C 142 6.281 144.221 81.153 1.00 35.22 C
ATOM 7703 CD2 TRP C 142 5.247 143.721 83.079 1.00 35.62 C
ATOM 7704 NE1 TRP C 142 6.013 145.400 81.804 1.00 34.36 N
ATOM 7705 CE2 TRP C 142 5.380 145.122 82.988 1.00 35.62 C
ATOM 7706 CE3 TRP C 142 4.626 143.173 84.212 1.00 36.51 C
ATOM 7707 CZ2 TRP C 142 4.915 145.985 83.990 1.00 36.22 C
ATOM 7708 CZ3 TRP C 142 4.167 144.034 85.211 1.00 34.65 C
ATOM 7709 CH2 TRP C 142 4.317 145.420 85.091 1.00 34.14 C
ATOM 7710 N GLY C 143 8.121 139.071 81.720 1.00 29.97 N
ATOM 7711 CA GLY C 143 8.299 137.630 81.757 1.00 28.35 C
ATOM 7712 C GLY C 143 8.983 137.284 83.072 1.00 28.11 C
ATOM 7713 O GLY C 143 8.630 136.303 83.751 1.00 25.32 O
ATOM 7714 N ALA C 144 9.967 138.114 83.431 1.00 27.90 N
ATOM 7715 CA ALA C 144 10.697 137.956 84.676 1.00 27.80 C
ATOM 7716 C ALA C 144 9.700 138.093 85.824 1.00 28.90 C
ATOM 7717 O ALA C 144 9.823 137.413 86.830 1.00 30.27 O
ATOM 7718 CB ALA C 144 11.770 139.017 84.790 1.00 26.74 C
ATOM 7719 N THR C 145 8.713 138.977 85.674 1.00 30.16 N
ATOM 7720 CA THR C 145 7.678 139.168 86.705 1.00 29.53 C
ATOM 7721 C THR C 145 6.759 137.937 86.813 1.00 29.00 C
ATOM 7722 O THR C 145 6.545 137.398 87.911 1.00 28.93 O
ATOM 7723 CB THR C 145 6.803 140.408 86.405 1.00 28.64 C
ATOM 7724 OG1 THR C 145 7.592 141.590 86.533 1.00 29.79 O
ATOM 7725 CG2 THR C 145 5.661 140.499 87.370 1.00 27.17 C
ATOM 7726 N VAL C 146 6.229 137.488 85.678 1.00 26.73 N
ATOM 7727 CA VAL C 146 5.347 136.328 85.680 1.00 28.09 C
ATOM 7728 C VAL C 146 6.060 135.099 86.227 1.00 28.86 C
ATOM 7729 O VAL C 146 5.578 134.475 87.154 1.00 30.13 O
ATOM 7730 CB VAL C 146 4.815 136.001 84.254 1.00 28.32 C
ATOM 7731 CG1 VAL C 146 3.962 134.766 84.286 1.00 27.18 C
ATOM 7732 CG2 VAL C 146 4.002 137.149 83.720 1.00 26.65 C
ATOM 7733 N ILE C 147 7.210 134.754 85.657 1.00 29.30 N
ATOM 7734 CA ILE C 147 7.949 133.585 86.112 1.00 28.94 C
ATOM 7735 C ILE C 147 8.302 133.636 87.595 1.00 30.54 C
ATOM 7736 O ILE C 147 7.993 132.707 88.329 1.00 30.04 O
ATOM 7737 CB ILE C 147 9.254 133.392 85.299 1.00 29.34 C
ATOM 7738 CG1 ILE C 147 8.914 133.110 83.833 1.00 29.81 C
ATOM 7739 CG2 ILE C 147 10.098 132.263 85.891 1.00 26.15 C
ATOM 7740 CD1 ILE C 147 8.017 131.915 83.612 1.00 24.26 C
ATOM 7741 N THR C 148 8.953 134.701 88.055 1.00 32.48 N
ATOM 7742 CA THR C 148 9.298 134.750 89.474 1.00 35.37 C
ATOM 7743 C THR C 148 8.048 134.656 90.356 1.00 38.02 C
ATOM 7744 O THR C 148 8.059 133.977 91.379 1.00 38.71 O
ATOM 7745 CB THR C 148 10.090 136.021 89.856 1.00 34.03 C
ATOM 7746 OG1 THR C 148 9.407 137.182 89.372 1.00 34.88 O
ATOM 7747 CG2 THR C 148 11.501 135.959 89.293 1.00 32.12 C
ATOM 7748 N ASN C 149 6.962 135.309 89.966 1.00 39.60 N
ATOM 7749 CA ASN C 149 5.760 135.225 90.779 1.00 42.55 C
ATOM 7750 C ASN C 149 5.143 133.834 90.804 1.00 44.45 C
ATOM 7751 O ASN C 149 4.195 133.574 91.544 1.00 45.06 O
ATOM 7752 CB ASN C 149 4.722 136.227 90.310 1.00 43.28 C
ATOM 7753 CG ASN C 149 4.906 137.573 90.943 1.00 44.57 C
ATOM 7754 OD1 ASN C 149 4.811 137.721 92.164 1.00 46.44 O
ATOM 7755 ND2 ASN C 149 5.177 138.575 90.119 1.00 46.44 N
ATOM 7756 N LEU C 150 5.664 132.928 89.998 1.00 46.31 N
ATOM 7757 CA LEU C 150 5.116 131.591 90.021 1.00 49.58 C
ATOM 7758 C LEU C 150 5.436 130.996 91.396 1.00 51.40 C
ATOM 7759 O LEU C 150 4.588 130.366 92.035 1.00 51.95 O
ATOM 7760 CB LEU C 150 5.741 130.737 88.914 1.00 49.51 C
ATOM 7761 CG LEU C 150 5.348 131.029 87.463 1.00 47.72 C
ATOM 7762 CD1 LEU C 150 6.200 130.151 86.537 1.00 47.60 C
ATOM 7763 CD2 LEU C 150 3.865 130.771 87.260 1.00 43.32 C
ATOM 7764 N PHE C 151 6.662 131.228 91.853 1.00 52.96 N
ATOM 7765 CA PHE C 151 7.113 130.705 93.135 1.00 54.41 C
ATOM 7766 C PHE C 151 6.317 131.210 94.315 1.00 53.72 C
ATOM 7767 O PHE C 151 6.272 130.560 95.360 1.00 54.42 O
ATOM 7768 CB PHE C 151 8.601 131.001 93.317 1.00 57.18 C
ATOM 7769 CG PHE C 151 9.467 130.267 92.335 1.00 61.06 C
ATOM 7770 CD1 PHE C 151 10.091 129.069 92.689 1.00 61.33 C
ATOM 7771 CD2 PHE C 151 9.589 130.727 91.016 1.00 61.91 C
ATOM 7772 CE1 PHE C 151 10.822 128.332 91.736 1.00 61.64 C
ATOM 7773 CE2 PHE C 151 10.315 130.000 90.061 1.00 61.49 C
ATOM 7774 CZ PHE C 151 10.931 128.801 90.422 1.00 60.56 C
ATOM 7775 N SER C 152 5.669 132.354 94.160 1.00 52.47 N
ATOM 7776 CA SER C 152 4.874 132.875 95.260 1.00 52.72 C
ATOM 7777 C SER C 152 3.665 131.967 95.526 1.00 53.15 C
ATOM 7778 O SER C 152 2.990 132.120 96.535 1.00 53.14 O
ATOM 7779 CB SER C 152 4.400 134.290 94.953 1.00 50.28 C
ATOM 7780 OG SER C 152 3.336 134.260 94.029 1.00 52.31 O
ATOM 7781 N ALA C 153 3.396 131.025 94.621 1.00 54.37 N
ATOM 7782 CA ALA C 153 2.268 130.098 94.775 1.00 55.03 C
ATOM 7783 C ALA C 153 2.563 129.003 95.824 1.00 55.78 C
ATOM 7784 O ALA C 153 1.654 128.338 96.332 1.00 54.69 O
ATOM 7785 CB ALA C 153 1.924 129.461 93.421 1.00 54.37 C
ATOM 7786 N ILE C 154 3.839 128.809 96.137 1.00 56.27 N
ATOM 7787 CA ILE C 154 4.210 127.827 97.138 1.00 57.18 C
ATOM 7788 C ILE C 154 3.621 128.325 98.449 1.00 58.68 C
ATOM 7789 O ILE C 154 3.805 129.480 98.819 1.00 58.46 O
ATOM 7790 CB ILE C 154 5.725 127.734 97.283 1.00 56.47 C
ATOM 7791 CG1 ILE C 154 6.345 127.351 95.938 1.00 56.00 C
ATOM 7792 CG2 ILE C 154 6.080 126.717 98.347 1.00 55.50 C
ATOM 7793 CD1 ILE C 154 7.865 127.349 95.940 1.00 56.50 C
ATOM 7794 N PRO C 155 2.893 127.462 99.170 1.00 60.24 N
ATOM 7795 CA PRO C 155 2.293 127.879 100.438 1.00 60.61 C
ATOM 7796 C PRO C 155 3.295 128.173 101.551 1.00 62.03 C
ATOM 7797 O PRO C 155 4.336 127.519 101.655 1.00 61.85 O
ATOM 7798 CB PRO C 155 1.368 126.718 100.767 1.00 60.12 C
ATOM 7799 CG PRO C 155 2.084 125.557 100.183 1.00 59.99 C
ATOM 7800 CD PRO C 155 2.518 126.077 98.846 1.00 60.25 C
ATOM 7801 N TYR C 156 2.967 129.182 102.361 1.00 63.32 N
ATOM 7802 CA TYR C 156 3.779 129.616 103.502 1.00 64.81 C
ATOM 7803 C TYR C 156 5.072 130.338 103.139 1.00 64.39 C
ATOM 7804 O TYR C 156 5.199 131.546 103.353 1.00 65.51 O
ATOM 7805 CB TYR C 156 4.101 128.420 104.411 1.00 68.50 C
ATOM 7806 CG TYR C 156 2.883 127.630 104.856 1.00 73.15 C
ATOM 7807 CD1 TYR C 156 3.021 126.354 105.407 1.00 74.96 C
ATOM 7808 CD2 TYR C 156 1.583 128.136 104.675 1.00 75.58 C
ATOM 7809 CE1 TYR C 156 1.897 125.595 105.756 1.00 76.99 C
ATOM 7810 CE2 TYR C 156 0.456 127.388 105.019 1.00 76.47 C
ATOM 7811 CZ TYR C 156 0.620 126.118 105.553 1.00 77.47 C
ATOM 7812 OH TYR C 156 -0.490 125.358 105.841 1.00 78.16 O
ATOM 7813 N ILE C 157 6.033 129.606 102.591 1.00 62.75 N
ATOM 7814 CA ILE C 157 7.307 130.207 102.231 1.00 62.63 C
ATOM 7815 C ILE C 157 7.292 130.969 100.895 1.00 62.23 C
ATOM 7816 O ILE C 157 8.251 131.669 100.561 1.00 61.97 O
ATOM 7817 CB ILE C 157 8.412 129.132 102.180 1.00 63.02 C
ATOM 7818 CG1 ILE C 157 8.148 128.149 101.033 1.00 63.79 C
ATOM 7819 CG2 ILE C 157 8.457 128.391 103.490 1.00 62.45 C
ATOM 7820 CD1 ILE C 157 9.253 127.133 100.820 1.00 61.85 C
ATOM 7821 N GLY C 158 6.200 130.844 100.145 1.00 61.25 N
ATOM 7822 CA GLY C 158 6.091 131.496 98.846 1.00 60.39 C
ATOM 7823 C GLY C 158 6.477 132.961 98.709 1.00 59.27 C
ATOM 7824 O GLY C 158 7.386 133.297 97.957 1.00 57.40 O
ATOM 7825 N HIS C 159 5.773 133.834 99.419 1.00 59.93 N
ATOM 7826 CA HIS C 159 6.040 135.266 99.360 1.00 60.92 C
ATOM 7827 C HIS C 159 7.464 135.554 99.796 1.00 58.90 C
ATOM 7828 O HIS C 159 8.173 136.367 99.191 1.00 58.75 O
ATOM 7829 CB HIS C 159 5.064 136.021 100.271 1.00 66.25 C
ATOM 7830 CG HIS C 159 5.344 137.493 100.378 1.00 72.80 C
ATOM 7831 ND1 HIS C 159 5.249 138.354 99.301 1.00 76.21 N
ATOM 7832 CD2 HIS C 159 5.737 138.252 101.431 1.00 74.26 C
ATOM 7833 CE1 HIS C 159 5.573 139.576 99.686 1.00 76.14 C
ATOM 7834 NE2 HIS C 159 5.874 139.542 100.974 1.00 75.86 N
ATOM 7835 N THR C 160 7.869 134.879 100.860 1.00 56.00 N
ATOM 7836 CA THR C 160 9.195 135.035 101.417 1.00 53.54 C
ATOM 7837 C THR C 160 10.282 134.689 100.397 1.00 51.49 C
ATOM 7838 O THR C 160 11.240 135.440 100.248 1.00 52.11 O
ATOM 7839 CB THR C 160 9.337 134.147 102.673 1.00 55.60 C
ATOM 7840 OG1 THR C 160 8.238 134.404 103.564 1.00 53.80 O
ATOM 7841 CG2 THR C 160 10.648 134.422 103.387 1.00 52.77 C
ATOM 7842 N LEU C 161 10.139 133.571 99.687 1.00 49.52 N
ATOM 7843 CA LEU C 161 11.143 133.179 98.683 1.00 48.72 C
ATOM 7844 C LEU C 161 11.225 134.150 97.525 1.00 46.84 C
ATOM 7845 O LEU C 161 12.311 134.499 97.071 1.00 47.95 O
ATOM 7846 CB LEU C 161 10.854 131.803 98.089 1.00 50.36 C
ATOM 7847 CG LEU C 161 10.833 130.560 98.977 1.00 54.21 C
ATOM 7848 CD1 LEU C 161 10.703 129.354 98.054 1.00 55.85 C
ATOM 7849 CD2 LEU C 161 12.101 130.455 99.830 1.00 52.21 C
ATOM 7850 N VAL C 162 10.075 134.573 97.026 1.00 43.93 N
ATOM 7851 CA VAL C 162 10.067 135.495 95.917 1.00 42.61 C
ATOM 7852 C VAL C 162 10.775 136.794 96.261 1.00 42.42 C
ATOM 7853 O VAL C 162 11.670 137.231 95.534 1.00 42.37 O
ATOM 7854 CB VAL C 162 8.642 135.772 95.470 1.00 42.24 C
ATOM 7855 CG1 VAL C 162 8.625 136.831 94.407 1.00 41.41 C
ATOM 7856 CG2 VAL C 162 8.039 134.491 94.932 1.00 43.50 C
ATOM 7857 N GLU C 163 10.400 137.417 97.370 1.00 42.57 N
ATOM 7858 CA GLU C 163 11.055 138.669 97.736 1.00 43.15 C
ATOM 7859 C GLU C 163 12.540 138.477 97.969 1.00 40.42 C
ATOM 7860 O GLU C 163 13.339 139.399 97.756 1.00 38.09 O
ATOM 7861 CB GLU C 163 10.406 139.288 98.968 1.00 46.38 C
ATOM 7862 CG GLU C 163 9.198 140.131 98.621 1.00 53.58 C
ATOM 7863 CD GLU C 163 8.640 140.866 99.818 1.00 58.17 C
ATOM 7864 OE1 GLU C 163 7.758 141.737 99.619 1.00 59.11 O
ATOM 7865 OE2 GLU C 163 9.090 140.568 100.954 1.00 61.67 O
ATOM 7866 N TRP C 164 12.908 137.276 98.402 1.00 38.18 N
ATOM 7867 CA TRP C 164 14.306 136.974 98.644 1.00 37.62 C
ATOM 7868 C TRP C 164 15.018 136.958 97.294 1.00 37.99 C
ATOM 7869 O TRP C 164 15.982 137.694 97.084 1.00 39.65 O
ATOM 7870 CB TRP C 164 14.457 135.618 99.334 1.00 36.41 C
ATOM 7871 CG TRP C 164 15.888 135.247 99.528 1.00 37.11 C
ATOM 7872 CD1 TRP C 164 16.780 135.821 100.394 1.00 37.69 C
ATOM 7873 CD2 TRP C 164 16.622 134.268 98.788 1.00 36.49 C
ATOM 7874 NE1 TRP C 164 18.027 135.260 100.236 1.00 37.37 N
ATOM 7875 CE2 TRP C 164 17.960 134.303 99.259 1.00 36.09 C
ATOM 7876 CE3 TRP C 164 16.281 133.365 97.771 1.00 35.30 C
ATOM 7877 CZ2 TRP C 164 18.956 133.468 98.748 1.00 35.82 C
ATOM 7878 CZ3 TRP C 164 17.273 132.529 97.258 1.00 35.86 C
ATOM 7879 CH2 TRP C 164 18.597 132.587 97.750 1.00 36.79 C
ATOM 7880 N ALA C 165 14.528 136.122 96.385 1.00 36.65 N
ATOM 7881 CA ALA C 165 15.086 136.008 95.052 1.00 35.85 C
ATOM 7882 C ALA C 165 15.209 137.370 94.373 1.00 36.54 C
ATOM 7883 O ALA C 165 16.196 137.632 93.688 1.00 35.97 O
ATOM 7884 CB ALA C 165 14.213 135.090 94.215 1.00 36.78 C
ATOM 7885 N TRP C 166 14.207 138.231 94.562 1.00 37.20 N
ATOM 7886 CA TRP C 166 14.200 139.574 93.960 1.00 37.98 C
ATOM 7887 C TRP C 166 15.213 140.534 94.547 1.00 38.17 C
ATOM 7888 O TRP C 166 15.686 141.454 93.863 1.00 37.63 O
ATOM 7889 CB TRP C 166 12.837 140.248 94.114 1.00 37.67 C
ATOM 7890 CG TRP C 166 11.774 139.734 93.221 1.00 40.62 C
ATOM 7891 CD1 TRP C 166 11.935 139.077 92.027 1.00 41.42 C
ATOM 7892 CD2 TRP C 166 10.365 139.869 93.414 1.00 41.32 C
ATOM 7893 NE1 TRP C 166 10.709 138.792 91.471 1.00 38.70 N
ATOM 7894 CE2 TRP C 166 9.728 139.270 92.300 1.00 40.29 C
ATOM 7895 CE3 TRP C 166 9.574 140.440 94.421 1.00 42.61 C
ATOM 7896 CZ2 TRP C 166 8.336 139.225 92.167 1.00 39.64 C
ATOM 7897 CZ3 TRP C 166 8.186 140.395 94.289 1.00 42.76 C
ATOM 7898 CH2 TRP C 166 7.584 139.789 93.167 1.00 41.60 C
ATOM 7899 N GLY C 167 15.519 140.343 95.828 1.00 38.27 N
ATOM 7900 CA GLY C 167 16.445 141.237 96.498 1.00 37.95 C
ATOM 7901 C GLY C 167 15.718 142.540 96.822 1.00 36.62 C
ATOM 7902 O GLY C 167 16.335 143.563 97.114 1.00 37.02 O
ATOM 7903 N GLY C 168 14.391 142.487 96.772 1.00 35.08 N
ATOM 7904 CA GLY C 168 13.586 143.653 97.042 1.00 34.58 C
ATOM 7905 C GLY C 168 12.106 143.334 96.970 1.00 36.17 C
ATOM 7906 O GLY C 168 11.686 142.188 97.131 1.00 34.52 O
ATOM 7907 N PHE C 169 11.303 144.349 96.686 1.00 39.04 N
ATOM 7908 CA PHE C 169 9.866 144.155 96.646 1.00 41.72 C
ATOM 7909 C PHE C 169 9.299 143.905 95.284 1.00 42.77 C
ATOM 7910 O PHE C 169 8.086 143.807 95.137 1.00 45.62 O
ATOM 7911 CB PHE C 169 9.177 145.356 97.265 1.00 43.59 C
ATOM 7912 CG PHE C 169 9.709 145.702 98.618 1.00 45.63 C
ATOM 7913 CD1 PHE C 169 10.506 146.832 98.794 1.00 45.77 C
ATOM 7914 CD2 PHE C 169 9.462 144.864 99.705 1.00 46.14 C
ATOM 7915 CE1 PHE C 169 11.057 147.127 100.032 1.00 47.50 C
ATOM 7916 CE2 PHE C 169 10.005 145.146 100.946 1.00 49.26 C
ATOM 7917 CZ PHE C 169 10.810 146.285 101.114 1.00 49.41 C
ATOM 7918 N SER C 170 10.170 143.779 94.290 1.00 42.76 N
ATOM 7919 CA SER C 170 9.735 143.529 92.919 1.00 41.96 C
ATOM 7920 C SER C 170 10.965 143.307 92.070 1.00 41.60 C
ATOM 7921 O SER C 170 12.085 143.535 92.526 1.00 42.05 O
ATOM 7922 CB SER C 170 9.006 144.742 92.367 1.00 41.44 C
ATOM 7923 OG SER C 170 9.917 145.826 92.271 1.00 44.53 O
ATOM 7924 N VAL C 171 10.758 142.869 90.833 1.00 39.87 N
ATOM 7925 CA VAL C 171 11.874 142.667 89.927 1.00 37.27 C
ATOM 7926 C VAL C 171 12.495 144.040 89.758 1.00 36.81 C
ATOM 7927 O VAL C 171 11.821 144.974 89.347 1.00 35.97 O
ATOM 7928 CB VAL C 171 11.396 142.163 88.560 1.00 37.31 C
ATOM 7929 CG1 VAL C 171 12.477 142.383 87.505 1.00 36.39 C
ATOM 7930 CG2 VAL C 171 11.040 140.700 88.653 1.00 35.76 C
ATOM 7931 N ASP C 172 13.774 144.169 90.085 1.00 37.40 N
ATOM 7932 CA ASP C 172 14.446 145.456 89.970 1.00 37.10 C
ATOM 7933 C ASP C 172 15.952 145.252 89.773 1.00 37.20 C
ATOM 7934 O ASP C 172 16.394 144.140 89.461 1.00 37.13 O
ATOM 7935 CB ASP C 172 14.179 146.285 91.221 1.00 39.16 C
ATOM 7936 CG ASP C 172 14.185 147.775 90.949 1.00 40.76 C
ATOM 7937 OD1 ASP C 172 15.059 148.230 90.187 1.00 41.63 O
ATOM 7938 OD2 ASP C 172 13.324 148.494 91.514 1.00 41.63 O
ATOM 7939 N ASN C 173 16.743 146.304 89.985 1.00 34.92 N
ATOM 7940 CA ASN C 173 18.170 146.211 89.750 1.00 33.77 C
ATOM 7941 C ASN C 173 18.910 145.075 90.456 1.00 33.74 C
ATOM 7942 O ASN C 173 19.781 144.421 89.878 1.00 34.58 O
ATOM 7943 CB ASN C 173 18.839 147.528 90.071 1.00 32.40 C
ATOM 7944 CG ASN C 173 20.085 147.739 89.252 1.00 35.63 C
ATOM 7945 OD1 ASN C 173 20.017 147.842 88.019 1.00 37.28 O
ATOM 7946 ND2 ASN C 173 21.239 147.786 89.918 1.00 35.44 N
ATOM 7947 N PRO C 174 18.599 144.830 91.723 1.00 31.86 N
ATOM 7948 CA PRO C 174 19.352 143.728 92.317 1.00 31.25 C
ATOM 7949 C PRO C 174 18.961 142.383 91.715 1.00 30.85 C
ATOM 7950 O PRO C 174 19.659 141.383 91.874 1.00 32.24 O
ATOM 7951 CB PRO C 174 19.032 143.853 93.812 1.00 29.28 C
ATOM 7952 CG PRO C 174 17.793 144.637 93.858 1.00 29.93 C
ATOM 7953 CD PRO C 174 17.931 145.628 92.751 1.00 29.57 C
ATOM 7954 N THR C 175 17.827 142.359 91.034 1.00 30.57 N
ATOM 7955 CA THR C 175 17.378 141.135 90.413 1.00 29.46 C
ATOM 7956 C THR C 175 18.223 141.028 89.155 1.00 29.97 C
ATOM 7957 O THR C 175 18.779 139.981 88.847 1.00 32.00 O
ATOM 7958 CB THR C 175 15.913 141.219 90.003 1.00 28.59 C
ATOM 7959 OG1 THR C 175 15.164 141.816 91.059 1.00 29.87 O
ATOM 7960 CG2 THR C 175 15.355 139.818 89.727 1.00 29.25 C
ATOM 7961 N LEU C 176 18.354 142.144 88.454 1.00 27.63 N
ATOM 7962 CA LEU C 176 19.112 142.154 87.236 1.00 26.55 C
ATOM 7963 C LEU C 176 20.554 141.775 87.429 1.00 28.33 C
ATOM 7964 O LEU C 176 21.056 140.906 86.709 1.00 29.75 O
ATOM 7965 CB LEU C 176 19.026 143.513 86.572 1.00 25.44 C
ATOM 7966 CG LEU C 176 19.755 143.605 85.231 1.00 27.67 C
ATOM 7967 CD1 LEU C 176 19.353 142.448 84.321 1.00 25.86 C
ATOM 7968 CD2 LEU C 176 19.424 144.957 84.569 1.00 28.33 C
ATOM 7969 N THR C 177 21.238 142.401 88.389 1.00 29.01 N
ATOM 7970 CA THR C 177 22.646 142.067 88.588 1.00 28.12 C
ATOM 7971 C THR C 177 22.830 140.646 89.054 1.00 29.16 C
ATOM 7972 O THR C 177 23.795 140.000 88.632 1.00 30.93 O
ATOM 7973 CB THR C 177 23.411 143.013 89.562 1.00 27.40 C
ATOM 7974 OG1 THR C 177 22.747 143.082 90.822 1.00 29.97 O
ATOM 7975 CG2 THR C 177 23.542 144.396 88.956 1.00 27.92 C
ATOM 7976 N ARG C 178 21.932 140.127 89.892 1.00 27.40 N
ATOM 7977 CA ARG C 178 22.124 138.742 90.302 1.00 28.11 C
ATOM 7978 C ARG C 178 21.799 137.793 89.154 1.00 28.00 C
ATOM 7979 O ARG C 178 22.390 136.714 89.060 1.00 27.99 O
ATOM 7980 CB ARG C 178 21.307 138.382 91.554 1.00 27.91 C
ATOM 7981 CG ARG C 178 19.826 138.154 91.362 1.00 29.48 C
ATOM 7982 CD ARG C 178 19.148 137.981 92.736 1.00 28.21 C
ATOM 7983 NE ARG C 178 19.341 139.157 93.580 1.00 29.26 N
ATOM 7984 CZ ARG C 178 19.119 139.191 94.891 1.00 29.92 C
ATOM 7985 NH1 ARG C 178 18.685 138.117 95.519 1.00 29.71 N
ATOM 7986 NH2 ARG C 178 19.366 140.294 95.586 1.00 31.64 N
ATOM 7987 N PHE C 179 20.888 138.197 88.267 1.00 28.46 N
ATOM 7988 CA PHE C 179 20.523 137.347 87.125 1.00 28.53 C
ATOM 7989 C PHE C 179 21.683 137.238 86.137 1.00 28.32 C
ATOM 7990 O PHE C 179 21.914 136.181 85.536 1.00 26.08 O
ATOM 7991 CB PHE C 179 19.274 137.880 86.422 1.00 28.23 C
ATOM 7992 CG PHE C 179 17.971 137.326 86.971 1.00 31.69 C
ATOM 7993 CD1 PHE C 179 17.928 136.679 88.213 1.00 30.93 C
ATOM 7994 CD2 PHE C 179 16.768 137.492 86.259 1.00 32.11 C
ATOM 7995 CE1 PHE C 179 16.712 136.209 88.735 1.00 30.13 C
ATOM 7996 CE2 PHE C 179 15.546 137.023 86.780 1.00 29.85 C
ATOM 7997 CZ PHE C 179 15.520 136.385 88.011 1.00 29.75 C
ATOM 7998 N PHE C 180 22.423 138.329 85.980 1.00 28.25 N
ATOM 7999 CA PHE C 180 23.567 138.318 85.083 1.00 27.68 C
ATOM 8000 C PHE C 180 24.574 137.298 85.619 1.00 28.96 C
ATOM 8001 O PHE C 180 25.029 136.407 84.892 1.00 32.80 O
ATOM 8002 CB PHE C 180 24.211 139.694 85.038 1.00 26.61 C
ATOM 8003 CG PHE C 180 25.437 139.760 84.183 1.00 26.36 C
ATOM 8004 CD1 PHE C 180 26.531 140.531 84.576 1.00 23.49 C
ATOM 8005 CD2 PHE C 180 25.482 139.100 82.953 1.00 26.43 C
ATOM 8006 CE1 PHE C 180 27.635 140.648 83.766 1.00 22.61 C
ATOM 8007 CE2 PHE C 180 26.593 139.213 82.123 1.00 24.29 C
ATOM 8008 CZ PHE C 180 27.670 139.985 82.524 1.00 23.99 C
ATOM 8009 N ALA C 181 24.913 137.418 86.897 1.00 26.84 N
ATOM 8010 CA ALA C 181 25.853 136.501 87.503 1.00 24.57 C
ATOM 8011 C ALA C 181 25.387 135.060 87.312 1.00 26.29 C
ATOM 8012 O ALA C 181 26.181 134.201 86.934 1.00 27.45 O
ATOM 8013 CB ALA C 181 25.994 136.815 88.954 1.00 25.44 C
ATOM 8014 N LEU C 182 24.112 134.784 87.578 1.00 26.42 N
ATOM 8015 CA LEU C 182 23.592 133.436 87.397 1.00 27.34 C
ATOM 8016 C LEU C 182 23.713 133.003 85.942 1.00 28.40 C
ATOM 8017 O LEU C 182 24.098 131.870 85.623 1.00 27.58 O
ATOM 8018 CB LEU C 182 22.122 133.366 87.774 1.00 29.01 C
ATOM 8019 CG LEU C 182 21.797 133.242 89.257 1.00 34.85 C
ATOM 8020 CD1 LEU C 182 20.287 133.022 89.438 1.00 34.24 C
ATOM 8021 CD2 LEU C 182 22.576 132.061 89.836 1.00 35.03 C
ATOM 8022 N HIS C 183 23.373 133.915 85.047 1.00 27.78 N
ATOM 8023 CA HIS C 183 23.412 133.568 83.657 1.00 26.86 C
ATOM 8024 C HIS C 183 24.825 133.245 83.234 1.00 27.60 C
ATOM 8025 O HIS C 183 25.035 132.380 82.370 1.00 28.35 O
ATOM 8026 CB HIS C 183 22.832 134.693 82.803 1.00 27.15 C
ATOM 8027 CG HIS C 183 22.715 134.332 81.358 1.00 26.34 C
ATOM 8028 ND1 HIS C 183 22.026 133.218 80.937 1.00 26.79 N
ATOM 8029 CD2 HIS C 183 23.246 134.893 80.244 1.00 25.21 C
ATOM 8030 CE1 HIS C 183 22.144 133.105 79.627 1.00 27.92 C
ATOM 8031 NE2 HIS C 183 22.879 134.107 79.182 1.00 25.85 N
ATOM 8032 N PHE C 184 25.795 133.926 83.845 1.00 25.82 N
ATOM 8033 CA PHE C 184 27.210 133.709 83.523 1.00 25.57 C
ATOM 8034 C PHE C 184 27.662 132.351 84.069 1.00 25.03 C
ATOM 8035 O PHE C 184 28.363 131.606 83.422 1.00 26.62 O
ATOM 8036 CB PHE C 184 28.047 134.828 84.158 1.00 25.22 C
ATOM 8037 CG PHE C 184 29.413 135.009 83.549 1.00 24.48 C
ATOM 8038 CD1 PHE C 184 29.783 136.244 83.012 1.00 23.97 C
ATOM 8039 CD2 PHE C 184 30.320 133.960 83.490 1.00 23.00 C
ATOM 8040 CE1 PHE C 184 31.038 136.435 82.415 1.00 24.76 C
ATOM 8041 CE2 PHE C 184 31.577 134.140 82.896 1.00 23.60 C
ATOM 8042 CZ PHE C 184 31.936 135.375 82.357 1.00 22.93 C
ATOM 8043 N LEU C 185 27.204 132.019 85.257 1.00 25.58 N
ATOM 8044 CA LEU C 185 27.603 130.799 85.922 1.00 25.68 C
ATOM 8045 C LEU C 185 27.021 129.509 85.412 1.00 26.86 C
ATOM 8046 O LEU C 185 27.774 128.583 85.085 1.00 28.22 O
ATOM 8047 CB LEU C 185 27.301 130.938 87.423 1.00 28.60 C
ATOM 8048 CG LEU C 185 27.440 129.741 88.362 1.00 28.28 C
ATOM 8049 CD1 LEU C 185 28.899 129.344 88.462 1.00 29.89 C
ATOM 8050 CD2 LEU C 185 26.895 130.111 89.725 1.00 26.82 C
ATOM 8051 N LEU C 186 25.685 129.433 85.365 1.00 27.28 N
ATOM 8052 CA LEU C 186 24.969 128.217 84.947 1.00 24.86 C
ATOM 8053 C LEU C 186 25.470 127.496 83.697 1.00 25.76 C
ATOM 8054 O LEU C 186 25.557 126.262 83.672 1.00 26.42 O
ATOM 8055 CB LEU C 186 23.479 128.518 84.811 1.00 23.53 C
ATOM 8056 CG LEU C 186 22.814 128.867 86.149 1.00 21.31 C
ATOM 8057 CD1 LEU C 186 21.354 129.260 85.965 1.00 17.67 C
ATOM 8058 CD2 LEU C 186 22.932 127.677 87.062 1.00 17.31 C
ATOM 8059 N PRO C 187 25.778 128.237 82.629 1.00 25.48 N
ATOM 8060 CA PRO C 187 26.263 127.533 81.445 1.00 27.34 C
ATOM 8061 C PRO C 187 27.425 126.588 81.790 1.00 28.90 C
ATOM 8062 O PRO C 187 27.564 125.502 81.202 1.00 28.33 O
ATOM 8063 CB PRO C 187 26.687 128.665 80.528 1.00 27.97 C
ATOM 8064 CG PRO C 187 25.689 129.717 80.844 1.00 28.29 C
ATOM 8065 CD PRO C 187 25.570 129.665 82.349 1.00 25.39 C
ATOM 8066 N PHE C 188 28.257 126.992 82.747 1.00 29.22 N
ATOM 8067 CA PHE C 188 29.372 126.137 83.136 1.00 30.12 C
ATOM 8068 C PHE C 188 28.895 124.921 83.950 1.00 29.95 C
ATOM 8069 O PHE C 188 29.501 123.851 83.897 1.00 30.11 O
ATOM 8070 CB PHE C 188 30.442 126.955 83.862 1.00 30.13 C
ATOM 8071 CG PHE C 188 31.089 127.995 82.976 1.00 34.34 C
ATOM 8072 CD1 PHE C 188 30.603 129.305 82.932 1.00 34.84 C
ATOM 8073 CD2 PHE C 188 32.137 127.646 82.122 1.00 35.08 C
ATOM 8074 CE1 PHE C 188 31.149 130.253 82.052 1.00 35.17 C
ATOM 8075 CE2 PHE C 188 32.690 128.588 81.231 1.00 36.05 C
ATOM 8076 CZ PHE C 188 32.190 129.895 81.199 1.00 36.52 C
ATOM 8077 N ALA C 189 27.798 125.060 84.684 1.00 27.45 N
ATOM 8078 CA ALA C 189 27.289 123.915 85.405 1.00 24.73 C
ATOM 8079 C ALA C 189 26.764 122.967 84.331 1.00 26.50 C
ATOM 8080 O ALA C 189 26.840 121.738 84.464 1.00 28.75 O
ATOM 8081 CB ALA C 189 26.170 124.324 86.325 1.00 22.92 C
ATOM 8082 N ILE C 190 26.229 123.536 83.255 1.00 25.35 N
ATOM 8083 CA ILE C 190 25.703 122.713 82.186 1.00 25.04 C
ATOM 8084 C ILE C 190 26.842 121.925 81.593 1.00 24.33 C
ATOM 8085 O ILE C 190 26.735 120.721 81.389 1.00 25.94 O
ATOM 8086 CB ILE C 190 25.038 123.578 81.107 1.00 27.35 C
ATOM 8087 CG1 ILE C 190 23.728 124.124 81.647 1.00 26.73 C
ATOM 8088 CG2 ILE C 190 24.759 122.763 79.847 1.00 27.95 C
ATOM 8089 CD1 ILE C 190 23.044 125.039 80.686 1.00 27.50 C
ATOM 8090 N ALA C 191 27.945 122.604 81.317 1.00 25.02 N
ATOM 8091 CA ALA C 191 29.122 121.935 80.764 1.00 24.40 C
ATOM 8092 C ALA C 191 29.588 120.817 81.714 1.00 24.32 C
ATOM 8093 O ALA C 191 29.787 119.669 81.309 1.00 25.01 O
ATOM 8094 CB ALA C 191 30.231 122.945 80.549 1.00 22.74 C
ATOM 8095 N GLY C 192 29.743 121.137 82.989 1.00 23.87 N
ATOM 8096 CA GLY C 192 30.165 120.109 83.925 1.00 25.87 C
ATOM 8097 C GLY C 192 29.241 118.893 83.978 1.00 26.67 C
ATOM 8098 O GLY C 192 29.693 117.746 83.879 1.00 26.56 O
ATOM 8099 N ILE C 193 27.945 119.134 84.153 1.00 25.60 N
ATOM 8100 CA ILE C 193 26.996 118.041 84.217 1.00 24.66 C
ATOM 8101 C ILE C 193 26.962 117.266 82.903 1.00 25.98 C
ATOM 8102 O ILE C 193 26.576 116.091 82.887 1.00 23.16 O
ATOM 8103 CB ILE C 193 25.614 118.565 84.551 1.00 24.57 C
ATOM 8104 CG1 ILE C 193 25.669 119.218 85.932 1.00 19.74 C
ATOM 8105 CG2 ILE C 193 24.586 117.432 84.479 1.00 22.03 C
ATOM 8106 CD1 ILE C 193 24.486 120.098 86.214 1.00 20.18 C
ATOM 8107 N THR C 194 27.364 117.910 81.804 1.00 24.92 N
ATOM 8108 CA THR C 194 27.398 117.196 80.534 1.00 26.47 C
ATOM 8109 C THR C 194 28.412 116.065 80.690 1.00 26.99 C
ATOM 8110 O THR C 194 28.148 114.941 80.294 1.00 28.46 O
ATOM 8111 CB THR C 194 27.802 118.110 79.351 1.00 26.68 C
ATOM 8112 OG1 THR C 194 26.777 119.079 79.121 1.00 28.37 O
ATOM 8113 CG2 THR C 194 27.977 117.311 78.093 1.00 21.88 C
ATOM 8114 N ILE C 195 29.566 116.359 81.283 1.00 28.29 N
ATOM 8115 CA ILE C 195 30.603 115.336 81.516 1.00 28.91 C
ATOM 8116 C ILE C 195 30.025 114.167 82.318 1.00 29.59 C
ATOM 8117 O ILE C 195 30.306 113.002 82.012 1.00 29.41 O
ATOM 8118 CB ILE C 195 31.818 115.894 82.322 1.00 30.02 C
ATOM 8119 CG1 ILE C 195 32.485 117.055 81.570 1.00 30.80 C
ATOM 8120 CG2 ILE C 195 32.822 114.800 82.552 1.00 28.34 C
ATOM 8121 CD1 ILE C 195 32.894 116.704 80.147 1.00 30.78 C
ATOM 8122 N ILE C 196 29.240 114.467 83.356 1.00 28.68 N
ATOM 8123 CA ILE C 196 28.621 113.392 84.147 1.00 28.99 C
ATOM 8124 C ILE C 196 27.667 112.564 83.244 1.00 28.06 C
ATOM 8125 O ILE C 196 27.594 111.339 83.340 1.00 27.55 O
ATOM 8126 CB ILE C 196 27.758 113.935 85.327 1.00 30.09 C
ATOM 8127 CG1 ILE C 196 28.523 114.953 86.168 1.00 30.31 C
ATOM 8128 CG2 ILE C 196 27.283 112.785 86.172 1.00 29.66 C
ATOM 8129 CD1 ILE C 196 29.763 114.423 86.775 1.00 34.56 C
ATOM 8130 N HIS C 197 26.938 113.269 82.381 1.00 26.43 N
ATOM 8131 CA HIS C 197 25.973 112.685 81.463 1.00 25.36 C
ATOM 8132 C HIS C 197 26.713 111.661 80.610 1.00 27.47 C
ATOM 8133 O HIS C 197 26.360 110.466 80.607 1.00 26.22 O
ATOM 8134 CB HIS C 197 25.386 113.825 80.610 1.00 26.20 C
ATOM 8135 CG HIS C 197 24.233 113.443 79.722 1.00 24.73 C
ATOM 8136 ND1 HIS C 197 23.067 112.885 80.201 1.00 24.51 N
ATOM 8137 CD2 HIS C 197 24.025 113.662 78.400 1.00 23.18 C
ATOM 8138 CE1 HIS C 197 22.190 112.785 79.216 1.00 23.64 C
ATOM 8139 NE2 HIS C 197 22.743 113.252 78.109 1.00 22.21 N
ATOM 8140 N LEU C 198 27.750 112.122 79.905 1.00 27.66 N
ATOM 8141 CA LEU C 198 28.528 111.247 79.048 1.00 29.61 C
ATOM 8142 C LEU C 198 29.290 110.181 79.839 1.00 31.79 C
ATOM 8143 O LEU C 198 29.624 109.108 79.311 1.00 32.69 O
ATOM 8144 CB LEU C 198 29.495 112.063 78.205 1.00 31.12 C
ATOM 8145 CG LEU C 198 28.862 112.976 77.156 1.00 33.79 C
ATOM 8146 CD1 LEU C 198 29.964 113.704 76.407 1.00 33.51 C
ATOM 8147 CD2 LEU C 198 28.021 112.164 76.185 1.00 35.31 C
ATOM 8148 N THR C 199 29.568 110.460 81.105 1.00 31.45 N
ATOM 8149 CA THR C 199 30.267 109.481 81.912 1.00 32.60 C
ATOM 8150 C THR C 199 29.357 108.295 82.200 1.00 32.12 C
ATOM 8151 O THR C 199 29.764 107.146 82.068 1.00 33.10 O
ATOM 8152 CB THR C 199 30.753 110.092 83.232 1.00 34.11 C
ATOM 8153 OG1 THR C 199 31.941 110.848 82.983 1.00 35.80 O
ATOM 8154 CG2 THR C 199 31.037 108.999 84.268 1.00 31.86 C
ATOM 8155 N PHE C 200 28.128 108.569 82.609 1.00 31.50 N
ATOM 8156 CA PHE C 200 27.191 107.494 82.886 1.00 31.02 C
ATOM 8157 C PHE C 200 26.931 106.750 81.585 1.00 31.79 C
ATOM 8158 O PHE C 200 26.887 105.529 81.551 1.00 31.09 O
ATOM 8159 CB PHE C 200 25.884 108.066 83.417 1.00 30.63 C
ATOM 8160 CG PHE C 200 25.908 108.367 84.877 1.00 30.54 C
ATOM 8161 CD1 PHE C 200 26.073 107.341 85.799 1.00 31.20 C
ATOM 8162 CD2 PHE C 200 25.734 109.667 85.339 1.00 30.19 C
ATOM 8163 CE1 PHE C 200 26.058 107.603 87.169 1.00 30.68 C
ATOM 8164 CE2 PHE C 200 25.717 109.941 86.706 1.00 29.87 C
ATOM 8165 CZ PHE C 200 25.878 108.903 87.621 1.00 31.13 C
ATOM 8166 N LEU C 201 26.761 107.501 80.505 1.00 31.82 N
ATOM 8167 CA LEU C 201 26.507 106.904 79.205 1.00 31.63 C
ATOM 8168 C LEU C 201 27.550 105.874 78.781 1.00 33.40 C
ATOM 8169 O LEU C 201 27.216 104.793 78.290 1.00 31.48 O
ATOM 8170 CB LEU C 201 26.448 107.994 78.146 1.00 29.62 C
ATOM 8171 CG LEU C 201 26.362 107.484 76.717 1.00 26.32 C
ATOM 8172 CD1 LEU C 201 25.051 106.729 76.493 1.00 20.96 C
ATOM 8173 CD2 LEU C 201 26.516 108.678 75.789 1.00 27.49 C
ATOM 8174 N HIS C 202 28.820 106.206 78.955 1.00 35.37 N
ATOM 8175 CA HIS C 202 29.856 105.281 78.539 1.00 38.23 C
ATOM 8176 C HIS C 202 29.887 103.992 79.332 1.00 37.98 C
ATOM 8177 O HIS C 202 30.550 103.038 78.930 1.00 36.93 O
ATOM 8178 CB HIS C 202 31.211 105.972 78.562 1.00 42.33 C
ATOM 8179 CG HIS C 202 31.318 107.087 77.570 1.00 48.24 C
ATOM 8180 ND1 HIS C 202 32.402 107.935 77.512 1.00 52.08 N
ATOM 8181 CD2 HIS C 202 30.462 107.507 76.606 1.00 49.71 C
ATOM 8182 CE1 HIS C 202 32.208 108.832 76.561 1.00 51.65 C
ATOM 8183 NE2 HIS C 202 31.040 108.595 75.997 1.00 49.94 N
ATOM 8184 N GLU C 203 29.168 103.950 80.448 1.00 37.38 N
ATOM 8185 CA GLU C 203 29.128 102.724 81.237 1.00 38.97 C
ATOM 8186 C GLU C 203 28.531 101.627 80.376 1.00 37.97 C
ATOM 8187 O GLU C 203 28.813 100.458 80.573 1.00 37.57 O
ATOM 8188 CB GLU C 203 28.255 102.890 82.484 1.00 41.52 C
ATOM 8189 CG GLU C 203 28.930 103.600 83.615 1.00 47.99 C
ATOM 8190 CD GLU C 203 30.207 102.904 83.993 1.00 54.36 C
ATOM 8191 OE1 GLU C 203 30.128 101.832 84.646 1.00 57.65 O
ATOM 8192 OE2 GLU C 203 31.288 103.419 83.617 1.00 56.77 O
ATOM 8193 N SER C 204 27.712 102.033 79.408 1.00 38.52 N
ATOM 8194 CA SER C 204 27.005 101.108 78.520 1.00 36.85 C
ATOM 8195 C SER C 204 27.152 101.414 77.052 1.00 35.13 C
ATOM 8196 O SER C 204 26.823 100.593 76.216 1.00 35.56 O
ATOM 8197 CB SER C 204 25.515 101.150 78.834 1.00 36.03 C
ATOM 8198 OG SER C 204 25.076 102.501 78.866 1.00 37.53 O
ATOM 8199 N GLY C 205 27.640 102.599 76.728 1.00 35.29 N
ATOM 8200 CA GLY C 205 27.738 102.955 75.331 1.00 32.99 C
ATOM 8201 C GLY C 205 26.318 103.228 74.857 1.00 32.46 C
ATOM 8202 O GLY C 205 25.330 103.031 75.595 1.00 32.35 O
ATOM 8203 N SER C 206 26.202 103.679 73.620 1.00 30.92 N
ATOM 8204 CA SER C 206 24.903 103.987 73.058 1.00 30.31 C
ATOM 8205 C SER C 206 23.955 102.824 72.817 1.00 30.46 C
ATOM 8206 O SER C 206 24.356 101.659 72.707 1.00 32.16 O
ATOM 8207 CB SER C 206 25.095 104.732 71.754 1.00 29.47 C
ATOM 8208 OG SER C 206 25.964 105.822 71.975 1.00 31.50 O
ATOM 8209 N ASN C 207 22.680 103.175 72.772 1.00 29.53 N
ATOM 8210 CA ASN C 207 21.593 102.259 72.476 1.00 28.97 C
ATOM 8211 C ASN C 207 21.528 102.437 70.930 1.00 29.06 C
ATOM 8212 O ASN C 207 22.350 103.157 70.352 1.00 27.45 O
ATOM 8213 CB ASN C 207 20.329 102.791 73.170 1.00 31.35 C
ATOM 8214 CG ASN C 207 19.071 101.993 72.852 1.00 30.86 C
ATOM 8215 OD1 ASN C 207 17.963 102.539 72.864 1.00 31.38 O
ATOM 8216 ND2 ASN C 207 19.229 100.710 72.589 1.00 31.77 N
ATOM 8217 N ASN C 208 20.585 101.793 70.254 1.00 28.17 N
ATOM 8218 CA ASN C 208 20.484 101.943 68.804 1.00 27.55 C
ATOM 8219 C ASN C 208 19.028 101.752 68.375 1.00 26.85 C
ATOM 8220 O ASN C 208 18.232 101.171 69.105 1.00 26.24 O
ATOM 8221 CB ASN C 208 21.410 100.933 68.102 1.00 25.69 C
ATOM 8222 CG ASN C 208 20.865 99.534 68.120 1.00 24.02 C
ATOM 8223 OD1 ASN C 208 19.953 99.203 67.368 1.00 28.20 O
ATOM 8224 ND2 ASN C 208 21.413 98.702 68.975 1.00 22.92 N
ATOM 8225 N PRO C 209 18.667 102.216 67.171 1.00 27.92 N
ATOM 8226 CA PRO C 209 17.279 102.074 66.702 1.00 28.40 C
ATOM 8227 C PRO C 209 16.535 100.725 66.827 1.00 27.86 C
ATOM 8228 O PRO C 209 15.339 100.731 67.082 1.00 29.02 O
ATOM 8229 CB PRO C 209 17.331 102.631 65.269 1.00 26.00 C
ATOM 8230 CG PRO C 209 18.791 102.676 64.907 1.00 24.05 C
ATOM 8231 CD PRO C 209 19.492 102.946 66.187 1.00 28.24 C
ATOM 8232 N LEU C 210 17.208 99.585 66.688 1.00 27.59 N
ATOM 8233 CA LEU C 210 16.517 98.292 66.830 1.00 26.61 C
ATOM 8234 C LEU C 210 16.339 97.845 68.277 1.00 28.53 C
ATOM 8235 O LEU C 210 15.634 96.867 68.552 1.00 29.29 O
ATOM 8236 CB LEU C 210 17.251 97.185 66.069 1.00 26.25 C
ATOM 8237 CG LEU C 210 17.422 97.357 64.555 1.00 24.06 C
ATOM 8238 CD1 LEU C 210 17.955 96.074 63.950 1.00 19.95 C
ATOM 8239 CD2 LEU C 210 16.078 97.731 63.935 1.00 23.75 C
ATOM 8240 N GLY C 211 16.995 98.541 69.205 1.00 30.47 N
ATOM 8241 CA GLY C 211 16.870 98.208 70.615 1.00 29.54 C
ATOM 8242 C GLY C 211 17.386 96.842 71.017 1.00 31.38 C
ATOM 8243 O GLY C 211 16.946 96.294 72.016 1.00 35.06 O
ATOM 8244 N ILE C 212 18.299 96.276 70.240 1.00 32.10 N
ATOM 8245 CA ILE C 212 18.883 94.979 70.560 1.00 32.15 C
ATOM 8246 C ILE C 212 20.391 95.211 70.670 1.00 32.71 C
ATOM 8247 O ILE C 212 20.937 96.152 70.082 1.00 31.81 O
ATOM 8248 CB ILE C 212 18.605 93.919 69.447 1.00 32.87 C
ATOM 8249 CG1 ILE C 212 19.275 94.347 68.142 1.00 35.38 C
ATOM 8250 CG2 ILE C 212 17.101 93.761 69.223 1.00 31.83 C
ATOM 8251 CD1 ILE C 212 18.899 93.501 66.934 1.00 36.11 C
ATOM 8252 N SER C 213 21.066 94.353 71.422 1.00 32.99 N
ATOM 8253 CA SER C 213 22.499 94.485 71.614 1.00 32.88 C
ATOM 8254 C SER C 213 23.274 94.680 70.307 1.00 34.39 C
ATOM 8255 O SER C 213 23.042 93.978 69.323 1.00 34.23 O
ATOM 8256 CB SER C 213 23.022 93.254 72.340 1.00 31.52 C
ATOM 8257 OG SER C 213 24.414 93.367 72.573 1.00 32.67 O
ATOM 8258 N SER C 214 24.202 95.631 70.303 1.00 35.90 N
ATOM 8259 CA SER C 214 25.010 95.879 69.117 1.00 38.94 C
ATOM 8260 C SER C 214 26.465 95.455 69.310 1.00 40.88 C
ATOM 8261 O SER C 214 27.334 95.817 68.516 1.00 42.20 O
ATOM 8262 CB SER C 214 24.937 97.359 68.710 1.00 38.99 C
ATOM 8263 OG SER C 214 25.138 98.231 69.813 1.00 40.14 O
ATOM 8264 N ASP C 215 26.721 94.669 70.352 1.00 42.84 N
ATOM 8265 CA ASP C 215 28.071 94.196 70.656 1.00 44.62 C
ATOM 8266 C ASP C 215 28.686 93.392 69.512 1.00 44.84 C
ATOM 8267 O ASP C 215 29.910 93.305 69.372 1.00 45.20 O
ATOM 8268 CB ASP C 215 28.042 93.335 71.917 1.00 46.30 C
ATOM 8269 CG ASP C 215 27.799 94.144 73.174 1.00 48.20 C
ATOM 8270 OD1 ASP C 215 27.396 93.541 74.193 1.00 52.51 O
ATOM 8271 OD2 ASP C 215 28.025 95.373 73.156 1.00 48.70 O
ATOM 8272 N SER C 216 27.820 92.801 68.699 1.00 44.79 N
ATOM 8273 CA SER C 216 28.248 91.992 67.568 1.00 44.04 C
ATOM 8274 C SER C 216 28.643 92.860 66.399 1.00 43.59 C
ATOM 8275 O SER C 216 29.290 92.388 65.462 1.00 44.67 O
ATOM 8276 CB SER C 216 27.113 91.063 67.141 1.00 44.65 C
ATOM 8277 OG SER C 216 25.868 91.740 67.238 1.00 49.81 O
ATOM 8278 N ASP C 217 28.268 94.135 66.452 1.00 42.27 N
ATOM 8279 CA ASP C 217 28.574 95.028 65.349 1.00 41.05 C
ATOM 8280 C ASP C 217 28.951 96.441 65.769 1.00 39.00 C
ATOM 8281 O ASP C 217 28.265 97.382 65.410 1.00 39.93 O
ATOM 8282 CB ASP C 217 27.367 95.083 64.400 1.00 43.44 C
ATOM 8283 CG ASP C 217 27.749 95.462 62.967 1.00 46.84 C
ATOM 8284 OD1 ASP C 217 26.816 95.674 62.149 1.00 45.78 O
ATOM 8285 OD2 ASP C 217 28.968 95.537 62.657 1.00 48.34 O
ATOM 8286 N LYS C 218 30.034 96.612 66.513 1.00 37.28 N
ATOM 8287 CA LYS C 218 30.421 97.958 66.900 1.00 36.37 C
ATOM 8288 C LYS C 218 31.524 98.518 66.020 1.00 35.67 C
ATOM 8289 O LYS C 218 32.245 97.759 65.367 1.00 36.40 O
ATOM 8290 CB LYS C 218 30.828 97.996 68.362 1.00 37.72 C
ATOM 8291 CG LYS C 218 29.613 97.922 69.257 1.00 40.54 C
ATOM 8292 CD LYS C 218 29.948 98.173 70.710 1.00 42.97 C
ATOM 8293 CE LYS C 218 28.734 97.900 71.607 1.00 42.43 C
ATOM 8294 NZ LYS C 218 27.623 98.848 71.381 1.00 39.85 N
ATOM 8295 N ILE C 219 31.634 99.844 65.982 1.00 33.08 N
ATOM 8296 CA ILE C 219 32.643 100.502 65.164 1.00 33.03 C
ATOM 8297 C ILE C 219 33.279 101.685 65.902 1.00 33.97 C
ATOM 8298 O ILE C 219 32.651 102.324 66.739 1.00 33.81 O
ATOM 8299 CB ILE C 219 32.046 101.021 63.813 1.00 31.66 C
ATOM 8300 CG1 ILE C 219 30.810 101.892 64.070 1.00 31.52 C
ATOM 8301 CG2 ILE C 219 31.668 99.875 62.932 1.00 28.35 C
ATOM 8302 CD1 ILE C 219 30.241 102.525 62.816 1.00 31.21 C
ATOM 8303 N PRO C 220 34.545 101.990 65.592 1.00 34.70 N
ATOM 8304 CA PRO C 220 35.201 103.116 66.264 1.00 35.16 C
ATOM 8305 C PRO C 220 34.467 104.438 65.984 1.00 35.81 C
ATOM 8306 O PRO C 220 34.039 104.701 64.847 1.00 35.05 O
ATOM 8307 CB PRO C 220 36.600 103.098 65.660 1.00 34.55 C
ATOM 8308 CG PRO C 220 36.328 102.618 64.239 1.00 34.87 C
ATOM 8309 CD PRO C 220 35.371 101.472 64.485 1.00 33.28 C
ATOM 8310 N PHE C 221 34.326 105.265 67.019 1.00 35.96 N
ATOM 8311 CA PHE C 221 33.663 106.559 66.870 1.00 35.19 C
ATOM 8312 C PHE C 221 34.288 107.337 65.717 1.00 35.76 C
ATOM 8313 O PHE C 221 33.599 108.023 64.960 1.00 34.50 O
ATOM 8314 CB PHE C 221 33.800 107.377 68.136 1.00 34.66 C
ATOM 8315 CG PHE C 221 33.200 108.737 68.022 1.00 34.81 C
ATOM 8316 CD1 PHE C 221 31.839 108.929 68.240 1.00 33.48 C
ATOM 8317 CD2 PHE C 221 33.982 109.821 67.639 1.00 33.47 C
ATOM 8318 CE1 PHE C 221 31.270 110.182 68.074 1.00 33.37 C
ATOM 8319 CE2 PHE C 221 33.415 111.087 67.470 1.00 34.42 C
ATOM 8320 CZ PHE C 221 32.057 111.267 67.688 1.00 32.58 C
ATOM 8321 N HIS C 222 35.610 107.251 65.615 1.00 37.71 N
ATOM 8322 CA HIS C 222 36.337 107.908 64.535 1.00 37.92 C
ATOM 8323 C HIS C 222 36.787 106.842 63.549 1.00 38.88 C
ATOM 8324 O HIS C 222 37.328 105.799 63.954 1.00 39.30 O
ATOM 8325 CB HIS C 222 37.574 108.616 65.040 1.00 37.57 C
ATOM 8326 CG HIS C 222 38.384 109.211 63.938 1.00 40.66 C
ATOM 8327 ND1 HIS C 222 37.924 110.251 63.157 1.00 41.73 N
ATOM 8328 CD2 HIS C 222 39.606 108.888 63.455 1.00 39.77 C
ATOM 8329 CE1 HIS C 222 38.830 110.546 62.244 1.00 40.82 C
ATOM 8330 NE2 HIS C 222 39.859 109.734 62.403 1.00 41.20 N
ATOM 8331 N PRO C 223 36.599 107.095 62.243 1.00 37.79 N
ATOM 8332 CA PRO C 223 36.006 108.306 61.683 1.00 37.38 C
ATOM 8333 C PRO C 223 34.511 108.202 61.386 1.00 36.69 C
ATOM 8334 O PRO C 223 33.933 109.129 60.829 1.00 38.54 O
ATOM 8335 CB PRO C 223 36.786 108.469 60.399 1.00 37.48 C
ATOM 8336 CG PRO C 223 36.762 107.041 59.899 1.00 36.94 C
ATOM 8337 CD PRO C 223 37.121 106.244 61.157 1.00 36.58 C
ATOM 8338 N TYR C 224 33.873 107.095 61.735 1.00 35.11 N
ATOM 8339 CA TYR C 224 32.456 106.959 61.413 1.00 35.67 C
ATOM 8340 C TYR C 224 31.521 108.048 61.910 1.00 35.49 C
ATOM 8341 O TYR C 224 30.837 108.709 61.113 1.00 33.76 O
ATOM 8342 CB TYR C 224 31.961 105.592 61.849 1.00 35.98 C
ATOM 8343 CG TYR C 224 32.618 104.535 61.006 1.00 37.29 C
ATOM 8344 CD1 TYR C 224 33.458 103.572 61.580 1.00 37.11 C
ATOM 8345 CD2 TYR C 224 32.482 104.553 59.617 1.00 33.63 C
ATOM 8346 CE1 TYR C 224 34.150 102.665 60.787 1.00 36.17 C
ATOM 8347 CE2 TYR C 224 33.167 103.649 58.825 1.00 36.17 C
ATOM 8348 CZ TYR C 224 34.002 102.709 59.418 1.00 34.96 C
ATOM 8349 OH TYR C 224 34.702 101.834 58.637 1.00 35.34 O
ATOM 8350 N TYR C 225 31.499 108.254 63.219 1.00 35.02 N
ATOM 8351 CA TYR C 225 30.633 109.270 63.766 1.00 34.42 C
ATOM 8352 C TYR C 225 31.241 110.656 63.870 1.00 34.68 C
ATOM 8353 O TYR C 225 30.518 111.639 64.001 1.00 35.89 O
ATOM 8354 CB TYR C 225 30.068 108.784 65.091 1.00 32.85 C
ATOM 8355 CG TYR C 225 29.197 107.580 64.852 1.00 31.18 C
ATOM 8356 CD1 TYR C 225 29.626 106.293 65.179 1.00 31.20 C
ATOM 8357 CD2 TYR C 225 27.968 107.721 64.210 1.00 31.57 C
ATOM 8358 CE1 TYR C 225 28.843 105.173 64.870 1.00 28.79 C
ATOM 8359 CE2 TYR C 225 27.185 106.618 63.893 1.00 29.57 C
ATOM 8360 CZ TYR C 225 27.625 105.357 64.226 1.00 28.72 C
ATOM 8361 OH TYR C 225 26.821 104.294 63.934 1.00 29.75 O
ATOM 8362 N SER C 226 32.560 110.764 63.794 1.00 35.75 N
ATOM 8363 CA SER C 226 33.146 112.101 63.836 1.00 35.79 C
ATOM 8364 C SER C 226 32.707 112.751 62.520 1.00 35.88 C
ATOM 8365 O SER C 226 32.218 113.874 62.509 1.00 34.67 O
ATOM 8366 CB SER C 226 34.678 112.031 63.967 1.00 34.34 C
ATOM 8367 OG SER C 226 35.230 111.015 63.154 1.00 35.98 O
ATOM 8368 N PHE C 227 32.847 112.011 61.419 1.00 36.95 N
ATOM 8369 CA PHE C 227 32.434 112.480 60.096 1.00 38.39 C
ATOM 8370 C PHE C 227 30.921 112.658 60.013 1.00 38.37 C
ATOM 8371 O PHE C 227 30.430 113.641 59.459 1.00 39.17 O
ATOM 8372 CB PHE C 227 32.869 111.494 59.024 1.00 40.76 C
ATOM 8373 CG PHE C 227 34.235 111.759 58.491 1.00 45.74 C
ATOM 8374 CD1 PHE C 227 34.421 112.626 57.434 1.00 47.84 C
ATOM 8375 CD2 PHE C 227 35.352 111.181 59.077 1.00 48.21 C
ATOM 8376 CE1 PHE C 227 35.707 112.917 56.970 1.00 49.87 C
ATOM 8377 CE2 PHE C 227 36.633 111.469 58.617 1.00 48.45 C
ATOM 8378 CZ PHE C 227 36.810 112.337 57.566 1.00 47.36 C
ATOM 8379 N LYS C 228 30.174 111.701 60.549 1.00 37.22 N
ATOM 8380 CA LYS C 228 28.727 111.817 60.515 1.00 36.61 C
ATOM 8381 C LYS C 228 28.281 113.031 61.344 1.00 38.06 C
ATOM 8382 O LYS C 228 27.379 113.781 60.941 1.00 36.31 O
ATOM 8383 CB LYS C 228 28.080 110.545 61.054 1.00 34.38 C
ATOM 8384 CG LYS C 228 26.580 110.530 60.889 1.00 32.61 C
ATOM 8385 CD LYS C 228 25.981 109.170 61.180 1.00 32.56 C
ATOM 8386 CE LYS C 228 24.521 109.154 60.775 1.00 33.96 C
ATOM 8387 NZ LYS C 228 23.874 107.844 60.964 1.00 31.37 N
ATOM 8388 N ASP C 229 28.932 113.235 62.491 1.00 38.22 N
ATOM 8389 CA ASP C 229 28.593 114.355 63.368 1.00 38.79 C
ATOM 8390 C ASP C 229 28.897 115.717 62.756 1.00 38.67 C
ATOM 8391 O ASP C 229 28.097 116.639 62.859 1.00 38.47 O
ATOM 8392 CB ASP C 229 29.285 114.201 64.730 1.00 38.65 C
ATOM 8393 CG ASP C 229 28.501 113.287 65.687 1.00 40.38 C
ATOM 8394 OD1 ASP C 229 28.913 113.153 66.864 1.00 39.68 O
ATOM 8395 OD2 ASP C 229 27.472 112.704 65.258 1.00 39.31 O
ATOM 8396 N ILE C 230 30.049 115.842 62.112 1.00 40.39 N
ATOM 8397 CA ILE C 230 30.433 117.087 61.456 1.00 39.65 C
ATOM 8398 C ILE C 230 29.442 117.384 60.338 1.00 38.21 C
ATOM 8399 O ILE C 230 29.156 118.544 60.035 1.00 37.24 O
ATOM 8400 CB ILE C 230 31.833 116.963 60.839 1.00 42.08 C
ATOM 8401 CG1 ILE C 230 32.861 116.788 61.951 1.00 43.54 C
ATOM 8402 CG2 ILE C 230 32.146 118.183 60.000 1.00 41.30 C
ATOM 8403 CD1 ILE C 230 34.235 116.512 61.438 1.00 47.90 C
ATOM 8404 N LEU C 231 28.934 116.331 59.706 1.00 36.56 N
ATOM 8405 CA LEU C 231 27.970 116.523 58.634 1.00 37.09 C
ATOM 8406 C LEU C 231 26.669 117.056 59.234 1.00 37.53 C
ATOM 8407 O LEU C 231 26.104 118.040 58.740 1.00 38.33 O
ATOM 8408 CB LEU C 231 27.715 115.210 57.883 1.00 35.25 C
ATOM 8409 CG LEU C 231 26.550 115.239 56.883 1.00 34.21 C
ATOM 8410 CD1 LEU C 231 26.701 116.375 55.880 1.00 31.40 C
ATOM 8411 CD2 LEU C 231 26.486 113.904 56.182 1.00 34.70 C
ATOM 8412 N GLY C 232 26.207 116.405 60.301 1.00 37.20 N
ATOM 8413 CA GLY C 232 24.995 116.834 60.966 1.00 36.47 C
ATOM 8414 C GLY C 232 25.151 118.264 61.444 1.00 38.68 C
ATOM 8415 O GLY C 232 24.194 119.040 61.454 1.00 39.07 O
ATOM 8416 N LEU C 233 26.365 118.631 61.831 1.00 38.88 N
ATOM 8417 CA LEU C 233 26.603 119.982 62.292 1.00 39.48 C
ATOM 8418 C LEU C 233 26.317 120.978 61.193 1.00 41.45 C
ATOM 8419 O LEU C 233 25.543 121.906 61.397 1.00 45.05 O
ATOM 8420 CB LEU C 233 28.039 120.155 62.771 1.00 39.41 C
ATOM 8421 CG LEU C 233 28.409 121.592 63.152 1.00 41.16 C
ATOM 8422 CD1 LEU C 233 27.390 122.118 64.161 1.00 42.12 C
ATOM 8423 CD2 LEU C 233 29.822 121.661 63.707 1.00 38.53 C
ATOM 8424 N THR C 234 26.920 120.794 60.024 1.00 42.36 N
ATOM 8425 CA THR C 234 26.706 121.731 58.920 1.00 44.03 C
ATOM 8426 C THR C 234 25.280 121.726 58.364 1.00 44.69 C
ATOM 8427 O THR C 234 24.841 122.724 57.785 1.00 44.71 O
ATOM 8428 CB THR C 234 27.689 121.476 57.752 1.00 44.84 C
ATOM 8429 OG1 THR C 234 27.298 120.293 57.045 1.00 48.26 O
ATOM 8430 CG2 THR C 234 29.107 121.294 58.285 1.00 43.82 C
ATOM 8431 N LEU C 235 24.562 120.612 58.521 1.00 44.83 N
ATOM 8432 CA LEU C 235 23.187 120.549 58.044 1.00 45.43 C
ATOM 8433 C LEU C 235 22.278 121.421 58.905 1.00 47.94 C
ATOM 8434 O LEU C 235 21.422 122.128 58.384 1.00 49.50 O
ATOM 8435 CB LEU C 235 22.678 119.117 58.047 1.00 43.24 C
ATOM 8436 CG LEU C 235 23.256 118.249 56.933 1.00 42.58 C
ATOM 8437 CD1 LEU C 235 22.711 116.851 57.065 1.00 41.23 C
ATOM 8438 CD2 LEU C 235 22.906 118.829 55.572 1.00 40.10 C
ATOM 8439 N MET C 236 22.468 121.386 60.221 1.00 49.92 N
ATOM 8440 CA MET C 236 21.657 122.203 61.123 1.00 51.99 C
ATOM 8441 C MET C 236 22.170 123.634 61.158 1.00 52.42 C
ATOM 8442 O MET C 236 21.434 124.569 61.473 1.00 53.64 O
ATOM 8443 CB MET C 236 21.686 121.634 62.536 1.00 53.87 C
ATOM 8444 CG MET C 236 20.952 120.307 62.679 1.00 60.04 C
ATOM 8445 SD MET C 236 19.161 120.448 62.559 1.00 62.57 S
ATOM 8446 CE MET C 236 18.800 121.187 64.208 1.00 60.02 C
ATOM 8447 N LEU C 237 23.436 123.809 60.820 1.00 51.24 N
ATOM 8448 CA LEU C 237 24.031 125.129 60.835 1.00 50.25 C
ATOM 8449 C LEU C 237 23.472 126.046 59.752 1.00 49.54 C
ATOM 8450 O LEU C 237 23.510 127.269 59.896 1.00 49.98 O
ATOM 8451 CB LEU C 237 25.539 125.001 60.686 1.00 50.68 C
ATOM 8452 CG LEU C 237 26.381 126.135 61.263 1.00 52.15 C
ATOM 8453 CD1 LEU C 237 25.998 126.393 62.726 1.00 50.40 C
ATOM 8454 CD2 LEU C 237 27.850 125.749 61.136 1.00 52.61 C
ATOM 8455 N THR C 238 22.952 125.469 58.671 1.00 49.03 N
ATOM 8456 CA THR C 238 22.389 126.275 57.587 1.00 48.45 C
ATOM 8457 C THR C 238 21.120 127.018 58.036 1.00 47.61 C
ATOM 8458 O THR C 238 21.061 128.248 57.963 1.00 48.71 O
ATOM 8459 CB THR C 238 22.093 125.406 56.358 1.00 48.65 C
ATOM 8460 OG1 THR C 238 23.326 124.907 55.833 1.00 48.07 O
ATOM 8461 CG2 THR C 238 21.394 126.209 55.291 1.00 48.73 C
ATOM 8462 N PRO C 239 20.089 126.289 58.504 1.00 45.69 N
ATOM 8463 CA PRO C 239 18.860 126.956 58.955 1.00 43.80 C
ATOM 8464 C PRO C 239 19.190 128.016 60.007 1.00 43.47 C
ATOM 8465 O PRO C 239 18.718 129.145 59.933 1.00 44.59 O
ATOM 8466 CB PRO C 239 18.049 125.814 59.540 1.00 44.75 C
ATOM 8467 CG PRO C 239 18.473 124.649 58.689 1.00 44.28 C
ATOM 8468 CD PRO C 239 19.960 124.824 58.595 1.00 43.67 C
ATOM 8469 N PHE C 240 20.013 127.639 60.982 1.00 42.31 N
ATOM 8470 CA PHE C 240 20.449 128.537 62.053 1.00 41.86 C
ATOM 8471 C PHE C 240 20.973 129.832 61.456 1.00 41.20 C
ATOM 8472 O PHE C 240 20.489 130.914 61.778 1.00 41.36 O
ATOM 8473 CB PHE C 240 21.562 127.860 62.886 1.00 43.53 C
ATOM 8474 CG PHE C 240 22.181 128.739 63.969 1.00 43.12 C
ATOM 8475 CD1 PHE C 240 23.514 128.571 64.336 1.00 45.08 C
ATOM 8476 CD2 PHE C 240 21.449 129.707 64.622 1.00 43.70 C
ATOM 8477 CE1 PHE C 240 24.107 129.358 65.337 1.00 43.95 C
ATOM 8478 CE2 PHE C 240 22.034 130.494 65.616 1.00 44.54 C
ATOM 8479 CZ PHE C 240 23.367 130.314 65.969 1.00 43.61 C
ATOM 8480 N LEU C 241 21.970 129.726 60.589 1.00 41.36 N
ATOM 8481 CA LEU C 241 22.532 130.922 59.971 1.00 42.43 C
ATOM 8482 C LEU C 241 21.556 131.641 59.044 1.00 41.14 C
ATOM 8483 O LEU C 241 21.561 132.868 58.974 1.00 39.92 O
ATOM 8484 CB LEU C 241 23.812 130.580 59.213 1.00 42.14 C
ATOM 8485 CG LEU C 241 24.927 130.053 60.108 1.00 40.24 C
ATOM 8486 CD1 LEU C 241 26.187 129.997 59.293 1.00 41.73 C
ATOM 8487 CD2 LEU C 241 25.117 130.946 61.318 1.00 37.56 C
ATOM 8488 N THR C 242 20.729 130.876 58.337 1.00 41.24 N
ATOM 8489 CA THR C 242 19.733 131.455 57.441 1.00 43.01 C
ATOM 8490 C THR C 242 18.757 132.290 58.262 1.00 44.98 C
ATOM 8491 O THR C 242 18.415 133.422 57.901 1.00 45.22 O
ATOM 8492 CB THR C 242 18.948 130.369 56.713 1.00 42.46 C
ATOM 8493 OG1 THR C 242 19.830 129.665 55.831 1.00 41.64 O
ATOM 8494 CG2 THR C 242 17.788 130.983 55.926 1.00 39.51 C
ATOM 8495 N LEU C 243 18.314 131.723 59.376 1.00 45.22 N
ATOM 8496 CA LEU C 243 17.404 132.428 60.256 1.00 46.16 C
ATOM 8497 C LEU C 243 18.109 133.663 60.799 1.00 45.12 C
ATOM 8498 O LEU C 243 17.661 134.778 60.607 1.00 47.48 O
ATOM 8499 CB LEU C 243 16.995 131.524 61.411 1.00 48.61 C
ATOM 8500 CG LEU C 243 15.949 132.104 62.353 1.00 50.29 C
ATOM 8501 CD1 LEU C 243 14.636 132.273 61.601 1.00 49.98 C
ATOM 8502 CD2 LEU C 243 15.779 131.173 63.544 1.00 50.95 C
ATOM 8503 N ALA C 244 19.228 133.459 61.469 1.00 43.92 N
ATOM 8504 CA ALA C 244 19.967 134.570 62.034 1.00 44.82 C
ATOM 8505 C ALA C 244 20.383 135.639 61.031 1.00 45.01 C
ATOM 8506 O ALA C 244 20.420 136.824 61.355 1.00 47.19 O
ATOM 8507 CB ALA C 244 21.204 134.055 62.772 1.00 44.87 C
ATOM 8508 N LEU C 245 20.711 135.244 59.814 1.00 44.95 N
ATOM 8509 CA LEU C 245 21.151 136.241 58.850 1.00 43.87 C
ATOM 8510 C LEU C 245 20.088 136.808 57.926 1.00 43.64 C
ATOM 8511 O LEU C 245 20.269 137.896 57.387 1.00 43.67 O
ATOM 8512 CB LEU C 245 22.304 135.692 58.018 1.00 42.26 C
ATOM 8513 CG LEU C 245 23.630 135.630 58.754 1.00 40.58 C
ATOM 8514 CD1 LEU C 245 24.720 135.179 57.794 1.00 39.15 C
ATOM 8515 CD2 LEU C 245 23.946 137.011 59.302 1.00 40.13 C
ATOM 8516 N PHE C 246 18.985 136.092 57.738 1.00 42.56 N
ATOM 8517 CA PHE C 246 17.946 136.595 56.855 1.00 42.85 C
ATOM 8518 C PHE C 246 16.634 136.911 57.552 1.00 43.96 C
ATOM 8519 O PHE C 246 15.768 137.552 56.966 1.00 45.15 O
ATOM 8520 CB PHE C 246 17.691 135.605 55.722 1.00 42.10 C
ATOM 8521 CG PHE C 246 18.836 135.493 54.749 1.00 44.00 C
ATOM 8522 CD1 PHE C 246 19.571 134.311 54.641 1.00 41.97 C
ATOM 8523 CD2 PHE C 246 19.180 136.570 53.935 1.00 43.52 C
ATOM 8524 CE1 PHE C 246 20.620 134.206 53.742 1.00 40.81 C
ATOM 8525 CE2 PHE C 246 20.234 136.466 53.029 1.00 43.33 C
ATOM 8526 CZ PHE C 246 20.951 135.279 52.937 1.00 41.51 C
ATOM 8527 N SER C 247 16.499 136.488 58.806 1.00 43.71 N
ATOM 8528 CA SER C 247 15.276 136.700 59.557 1.00 41.86 C
ATOM 8529 C SER C 247 15.596 136.756 61.059 1.00 41.65 C
ATOM 8530 O SER C 247 15.022 136.022 61.868 1.00 41.74 O
ATOM 8531 CB SER C 247 14.338 135.549 59.242 1.00 41.43 C
ATOM 8532 OG SER C 247 13.027 135.832 59.673 1.00 49.56 O
ATOM 8533 N PRO C 248 16.498 137.664 61.451 1.00 41.43 N
ATOM 8534 CA PRO C 248 16.954 137.870 62.830 1.00 40.86 C
ATOM 8535 C PRO C 248 15.863 137.963 63.865 1.00 41.54 C
ATOM 8536 O PRO C 248 16.032 137.515 64.995 1.00 44.07 O
ATOM 8537 CB PRO C 248 17.715 139.190 62.767 1.00 39.25 C
ATOM 8538 CG PRO C 248 18.046 139.361 61.347 1.00 41.77 C
ATOM 8539 CD PRO C 248 16.859 138.821 60.619 1.00 41.66 C
ATOM 8540 N ASN C 249 14.739 138.547 63.484 1.00 42.02 N
ATOM 8541 CA ASN C 249 13.664 138.758 64.437 1.00 41.86 C
ATOM 8542 C ASN C 249 12.439 137.903 64.252 1.00 41.22 C
ATOM 8543 O ASN C 249 11.392 138.175 64.826 1.00 43.78 O
ATOM 8544 CB ASN C 249 13.274 140.227 64.407 1.00 43.54 C
ATOM 8545 CG ASN C 249 14.472 141.137 64.594 1.00 47.98 C
ATOM 8546 OD1 ASN C 249 15.228 140.993 65.567 1.00 48.42 O
ATOM 8547 ND2 ASN C 249 14.663 142.079 63.658 1.00 48.90 N
ATOM 8548 N LEU C 250 12.549 136.864 63.453 1.00 38.57 N
ATOM 8549 CA LEU C 250 11.400 136.027 63.257 1.00 38.18 C
ATOM 8550 C LEU C 250 10.872 135.484 64.595 1.00 38.29 C
ATOM 8551 O LEU C 250 9.678 135.458 64.837 1.00 38.89 O
ATOM 8552 CB LEU C 250 11.772 134.869 62.333 1.00 39.36 C
ATOM 8553 CG LEU C 250 10.628 133.922 61.988 1.00 39.82 C
ATOM 8554 CD1 LEU C 250 9.694 134.601 61.010 1.00 38.95 C
ATOM 8555 CD2 LEU C 250 11.189 132.653 61.401 1.00 40.22 C
ATOM 8556 N LEU C 251 11.767 135.083 65.483 1.00 39.04 N
ATOM 8557 CA LEU C 251 11.352 134.483 66.746 1.00 40.31 C
ATOM 8558 C LEU C 251 11.134 135.373 67.978 1.00 40.39 C
ATOM 8559 O LEU C 251 10.564 134.910 68.971 1.00 41.65 O
ATOM 8560 CB LEU C 251 12.346 133.372 67.108 1.00 40.23 C
ATOM 8561 CG LEU C 251 12.517 132.287 66.046 1.00 40.83 C
ATOM 8562 CD1 LEU C 251 13.700 131.407 66.399 1.00 39.14 C
ATOM 8563 CD2 LEU C 251 11.219 131.477 65.931 1.00 40.52 C
ATOM 8564 N GLY C 252 11.577 136.627 67.927 1.00 38.30 N
ATOM 8565 CA GLY C 252 11.428 137.501 69.078 1.00 37.12 C
ATOM 8566 C GLY C 252 10.190 138.374 69.108 1.00 36.37 C
ATOM 8567 O GLY C 252 9.568 138.620 68.077 1.00 39.41 O
ATOM 8568 N ASP C 253 9.845 138.864 70.292 1.00 33.53 N
ATOM 8569 CA ASP C 253 8.673 139.699 70.449 1.00 33.70 C
ATOM 8570 C ASP C 253 9.049 141.151 70.263 1.00 33.53 C
ATOM 8571 O ASP C 253 9.897 141.675 70.986 1.00 35.01 O
ATOM 8572 CB ASP C 253 8.074 139.521 71.841 1.00 35.14 C
ATOM 8573 CG ASP C 253 6.689 140.135 71.961 1.00 38.55 C
ATOM 8574 OD1 ASP C 253 6.487 141.275 71.476 1.00 38.38 O
ATOM 8575 OD2 ASP C 253 5.799 139.478 72.548 1.00 43.23 O
ATOM 8576 N PRO C 254 8.417 141.834 69.298 1.00 31.96 N
ATOM 8577 CA PRO C 254 8.736 143.249 69.070 1.00 30.04 C
ATOM 8578 C PRO C 254 8.678 144.061 70.350 1.00 29.10 C
ATOM 8579 O PRO C 254 9.294 145.131 70.464 1.00 30.61 O
ATOM 8580 CB PRO C 254 7.670 143.693 68.071 1.00 29.05 C
ATOM 8581 CG PRO C 254 6.550 142.720 68.307 1.00 31.03 C
ATOM 8582 CD PRO C 254 7.271 141.416 68.478 1.00 29.48 C
ATOM 8583 N GLU C 255 7.939 143.538 71.316 1.00 26.70 N
ATOM 8584 CA GLU C 255 7.766 144.219 72.583 1.00 26.90 C
ATOM 8585 C GLU C 255 9.107 144.373 73.300 1.00 26.79 C
ATOM 8586 O GLU C 255 9.271 145.271 74.135 1.00 27.49 O
ATOM 8587 CB GLU C 255 6.772 143.446 73.443 1.00 25.81 C
ATOM 8588 CG GLU C 255 6.285 144.191 74.637 1.00 35.28 C
ATOM 8589 CD GLU C 255 5.113 145.127 74.335 1.00 40.24 C
ATOM 8590 OE1 GLU C 255 4.044 144.622 73.893 1.00 41.30 O
ATOM 8591 OE2 GLU C 255 5.262 146.362 74.557 1.00 40.78 O
ATOM 8592 N ASN C 256 10.085 143.536 72.947 1.00 25.60 N
ATOM 8593 CA ASN C 256 11.375 143.617 73.617 1.00 25.48 C
ATOM 8594 C ASN C 256 12.309 144.641 73.045 1.00 25.78 C
ATOM 8595 O ASN C 256 13.489 144.683 73.396 1.00 27.18 O
ATOM 8596 CB ASN C 256 12.056 142.261 73.675 1.00 26.60 C
ATOM 8597 CG ASN C 256 12.527 141.914 75.082 1.00 29.81 C
ATOM 8598 OD1 ASN C 256 11.971 142.398 76.078 1.00 31.76 O
ATOM 8599 ND2 ASN C 256 13.539 141.059 75.176 1.00 33.13 N
ATOM 8600 N PHE C 257 11.778 145.468 72.154 1.00 25.51 N
ATOM 8601 CA PHE C 257 12.543 146.552 71.574 1.00 23.77 C
ATOM 8602 C PHE C 257 12.075 147.825 72.264 1.00 25.03 C
ATOM 8603 O PHE C 257 12.351 148.938 71.826 1.00 25.83 O
ATOM 8604 CB PHE C 257 12.287 146.646 70.090 1.00 23.25 C
ATOM 8605 CG PHE C 257 13.103 145.692 69.278 1.00 22.60 C
ATOM 8606 CD1 PHE C 257 12.592 144.463 68.902 1.00 19.56 C
ATOM 8607 CD2 PHE C 257 14.390 146.046 68.859 1.00 21.18 C
ATOM 8608 CE1 PHE C 257 13.364 143.593 68.101 1.00 21.10 C
ATOM 8609 CE2 PHE C 257 15.157 145.189 68.070 1.00 20.47 C
ATOM 8610 CZ PHE C 257 14.651 143.962 67.686 1.00 15.02 C
ATOM 8611 N THR C 258 11.348 147.646 73.356 1.00 25.82 N
ATOM 8612 CA THR C 258 10.858 148.770 74.120 1.00 27.42 C
ATOM 8613 C THR C 258 11.346 148.640 75.557 1.00 28.28 C
ATOM 8614 O THR C 258 11.017 147.667 76.238 1.00 30.12 O
ATOM 8615 CB THR C 258 9.331 148.798 74.145 1.00 28.08 C
ATOM 8616 OG1 THR C 258 8.842 148.934 72.813 1.00 29.53 O
ATOM 8617 CG2 THR C 258 8.837 149.952 74.990 1.00 23.01 C
ATOM 8618 N PRO C 259 12.136 149.615 76.036 1.00 26.69 N
ATOM 8619 CA PRO C 259 12.646 149.578 77.406 1.00 25.79 C
ATOM 8620 C PRO C 259 11.570 149.219 78.422 1.00 26.19 C
ATOM 8621 O PRO C 259 10.473 149.761 78.402 1.00 26.02 O
ATOM 8622 CB PRO C 259 13.170 150.999 77.612 1.00 23.10 C
ATOM 8623 CG PRO C 259 13.711 151.329 76.307 1.00 23.52 C
ATOM 8624 CD PRO C 259 12.652 150.799 75.328 1.00 25.62 C
ATOM 8625 N ALA C 260 11.907 148.298 79.310 1.00 28.23 N
ATOM 8626 CA ALA C 260 11.012 147.869 80.368 1.00 28.72 C
ATOM 8627 C ALA C 260 10.351 149.066 81.020 1.00 29.58 C
ATOM 8628 O ALA C 260 11.020 150.048 81.306 1.00 29.37 O
ATOM 8629 CB ALA C 260 11.797 147.107 81.413 1.00 26.45 C
ATOM 8630 N ASN C 261 9.041 148.965 81.243 1.00 30.63 N
ATOM 8631 CA ASN C 261 8.245 149.999 81.898 1.00 31.99 C
ATOM 8632 C ASN C 261 7.474 149.316 83.021 1.00 34.40 C
ATOM 8633 O ASN C 261 6.521 148.571 82.775 1.00 34.58 O
ATOM 8634 CB ASN C 261 7.243 150.600 80.927 1.00 33.32 C
ATOM 8635 CG ASN C 261 6.415 151.702 81.555 1.00 34.23 C
ATOM 8636 OD1 ASN C 261 6.140 151.690 82.759 1.00 34.10 O
ATOM 8637 ND2 ASN C 261 5.994 152.652 80.737 1.00 34.03 N
ATOM 8638 N PRO C 262 7.865 149.565 84.274 1.00 37.65 N
ATOM 8639 CA PRO C 262 7.214 148.963 85.448 1.00 39.04 C
ATOM 8640 C PRO C 262 5.724 149.221 85.563 1.00 38.43 C
ATOM 8641 O PRO C 262 5.012 148.428 86.151 1.00 38.52 O
ATOM 8642 CB PRO C 262 7.970 149.578 86.626 1.00 39.38 C
ATOM 8643 CG PRO C 262 9.325 149.867 86.053 1.00 39.97 C
ATOM 8644 CD PRO C 262 8.987 150.425 84.684 1.00 38.89 C
ATOM 8645 N LEU C 263 5.261 150.323 84.989 1.00 38.81 N
ATOM 8646 CA LEU C 263 3.858 150.705 85.087 1.00 40.89 C
ATOM 8647 C LEU C 263 2.936 150.262 83.967 1.00 43.44 C
ATOM 8648 O LEU C 263 1.723 150.279 84.129 1.00 47.31 O
ATOM 8649 CB LEU C 263 3.765 152.218 85.234 1.00 40.51 C
ATOM 8650 CG LEU C 263 4.535 152.765 86.439 1.00 38.55 C
ATOM 8651 CD1 LEU C 263 4.723 154.259 86.329 1.00 35.84 C
ATOM 8652 CD2 LEU C 263 3.787 152.383 87.691 1.00 38.04 C
ATOM 8653 N VAL C 264 3.492 149.868 82.833 1.00 43.83 N
ATOM 8654 CA VAL C 264 2.670 149.416 81.727 1.00 43.88 C
ATOM 8655 C VAL C 264 2.991 147.977 81.356 1.00 45.55 C
ATOM 8656 O VAL C 264 4.126 147.672 81.005 1.00 46.64 O
ATOM 8657 CB VAL C 264 2.899 150.291 80.498 1.00 42.56 C
ATOM 8658 CG1 VAL C 264 1.999 149.854 79.379 1.00 38.78 C
ATOM 8659 CG2 VAL C 264 2.668 151.735 80.862 1.00 40.99 C
ATOM 8660 N THR C 265 2.003 147.091 81.449 1.00 47.12 N
ATOM 8661 CA THR C 265 2.215 145.695 81.079 1.00 47.79 C
ATOM 8662 C THR C 265 1.735 145.494 79.650 1.00 46.59 C
ATOM 8663 O THR C 265 0.673 145.962 79.271 1.00 46.08 O
ATOM 8664 CB THR C 265 1.436 144.732 81.985 1.00 49.61 C
ATOM 8665 OG1 THR C 265 1.890 144.881 83.335 1.00 51.84 O
ATOM 8666 CG2 THR C 265 1.657 143.288 81.541 1.00 50.15 C
ATOM 8667 N PRO C 266 2.522 144.800 78.831 1.00 46.57 N
ATOM 8668 CA PRO C 266 2.091 144.585 77.448 1.00 46.68 C
ATOM 8669 C PRO C 266 0.740 143.872 77.365 1.00 46.62 C
ATOM 8670 O PRO C 266 0.443 142.990 78.155 1.00 45.59 O
ATOM 8671 CB PRO C 266 3.231 143.756 76.859 1.00 45.83 C
ATOM 8672 CG PRO C 266 4.423 144.252 77.614 1.00 45.89 C
ATOM 8673 CD PRO C 266 3.900 144.324 79.038 1.00 46.15 C
ATOM 8674 N PRO C 267 -0.087 144.248 76.387 1.00 48.41 N
ATOM 8675 CA PRO C 267 -1.410 143.671 76.177 1.00 49.92 C
ATOM 8676 C PRO C 267 -1.360 142.169 76.039 1.00 52.25 C
ATOM 8677 O PRO C 267 -2.177 141.460 76.621 1.00 54.48 O
ATOM 8678 CB PRO C 267 -1.875 144.337 74.895 1.00 49.63 C
ATOM 8679 CG PRO C 267 -1.159 145.630 74.905 1.00 50.03 C
ATOM 8680 CD PRO C 267 0.215 145.217 75.324 1.00 49.78 C
ATOM 8681 N HIS C 268 -0.416 141.670 75.257 1.00 54.66 N
ATOM 8682 CA HIS C 268 -0.316 140.227 75.094 1.00 57.79 C
ATOM 8683 C HIS C 268 1.070 139.698 75.415 1.00 57.99 C
ATOM 8684 O HIS C 268 1.976 139.637 74.571 1.00 60.15 O
ATOM 8685 CB HIS C 268 -0.760 139.813 73.692 1.00 61.71 C
ATOM 8686 CG HIS C 268 -2.219 140.045 73.440 1.00 66.83 C
ATOM 8687 ND1 HIS C 268 -2.705 141.207 72.870 1.00 67.50 N
ATOM 8688 CD2 HIS C 268 -3.305 139.294 73.751 1.00 67.88 C
ATOM 8689 CE1 HIS C 268 -4.026 141.162 72.845 1.00 69.32 C
ATOM 8690 NE2 HIS C 268 -4.415 140.012 73.373 1.00 70.86 N
ATOM 8691 N ILE C 269 1.216 139.349 76.684 1.00 55.66 N
ATOM 8692 CA ILE C 269 2.440 138.816 77.223 1.00 53.07 C
ATOM 8693 C ILE C 269 2.529 137.394 76.699 1.00 52.23 C
ATOM 8694 O ILE C 269 1.702 136.549 77.039 1.00 54.45 O
ATOM 8695 CB ILE C 269 2.363 138.850 78.764 1.00 52.38 C
ATOM 8696 CG1 ILE C 269 3.016 140.127 79.266 1.00 53.67 C
ATOM 8697 CG2 ILE C 269 2.971 137.615 79.375 1.00 52.47 C
ATOM 8698 CD1 ILE C 269 2.969 140.297 80.764 1.00 56.03 C
ATOM 8699 N LYS C 270 3.511 137.132 75.850 1.00 48.99 N
ATOM 8700 CA LYS C 270 3.662 135.801 75.302 1.00 47.02 C
ATOM 8701 C LYS C 270 5.124 135.381 75.390 1.00 44.33 C
ATOM 8702 O LYS C 270 6.012 136.112 74.955 1.00 46.21 O
ATOM 8703 CB LYS C 270 3.153 135.779 73.852 1.00 48.91 C
ATOM 8704 CG LYS C 270 4.079 135.097 72.859 1.00 51.88 C
ATOM 8705 CD LYS C 270 3.467 134.948 71.477 1.00 54.40 C
ATOM 8706 CE LYS C 270 4.477 134.275 70.543 1.00 59.40 C
ATOM 8707 NZ LYS C 270 3.905 133.789 69.236 1.00 63.24 N
ATOM 8708 N PRO C 271 5.392 134.197 75.968 1.00 40.55 N
ATOM 8709 CA PRO C 271 6.750 133.668 76.124 1.00 36.91 C
ATOM 8710 C PRO C 271 7.404 133.194 74.843 1.00 35.30 C
ATOM 8711 O PRO C 271 6.752 133.044 73.811 1.00 35.42 O
ATOM 8712 CB PRO C 271 6.563 132.527 77.120 1.00 35.93 C
ATOM 8713 CG PRO C 271 5.205 132.042 76.816 1.00 37.71 C
ATOM 8714 CD PRO C 271 4.418 133.322 76.645 1.00 39.59 C
ATOM 8715 N GLU C 272 8.709 132.972 74.926 1.00 32.87 N
ATOM 8716 CA GLU C 272 9.476 132.483 73.810 1.00 30.39 C
ATOM 8717 C GLU C 272 8.856 131.152 73.369 1.00 30.86 C
ATOM 8718 O GLU C 272 8.272 130.420 74.180 1.00 29.53 O
ATOM 8719 CB GLU C 272 10.921 132.326 74.247 1.00 31.34 C
ATOM 8720 CG GLU C 272 11.621 133.674 74.472 1.00 35.50 C
ATOM 8721 CD GLU C 272 11.757 134.500 73.193 1.00 37.71 C
ATOM 8722 OE1 GLU C 272 12.605 134.151 72.345 1.00 38.10 O
ATOM 8723 OE2 GLU C 272 11.006 135.493 73.031 1.00 38.77 O
ATOM 8724 N TRP C 273 8.972 130.837 72.081 1.00 30.26 N
ATOM 8725 CA TRP C 273 8.361 129.625 71.555 1.00 27.18 C
ATOM 8726 C TRP C 273 8.633 128.360 72.318 1.00 27.68 C
ATOM 8727 O TRP C 273 7.747 127.522 72.429 1.00 29.64 O
ATOM 8728 CB TRP C 273 8.749 129.408 70.094 1.00 25.76 C
ATOM 8729 CG TRP C 273 10.153 128.945 69.897 1.00 25.87 C
ATOM 8730 CD1 TRP C 273 11.267 129.724 69.709 1.00 24.64 C
ATOM 8731 CD2 TRP C 273 10.611 127.592 69.930 1.00 23.74 C
ATOM 8732 NE1 TRP C 273 12.386 128.936 69.629 1.00 23.68 N
ATOM 8733 CE2 TRP C 273 12.014 127.623 69.764 1.00 22.93 C
ATOM 8734 CE3 TRP C 273 9.972 126.359 70.090 1.00 21.51 C
ATOM 8735 CZ2 TRP C 273 12.788 126.469 69.754 1.00 23.24 C
ATOM 8736 CZ3 TRP C 273 10.743 125.207 70.082 1.00 24.97 C
ATOM 8737 CH2 TRP C 273 12.140 125.270 69.915 1.00 25.79 C
ATOM 8738 N TYR C 274 9.834 128.202 72.860 1.00 28.39 N
ATOM 8739 CA TYR C 274 10.147 126.950 73.553 1.00 30.54 C
ATOM 8740 C TYR C 274 9.530 126.794 74.932 1.00 32.58 C
ATOM 8741 O TYR C 274 9.699 125.764 75.597 1.00 34.01 O
ATOM 8742 CB TYR C 274 11.660 126.739 73.620 1.00 28.35 C
ATOM 8743 CG TYR C 274 12.414 127.948 74.097 1.00 27.77 C
ATOM 8744 CD1 TYR C 274 12.489 128.251 75.450 1.00 26.51 C
ATOM 8745 CD2 TYR C 274 13.065 128.786 73.197 1.00 26.71 C
ATOM 8746 CE1 TYR C 274 13.191 129.345 75.895 1.00 25.68 C
ATOM 8747 CE2 TYR C 274 13.775 129.892 73.638 1.00 26.62 C
ATOM 8748 CZ TYR C 274 13.830 130.159 74.998 1.00 27.14 C
ATOM 8749 OH TYR C 274 14.530 131.242 75.477 1.00 30.14 O
ATOM 8750 N PHE C 275 8.794 127.803 75.367 1.00 32.73 N
ATOM 8751 CA PHE C 275 8.158 127.706 76.663 1.00 32.60 C
ATOM 8752 C PHE C 275 6.636 127.709 76.514 1.00 31.27 C
ATOM 8753 O PHE C 275 5.921 127.493 77.485 1.00 32.76 O
ATOM 8754 CB PHE C 275 8.616 128.860 77.571 1.00 33.60 C
ATOM 8755 CG PHE C 275 8.004 128.828 78.948 1.00 34.36 C
ATOM 8756 CD1 PHE C 275 8.274 127.790 79.824 1.00 37.41 C
ATOM 8757 CD2 PHE C 275 7.126 129.817 79.354 1.00 36.67 C
ATOM 8758 CE1 PHE C 275 7.670 127.743 81.090 1.00 37.08 C
ATOM 8759 CE2 PHE C 275 6.516 129.774 80.620 1.00 35.69 C
ATOM 8760 CZ PHE C 275 6.793 128.738 81.479 1.00 34.78 C
ATOM 8761 N LEU C 276 6.147 127.938 75.298 1.00 29.55 N
ATOM 8762 CA LEU C 276 4.706 127.993 75.034 1.00 28.57 C
ATOM 8763 C LEU C 276 3.890 126.795 75.518 1.00 29.73 C
ATOM 8764 O LEU C 276 2.928 126.976 76.247 1.00 30.19 O
ATOM 8765 CB LEU C 276 4.459 128.215 73.545 1.00 26.20 C
ATOM 8766 CG LEU C 276 4.835 129.625 73.070 1.00 27.20 C
ATOM 8767 CD1 LEU C 276 4.825 129.712 71.553 1.00 24.46 C
ATOM 8768 CD2 LEU C 276 3.855 130.636 73.666 1.00 26.16 C
ATOM 8769 N PHE C 277 4.276 125.580 75.135 1.00 30.98 N
ATOM 8770 CA PHE C 277 3.547 124.382 75.545 1.00 30.18 C
ATOM 8771 C PHE C 277 3.391 124.282 77.060 1.00 31.61 C
ATOM 8772 O PHE C 277 2.334 123.861 77.556 1.00 31.82 O
ATOM 8773 CB PHE C 277 4.248 123.128 75.019 1.00 30.45 C
ATOM 8774 CG PHE C 277 5.381 122.649 75.879 1.00 29.70 C
ATOM 8775 CD1 PHE C 277 5.148 121.781 76.938 1.00 29.56 C
ATOM 8776 CD2 PHE C 277 6.679 123.087 75.644 1.00 32.54 C
ATOM 8777 CE1 PHE C 277 6.186 121.357 77.757 1.00 30.00 C
ATOM 8778 CE2 PHE C 277 7.729 122.676 76.451 1.00 31.50 C
ATOM 8779 CZ PHE C 277 7.480 121.804 77.517 1.00 32.20 C
ATOM 8780 N ALA C 278 4.440 124.653 77.796 1.00 30.57 N
ATOM 8781 CA ALA C 278 4.385 124.599 79.255 1.00 30.59 C
ATOM 8782 C ALA C 278 3.474 125.714 79.753 1.00 31.87 C
ATOM 8783 O ALA C 278 2.665 125.512 80.650 1.00 33.84 O
ATOM 8784 CB ALA C 278 5.768 124.756 79.841 1.00 28.09 C
ATOM 8785 N TYR C 279 3.598 126.891 79.157 1.00 31.70 N
ATOM 8786 CA TYR C 279 2.775 128.013 79.555 1.00 31.77 C
ATOM 8787 C TYR C 279 1.323 127.592 79.377 1.00 33.25 C
ATOM 8788 O TYR C 279 0.494 127.814 80.266 1.00 35.64 O
ATOM 8789 CB TYR C 279 3.100 129.227 78.691 1.00 29.64 C
ATOM 8790 CG TYR C 279 2.528 130.531 79.190 1.00 30.51 C
ATOM 8791 CD1 TYR C 279 2.784 130.985 80.487 1.00 31.56 C
ATOM 8792 CD2 TYR C 279 1.778 131.348 78.339 1.00 32.23 C
ATOM 8793 CE1 TYR C 279 2.311 132.229 80.918 1.00 33.07 C
ATOM 8794 CE2 TYR C 279 1.298 132.578 78.752 1.00 32.81 C
ATOM 8795 CZ TYR C 279 1.565 133.017 80.033 1.00 35.03 C
ATOM 8796 OH TYR C 279 1.074 134.248 80.402 1.00 40.33 O
ATOM 8797 N ALA C 280 1.030 126.963 78.240 1.00 31.97 N
ATOM 8798 CA ALA C 280 -0.318 126.498 77.928 1.00 31.79 C
ATOM 8799 C ALA C 280 -0.852 125.655 79.069 1.00 32.52 C
ATOM 8800 O ALA C 280 -1.996 125.824 79.518 1.00 33.67 O
ATOM 8801 CB ALA C 280 -0.308 125.681 76.653 1.00 28.90 C
ATOM 8802 N ILE C 281 -0.016 124.746 79.542 1.00 32.08 N
ATOM 8803 CA ILE C 281 -0.415 123.881 80.628 1.00 32.95 C
ATOM 8804 C ILE C 281 -0.665 124.697 81.905 1.00 35.78 C
ATOM 8805 O ILE C 281 -1.665 124.487 82.601 1.00 37.22 O
ATOM 8806 CB ILE C 281 0.644 122.776 80.849 1.00 29.61 C
ATOM 8807 CG1 ILE C 281 0.574 121.777 79.680 1.00 27.72 C
ATOM 8808 CG2 ILE C 281 0.396 122.052 82.163 1.00 30.75 C
ATOM 8809 CD1 ILE C 281 1.692 120.731 79.636 1.00 22.15 C
ATOM 8810 N LEU C 282 0.216 125.646 82.200 1.00 36.54 N
ATOM 8811 CA LEU C 282 0.057 126.466 83.392 1.00 36.83 C
ATOM 8812 C LEU C 282 -1.302 127.133 83.439 1.00 39.04 C
ATOM 8813 O LEU C 282 -1.914 127.237 84.501 1.00 40.07 O
ATOM 8814 CB LEU C 282 1.122 127.551 83.432 1.00 37.26 C
ATOM 8815 CG LEU C 282 0.865 128.674 84.443 1.00 37.84 C
ATOM 8816 CD1 LEU C 282 1.041 128.159 85.866 1.00 38.05 C
ATOM 8817 CD2 LEU C 282 1.819 129.818 84.179 1.00 37.17 C
ATOM 8818 N ARG C 283 -1.772 127.588 82.282 1.00 40.80 N
ATOM 8819 CA ARG C 283 -3.046 128.285 82.201 1.00 42.09 C
ATOM 8820 C ARG C 283 -4.270 127.389 82.194 1.00 43.23 C
ATOM 8821 O ARG C 283 -5.377 127.851 82.471 1.00 44.05 O
ATOM 8822 CB ARG C 283 -3.068 129.182 80.961 1.00 42.42 C
ATOM 8823 CG ARG C 283 -1.919 130.169 80.913 1.00 44.15 C
ATOM 8824 CD ARG C 283 -2.159 131.286 79.916 1.00 44.98 C
ATOM 8825 NE ARG C 283 -2.223 130.819 78.535 1.00 49.25 N
ATOM 8826 CZ ARG C 283 -2.313 131.630 77.480 1.00 50.48 C
ATOM 8827 NH1 ARG C 283 -2.356 132.941 77.654 1.00 51.63 N
ATOM 8828 NH2 ARG C 283 -2.342 131.139 76.247 1.00 51.59 N
ATOM 8829 N SER C 284 -4.082 126.113 81.883 1.00 44.52 N
ATOM 8830 CA SER C 284 -5.216 125.188 81.824 1.00 46.49 C
ATOM 8831 C SER C 284 -5.949 125.115 83.153 1.00 47.33 C
ATOM 8832 O SER C 284 -7.168 124.997 83.194 1.00 46.33 O
ATOM 8833 CB SER C 284 -4.756 123.782 81.409 1.00 45.18 C
ATOM 8834 OG SER C 284 -3.849 123.230 82.344 1.00 41.72 O
ATOM 8835 N ILE C 285 -5.190 125.182 84.238 1.00 49.67 N
ATOM 8836 CA ILE C 285 -5.764 125.138 85.572 1.00 51.57 C
ATOM 8837 C ILE C 285 -5.970 126.565 86.065 1.00 54.24 C
ATOM 8838 O ILE C 285 -5.008 127.261 86.416 1.00 54.90 O
ATOM 8839 CB ILE C 285 -4.843 124.405 86.543 1.00 50.81 C
ATOM 8840 CG1 ILE C 285 -4.587 122.997 86.020 1.00 50.77 C
ATOM 8841 CG2 ILE C 285 -5.466 124.362 87.928 1.00 47.91 C
ATOM 8842 CD1 ILE C 285 -3.681 122.199 86.902 1.00 53.03 C
ATOM 8843 N PRO C 286 -7.235 127.020 86.091 1.00 56.12 N
ATOM 8844 CA PRO C 286 -7.645 128.360 86.529 1.00 56.95 C
ATOM 8845 C PRO C 286 -7.392 128.666 88.023 1.00 57.23 C
ATOM 8846 O PRO C 286 -7.959 129.615 88.573 1.00 58.94 O
ATOM 8847 CB PRO C 286 -9.130 128.382 86.175 1.00 57.01 C
ATOM 8848 CG PRO C 286 -9.536 126.947 86.436 1.00 56.79 C
ATOM 8849 CD PRO C 286 -8.416 126.197 85.761 1.00 56.69 C
ATOM 8850 N ASN C 287 -6.553 127.859 88.670 1.00 56.36 N
ATOM 8851 CA ASN C 287 -6.212 128.035 90.082 1.00 54.38 C
ATOM 8852 C ASN C 287 -4.711 128.260 90.192 1.00 52.18 C
ATOM 8853 O ASN C 287 -3.932 127.419 89.764 1.00 52.25 O
ATOM 8854 CB ASN C 287 -6.616 126.787 90.877 1.00 55.53 C
ATOM 8855 CG ASN C 287 -6.057 126.786 92.291 1.00 56.30 C
ATOM 8856 OD1 ASN C 287 -4.869 126.544 92.506 1.00 56.64 O
ATOM 8857 ND2 ASN C 287 -6.916 127.065 93.261 1.00 58.14 N
ATOM 8858 N LYS C 288 -4.306 129.382 90.777 1.00 50.32 N
ATOM 8859 CA LYS C 288 -2.890 129.709 90.902 1.00 48.91 C
ATOM 8860 C LYS C 288 -1.982 128.531 91.258 1.00 48.63 C
ATOM 8861 O LYS C 288 -1.180 128.093 90.425 1.00 49.69 O
ATOM 8862 CB LYS C 288 -2.694 130.830 91.913 1.00 48.62 C
ATOM 8863 CG LYS C 288 -1.259 131.288 92.023 1.00 49.46 C
ATOM 8864 CD LYS C 288 -1.139 132.544 92.868 1.00 51.04 C
ATOM 8865 CE LYS C 288 0.314 132.946 93.049 1.00 51.24 C
ATOM 8866 NZ LYS C 288 0.419 134.187 93.854 1.00 52.51 N
ATOM 8867 N LEU C 289 -2.100 128.007 92.476 1.00 46.88 N
ATOM 8868 CA LEU C 289 -1.253 126.885 92.880 1.00 45.15 C
ATOM 8869 C LEU C 289 -1.431 125.656 92.004 1.00 44.00 C
ATOM 8870 O LEU C 289 -0.453 124.994 91.672 1.00 45.32 O
ATOM 8871 CB LEU C 289 -1.505 126.496 94.335 1.00 44.83 C
ATOM 8872 CG LEU C 289 -0.789 125.225 94.811 1.00 44.18 C
ATOM 8873 CD1 LEU C 289 0.711 125.410 94.756 1.00 44.47 C
ATOM 8874 CD2 LEU C 289 -1.222 124.905 96.224 1.00 44.25 C
ATOM 8875 N GLY C 290 -2.671 125.347 91.637 1.00 42.74 N
ATOM 8876 CA GLY C 290 -2.922 124.188 90.791 1.00 41.26 C
ATOM 8877 C GLY C 290 -2.211 124.293 89.445 1.00 41.64 C
ATOM 8878 O GLY C 290 -1.635 123.324 88.943 1.00 40.10 O
ATOM 8879 N GLY C 291 -2.247 125.487 88.863 1.00 40.91 N
ATOM 8880 CA GLY C 291 -1.609 125.711 87.588 1.00 38.03 C
ATOM 8881 C GLY C 291 -0.110 125.584 87.722 1.00 38.37 C
ATOM 8882 O GLY C 291 0.542 125.066 86.811 1.00 40.01 O
ATOM 8883 N VAL C 292 0.449 126.049 88.839 1.00 36.42 N
ATOM 8884 CA VAL C 292 1.893 125.953 89.027 1.00 35.36 C
ATOM 8885 C VAL C 292 2.326 124.495 89.109 1.00 36.01 C
ATOM 8886 O VAL C 292 3.321 124.100 88.502 1.00 34.21 O
ATOM 8887 CB VAL C 292 2.356 126.712 90.294 1.00 34.50 C
ATOM 8888 CG1 VAL C 292 3.730 126.244 90.716 1.00 34.06 C
ATOM 8889 CG2 VAL C 292 2.413 128.210 90.008 1.00 33.56 C
ATOM 8890 N LEU C 293 1.571 123.693 89.854 1.00 38.25 N
ATOM 8891 CA LEU C 293 1.883 122.271 89.997 1.00 39.54 C
ATOM 8892 C LEU C 293 1.795 121.578 88.641 1.00 39.30 C
ATOM 8893 O LEU C 293 2.641 120.754 88.310 1.00 40.24 O
ATOM 8894 CB LEU C 293 0.911 121.601 90.966 1.00 40.32 C
ATOM 8895 CG LEU C 293 0.943 122.066 92.425 1.00 41.93 C
ATOM 8896 CD1 LEU C 293 -0.244 121.465 93.150 1.00 39.66 C
ATOM 8897 CD2 LEU C 293 2.249 121.668 93.081 1.00 40.45 C
ATOM 8898 N ALA C 294 0.773 121.908 87.854 1.00 37.85 N
ATOM 8899 CA ALA C 294 0.630 121.296 86.539 1.00 36.26 C
ATOM 8900 C ALA C 294 1.882 121.624 85.715 1.00 36.71 C
ATOM 8901 O ALA C 294 2.423 120.776 85.002 1.00 35.16 O
ATOM 8902 CB ALA C 294 -0.617 121.816 85.850 1.00 32.87 C
ATOM 8903 N LEU C 295 2.350 122.859 85.832 1.00 36.79 N
ATOM 8904 CA LEU C 295 3.535 123.280 85.106 1.00 37.33 C
ATOM 8905 C LEU C 295 4.749 122.491 85.559 1.00 37.18 C
ATOM 8906 O LEU C 295 5.489 121.963 84.746 1.00 39.12 O
ATOM 8907 CB LEU C 295 3.787 124.772 85.316 1.00 36.76 C
ATOM 8908 CG LEU C 295 5.045 125.331 84.654 1.00 37.30 C
ATOM 8909 CD1 LEU C 295 5.130 124.861 83.201 1.00 36.60 C
ATOM 8910 CD2 LEU C 295 5.022 126.853 84.745 1.00 36.76 C
ATOM 8911 N ALA C 296 4.957 122.415 86.864 1.00 37.40 N
ATOM 8912 CA ALA C 296 6.091 121.677 87.406 1.00 36.57 C
ATOM 8913 C ALA C 296 6.040 120.240 86.931 1.00 35.78 C
ATOM 8914 O ALA C 296 7.020 119.707 86.429 1.00 35.37 O
ATOM 8915 CB ALA C 296 6.063 121.720 88.937 1.00 36.29 C
ATOM 8916 N ALA C 297 4.878 119.619 87.098 1.00 36.79 N
ATOM 8917 CA ALA C 297 4.664 118.227 86.705 1.00 36.61 C
ATOM 8918 C ALA C 297 4.874 118.003 85.206 1.00 36.66 C
ATOM 8919 O ALA C 297 5.318 116.928 84.786 1.00 35.66 O
ATOM 8920 CB ALA C 297 3.254 117.789 87.101 1.00 33.43 C
ATOM 8921 N SER C 298 4.570 119.017 84.402 1.00 35.68 N
ATOM 8922 CA SER C 298 4.714 118.879 82.966 1.00 35.87 C
ATOM 8923 C SER C 298 6.154 118.630 82.568 1.00 36.21 C
ATOM 8924 O SER C 298 6.417 118.117 81.475 1.00 39.28 O
ATOM 8925 CB SER C 298 4.219 120.122 82.245 1.00 36.11 C
ATOM 8926 OG SER C 298 5.185 121.148 82.336 1.00 39.43 O
ATOM 8927 N VAL C 299 7.094 118.990 83.432 1.00 34.20 N
ATOM 8928 CA VAL C 299 8.497 118.778 83.098 1.00 33.15 C
ATOM 8929 C VAL C 299 9.067 117.655 83.924 1.00 34.25 C
ATOM 8930 O VAL C 299 9.792 116.804 83.402 1.00 36.09 O
ATOM 8931 CB VAL C 299 9.354 120.079 83.297 1.00 32.31 C
ATOM 8932 CG1 VAL C 299 10.844 119.768 83.185 1.00 27.33 C
ATOM 8933 CG2 VAL C 299 8.976 121.119 82.233 1.00 28.71 C
ATOM 8934 N LEU C 300 8.740 117.649 85.213 1.00 34.32 N
ATOM 8935 CA LEU C 300 9.221 116.608 86.114 1.00 33.35 C
ATOM 8936 C LEU C 300 8.625 115.240 85.765 1.00 32.18 C
ATOM 8937 O LEU C 300 9.085 114.205 86.233 1.00 32.87 O
ATOM 8938 CB LEU C 300 8.894 116.983 87.558 1.00 34.83 C
ATOM 8939 CG LEU C 300 9.547 118.292 88.029 1.00 36.44 C
ATOM 8940 CD1 LEU C 300 9.087 118.618 89.448 1.00 33.75 C
ATOM 8941 CD2 LEU C 300 11.074 118.162 87.958 1.00 36.39 C
ATOM 8942 N ILE C 301 7.601 115.232 84.929 1.00 31.75 N
ATOM 8943 CA ILE C 301 6.994 113.975 84.512 1.00 32.36 C
ATOM 8944 C ILE C 301 8.104 113.129 83.852 1.00 33.02 C
ATOM 8945 O ILE C 301 8.045 111.895 83.845 1.00 33.36 O
ATOM 8946 CB ILE C 301 5.835 114.250 83.491 1.00 33.30 C
ATOM 8947 CG1 ILE C 301 5.132 112.955 83.096 1.00 30.45 C
ATOM 8948 CG2 ILE C 301 6.383 114.950 82.242 1.00 32.10 C
ATOM 8949 CD1 ILE C 301 4.327 112.364 84.180 1.00 33.75 C
ATOM 8950 N LEU C 302 9.121 113.803 83.309 1.00 30.98 N
ATOM 8951 CA LEU C 302 10.232 113.122 82.647 1.00 30.47 C
ATOM 8952 C LEU C 302 11.018 112.172 83.557 1.00 29.83 C
ATOM 8953 O LEU C 302 11.619 111.215 83.083 1.00 29.19 O
ATOM 8954 CB LEU C 302 11.195 114.142 82.019 1.00 29.47 C
ATOM 8955 CG LEU C 302 10.744 114.995 80.820 1.00 28.17 C
ATOM 8956 CD1 LEU C 302 11.889 115.860 80.362 1.00 26.41 C
ATOM 8957 CD2 LEU C 302 10.296 114.129 79.663 1.00 28.80 C
ATOM 8958 N PHE C 303 11.028 112.438 84.858 1.00 29.53 N
ATOM 8959 CA PHE C 303 11.742 111.571 85.790 1.00 29.80 C
ATOM 8960 C PHE C 303 10.965 110.253 85.956 1.00 31.73 C
ATOM 8961 O PHE C 303 11.522 109.234 86.376 1.00 31.32 O
ATOM 8962 CB PHE C 303 11.881 112.247 87.162 1.00 28.93 C
ATOM 8963 CG PHE C 303 13.030 113.221 87.266 1.00 27.81 C
ATOM 8964 CD1 PHE C 303 12.800 114.556 87.600 1.00 25.10 C
ATOM 8965 CD2 PHE C 303 14.341 112.807 87.027 1.00 25.12 C
ATOM 8966 CE1 PHE C 303 13.861 115.467 87.689 1.00 24.55 C
ATOM 8967 CE2 PHE C 303 15.409 113.713 87.116 1.00 22.15 C
ATOM 8968 CZ PHE C 303 15.170 115.039 87.444 1.00 23.20 C
ATOM 8969 N LEU C 304 9.678 110.279 85.623 1.00 32.13 N
ATOM 8970 CA LEU C 304 8.838 109.104 85.763 1.00 32.54 C
ATOM 8971 C LEU C 304 8.852 108.133 84.598 1.00 34.16 C
ATOM 8972 O LEU C 304 8.520 106.967 84.782 1.00 36.86 O
ATOM 8973 CB LEU C 304 7.390 109.523 86.005 1.00 34.19 C
ATOM 8974 CG LEU C 304 6.956 109.899 87.421 1.00 35.43 C
ATOM 8975 CD1 LEU C 304 5.472 110.204 87.467 1.00 34.58 C
ATOM 8976 CD2 LEU C 304 7.241 108.731 88.331 1.00 36.49 C
ATOM 8977 N ILE C 305 9.224 108.603 83.408 1.00 33.80 N
ATOM 8978 CA ILE C 305 9.225 107.772 82.203 1.00 30.76 C
ATOM 8979 C ILE C 305 9.838 106.389 82.342 1.00 31.89 C
ATOM 8980 O ILE C 305 9.235 105.408 81.904 1.00 31.85 O
ATOM 8981 CB ILE C 305 9.925 108.488 81.012 1.00 30.14 C
ATOM 8982 CG1 ILE C 305 9.238 109.823 80.734 1.00 30.53 C
ATOM 8983 CG2 ILE C 305 9.875 107.616 79.753 1.00 27.76 C
ATOM 8984 CD1 ILE C 305 7.759 109.696 80.479 1.00 33.12 C
ATOM 8985 N PRO C 306 11.035 106.280 82.946 1.00 32.76 N
ATOM 8986 CA PRO C 306 11.656 104.959 83.084 1.00 33.84 C
ATOM 8987 C PRO C 306 10.817 103.932 83.831 1.00 36.09 C
ATOM 8988 O PRO C 306 10.992 102.734 83.637 1.00 37.70 O
ATOM 8989 CB PRO C 306 12.968 105.257 83.800 1.00 33.43 C
ATOM 8990 CG PRO C 306 13.276 106.663 83.388 1.00 34.39 C
ATOM 8991 CD PRO C 306 11.924 107.331 83.471 1.00 33.75 C
ATOM 8992 N PHE C 307 9.898 104.390 84.671 1.00 37.99 N
ATOM 8993 CA PHE C 307 9.053 103.476 85.432 1.00 39.69 C
ATOM 8994 C PHE C 307 7.716 103.173 84.762 1.00 39.92 C
ATOM 8995 O PHE C 307 6.903 102.412 85.289 1.00 41.76 O
ATOM 8996 CB PHE C 307 8.810 104.060 86.816 1.00 42.97 C
ATOM 8997 CG PHE C 307 10.073 104.459 87.519 1.00 48.59 C
ATOM 8998 CD1 PHE C 307 10.935 103.490 88.028 1.00 50.08 C
ATOM 8999 CD2 PHE C 307 10.430 105.805 87.637 1.00 49.61 C
ATOM 9000 CE1 PHE C 307 12.134 103.852 88.643 1.00 51.55 C
ATOM 9001 CE2 PHE C 307 11.627 106.178 88.250 1.00 49.86 C
ATOM 9002 CZ PHE C 307 12.480 105.201 88.753 1.00 51.42 C
ATOM 9003 N LEU C 308 7.473 103.759 83.601 1.00 38.11 N
ATOM 9004 CA LEU C 308 6.217 103.513 82.921 1.00 37.71 C
ATOM 9005 C LEU C 308 6.464 102.664 81.691 1.00 37.99 C
ATOM 9006 O LEU C 308 5.650 102.637 80.764 1.00 40.16 O
ATOM 9007 CB LEU C 308 5.575 104.841 82.541 1.00 36.67 C
ATOM 9008 CG LEU C 308 5.341 105.743 83.754 1.00 38.30 C
ATOM 9009 CD1 LEU C 308 4.726 107.053 83.312 1.00 39.21 C
ATOM 9010 CD2 LEU C 308 4.427 105.041 84.747 1.00 38.31 C
ATOM 9011 N HIS C 309 7.600 101.974 81.688 1.00 36.97 N
ATOM 9012 CA HIS C 309 7.974 101.131 80.569 1.00 36.44 C
ATOM 9013 C HIS C 309 7.527 99.709 80.824 1.00 36.91 C
ATOM 9014 O HIS C 309 8.080 99.033 81.681 1.00 39.05 O
ATOM 9015 CB HIS C 309 9.486 101.155 80.359 1.00 35.72 C
ATOM 9016 CG HIS C 309 9.921 100.493 79.089 1.00 36.52 C
ATOM 9017 ND1 HIS C 309 9.937 101.151 77.876 1.00 36.09 N
ATOM 9018 CD2 HIS C 309 10.293 99.216 78.829 1.00 36.00 C
ATOM 9019 CE1 HIS C 309 10.298 100.306 76.925 1.00 37.73 C
ATOM 9020 NE2 HIS C 309 10.519 99.125 77.476 1.00 38.56 N
ATOM 9021 N LYS C 310 6.538 99.247 80.069 1.00 36.65 N
ATOM 9022 CA LYS C 310 6.029 97.901 80.250 1.00 34.82 C
ATOM 9023 C LYS C 310 6.403 97.001 79.091 1.00 33.27 C
ATOM 9024 O LYS C 310 6.338 95.783 79.196 1.00 33.17 O
ATOM 9025 CB LYS C 310 4.507 97.942 80.396 1.00 36.46 C
ATOM 9026 CG LYS C 310 4.034 98.850 81.494 1.00 38.63 C
ATOM 9027 CD LYS C 310 4.631 98.434 82.821 1.00 42.00 C
ATOM 9028 CE LYS C 310 4.225 99.399 83.939 1.00 44.25 C
ATOM 9029 NZ LYS C 310 4.921 99.095 85.225 1.00 46.11 N
ATOM 9030 N SER C 311 6.792 97.600 77.977 1.00 34.20 N
ATOM 9031 CA SER C 311 7.136 96.823 76.797 1.00 33.24 C
ATOM 9032 C SER C 311 8.279 95.835 77.028 1.00 31.11 C
ATOM 9033 O SER C 311 9.211 96.124 77.762 1.00 32.62 O
ATOM 9034 CB SER C 311 7.491 97.762 75.660 1.00 33.10 C
ATOM 9035 OG SER C 311 7.763 97.001 74.499 1.00 40.02 O
ATOM 9036 N LYS C 312 8.203 94.664 76.411 1.00 29.37 N
ATOM 9037 CA LYS C 312 9.259 93.665 76.556 1.00 29.18 C
ATOM 9038 C LYS C 312 10.384 94.007 75.586 1.00 27.72 C
ATOM 9039 O LYS C 312 11.452 93.392 75.609 1.00 27.53 O
ATOM 9040 CB LYS C 312 8.729 92.258 76.253 1.00 30.15 C
ATOM 9041 CG LYS C 312 7.839 91.678 77.330 1.00 35.57 C
ATOM 9042 CD LYS C 312 8.650 91.364 78.558 1.00 43.37 C
ATOM 9043 CE LYS C 312 7.827 90.717 79.678 1.00 47.58 C
ATOM 9044 NZ LYS C 312 7.062 91.696 80.496 1.00 49.16 N
ATOM 9045 N GLN C 313 10.115 94.992 74.738 1.00 25.77 N
ATOM 9046 CA GLN C 313 11.048 95.477 73.735 1.00 26.85 C
ATOM 9047 C GLN C 313 11.494 96.902 74.104 1.00 28.18 C
ATOM 9048 O GLN C 313 10.712 97.707 74.614 1.00 31.79 O
ATOM 9049 CB GLN C 313 10.373 95.442 72.359 1.00 26.55 C
ATOM 9050 CG GLN C 313 10.037 94.033 71.913 1.00 28.29 C
ATOM 9051 CD GLN C 313 9.268 93.975 70.610 1.00 32.00 C
ATOM 9052 OE1 GLN C 313 8.213 94.602 70.458 1.00 35.13 O
ATOM 9053 NE2 GLN C 313 9.782 93.202 69.659 1.00 33.73 N
ATOM 9054 N ARG C 314 12.750 97.229 73.851 1.00 26.64 N
ATOM 9055 CA ARG C 314 13.231 98.545 74.229 1.00 24.60 C
ATOM 9056 C ARG C 314 12.714 99.722 73.417 1.00 22.93 C
ATOM 9057 O ARG C 314 12.302 100.726 73.984 1.00 23.32 O
ATOM 9058 CB ARG C 314 14.763 98.560 74.224 1.00 27.24 C
ATOM 9059 CG ARG C 314 15.337 99.881 74.675 1.00 27.15 C
ATOM 9060 CD ARG C 314 16.794 99.781 75.004 1.00 28.58 C
ATOM 9061 NE ARG C 314 17.233 101.003 75.667 1.00 29.44 N
ATOM 9062 CZ ARG C 314 18.446 101.192 76.174 1.00 29.64 C
ATOM 9063 NH1 ARG C 314 19.360 100.233 76.099 1.00 28.24 N
ATOM 9064 NH2 ARG C 314 18.747 102.350 76.749 1.00 30.92 N
ATOM 9065 N THR C 315 12.750 99.632 72.095 1.00 21.94 N
ATOM 9066 CA THR C 315 12.284 100.761 71.302 1.00 23.30 C
ATOM 9067 C THR C 315 10.855 100.623 70.806 1.00 23.65 C
ATOM 9068 O THR C 315 10.154 99.671 71.129 1.00 24.39 O
ATOM 9069 CB THR C 315 13.199 101.034 70.091 1.00 22.37 C
ATOM 9070 OG1 THR C 315 13.082 99.974 69.144 1.00 21.71 O
ATOM 9071 CG2 THR C 315 14.640 101.162 70.536 1.00 20.36 C
ATOM 9072 N MET C 316 10.417 101.605 70.039 1.00 23.93 N
ATOM 9073 CA MET C 316 9.069 101.584 69.512 1.00 26.46 C
ATOM 9074 C MET C 316 9.097 101.155 68.055 1.00 27.75 C
ATOM 9075 O MET C 316 8.071 101.112 67.381 1.00 27.97 O
ATOM 9076 CB MET C 316 8.446 102.974 69.651 1.00 25.02 C
ATOM 9077 CG MET C 316 7.975 103.294 71.057 1.00 21.85 C
ATOM 9078 SD MET C 316 7.371 104.956 71.133 1.00 26.10 S
ATOM 9079 CE MET C 316 7.023 105.176 72.826 1.00 24.97 C
ATOM 9080 N THR C 317 10.284 100.804 67.581 1.00 30.02 N
ATOM 9081 CA THR C 317 10.448 100.416 66.188 1.00 32.20 C
ATOM 9082 C THR C 317 9.502 99.321 65.718 1.00 31.99 C
ATOM 9083 O THR C 317 8.979 99.404 64.615 1.00 34.21 O
ATOM 9084 CB THR C 317 11.883 99.978 65.896 1.00 30.73 C
ATOM 9085 OG1 THR C 317 12.780 100.948 66.432 1.00 32.68 O
ATOM 9086 CG2 THR C 317 12.112 99.894 64.414 1.00 30.36 C
ATOM 9087 N PHE C 318 9.270 98.320 66.556 1.00 31.66 N
ATOM 9088 CA PHE C 318 8.404 97.203 66.192 1.00 29.36 C
ATOM 9089 C PHE C 318 7.079 97.243 66.918 1.00 28.94 C
ATOM 9090 O PHE C 318 6.413 96.218 67.014 1.00 29.73 O
ATOM 9091 CB PHE C 318 9.101 95.878 66.510 1.00 27.55 C
ATOM 9092 CG PHE C 318 10.466 95.747 65.890 1.00 28.51 C
ATOM 9093 CD1 PHE C 318 11.570 95.405 66.670 1.00 25.69 C
ATOM 9094 CD2 PHE C 318 10.648 95.959 64.518 1.00 28.82 C
ATOM 9095 CE1 PHE C 318 12.828 95.273 66.105 1.00 24.71 C
ATOM 9096 CE2 PHE C 318 11.920 95.827 63.927 1.00 27.76 C
ATOM 9097 CZ PHE C 318 13.008 95.484 64.724 1.00 28.50 C
ATOM 9098 N ARG C 319 6.699 98.421 67.409 1.00 28.85 N
ATOM 9099 CA ARG C 319 5.457 98.600 68.162 1.00 31.30 C
ATOM 9100 C ARG C 319 4.573 99.663 67.524 1.00 33.48 C
ATOM 9101 O ARG C 319 4.519 100.816 67.974 1.00 33.43 O
ATOM 9102 CB ARG C 319 5.770 99.027 69.602 1.00 33.13 C
ATOM 9103 CG ARG C 319 6.472 97.986 70.454 1.00 31.32 C
ATOM 9104 CD ARG C 319 6.370 98.384 71.917 1.00 31.39 C
ATOM 9105 NE ARG C 319 7.530 99.147 72.355 1.00 32.30 N
ATOM 9106 CZ ARG C 319 7.462 100.195 73.159 1.00 31.97 C
ATOM 9107 NH1 ARG C 319 6.287 100.613 73.613 1.00 29.51 N
ATOM 9108 NH2 ARG C 319 8.577 100.824 73.505 1.00 36.01 N
ATOM 9109 N PRO C 320 3.850 99.288 66.468 1.00 35.04 N
ATOM 9110 CA PRO C 320 2.962 100.213 65.756 1.00 34.34 C
ATOM 9111 C PRO C 320 1.941 100.961 66.629 1.00 35.20 C
ATOM 9112 O PRO C 320 1.700 102.149 66.401 1.00 36.20 O
ATOM 9113 CB PRO C 320 2.310 99.312 64.711 1.00 33.34 C
ATOM 9114 CG PRO C 320 2.262 97.998 65.403 1.00 35.80 C
ATOM 9115 CD PRO C 320 3.641 97.906 66.009 1.00 35.57 C
ATOM 9116 N LEU C 321 1.325 100.297 67.609 1.00 33.43 N
ATOM 9117 CA LEU C 321 0.371 101.011 68.447 1.00 33.54 C
ATOM 9118 C LEU C 321 1.058 102.136 69.234 1.00 33.32 C
ATOM 9119 O LEU C 321 0.541 103.239 69.314 1.00 34.08 O
ATOM 9120 CB LEU C 321 -0.345 100.058 69.410 1.00 37.04 C
ATOM 9121 CG LEU C 321 -1.166 98.894 68.823 1.00 38.24 C
ATOM 9122 CD1 LEU C 321 -2.048 98.371 69.913 1.00 37.86 C
ATOM 9123 CD2 LEU C 321 -2.022 99.324 67.654 1.00 36.62 C
ATOM 9124 N SER C 322 2.231 101.870 69.803 1.00 33.60 N
ATOM 9125 CA SER C 322 2.968 102.897 70.549 1.00 32.00 C
ATOM 9126 C SER C 322 3.400 104.025 69.628 1.00 30.77 C
ATOM 9127 O SER C 322 3.399 105.189 70.016 1.00 31.06 O
ATOM 9128 CB SER C 322 4.210 102.308 71.220 1.00 31.81 C
ATOM 9129 OG SER C 322 3.856 101.255 72.090 1.00 34.96 O
ATOM 9130 N GLN C 323 3.795 103.687 68.411 1.00 29.88 N
ATOM 9131 CA GLN C 323 4.195 104.723 67.477 1.00 30.93 C
ATOM 9132 C GLN C 323 3.062 105.725 67.249 1.00 30.72 C
ATOM 9133 O GLN C 323 3.294 106.925 67.123 1.00 31.91 O
ATOM 9134 CB GLN C 323 4.608 104.115 66.146 1.00 30.18 C
ATOM 9135 CG GLN C 323 5.889 103.340 66.204 1.00 34.43 C
ATOM 9136 CD GLN C 323 6.115 102.530 64.940 1.00 37.14 C
ATOM 9137 OE1 GLN C 323 5.935 103.034 63.830 1.00 39.74 O
ATOM 9138 NE2 GLN C 323 6.521 101.275 65.099 1.00 38.03 N
ATOM 9139 N THR C 324 1.829 105.253 67.200 1.00 30.95 N
ATOM 9140 CA THR C 324 0.729 106.177 66.966 1.00 32.37 C
ATOM 9141 C THR C 324 0.618 107.049 68.188 1.00 30.90 C
ATOM 9142 O THR C 324 0.587 108.285 68.116 1.00 30.50 O
ATOM 9143 CB THR C 324 -0.590 105.442 66.779 1.00 34.13 C
ATOM 9144 OG1 THR C 324 -0.397 104.346 65.881 1.00 36.48 O
ATOM 9145 CG2 THR C 324 -1.610 106.371 66.191 1.00 35.22 C
ATOM 9146 N LEU C 325 0.551 106.374 69.319 1.00 29.48 N
ATOM 9147 CA LEU C 325 0.477 107.040 70.590 1.00 28.87 C
ATOM 9148 C LEU C 325 1.620 108.066 70.668 1.00 27.48 C
ATOM 9149 O LEU C 325 1.434 109.165 71.155 1.00 28.50 O
ATOM 9150 CB LEU C 325 0.597 105.992 71.687 1.00 29.85 C
ATOM 9151 CG LEU C 325 -0.149 106.311 72.973 1.00 33.69 C
ATOM 9152 CD1 LEU C 325 -1.537 106.794 72.621 1.00 33.31 C
ATOM 9153 CD2 LEU C 325 -0.188 105.076 73.875 1.00 32.13 C
ATOM 9154 N PHE C 326 2.792 107.723 70.151 1.00 27.23 N
ATOM 9155 CA PHE C 326 3.933 108.639 70.190 1.00 28.38 C
ATOM 9156 C PHE C 326 3.713 109.934 69.402 1.00 29.77 C
ATOM 9157 O PHE C 326 3.986 111.044 69.892 1.00 30.11 O
ATOM 9158 CB PHE C 326 5.193 107.955 69.651 1.00 26.32 C
ATOM 9159 CG PHE C 326 6.387 108.864 69.586 1.00 23.19 C
ATOM 9160 CD1 PHE C 326 7.192 109.062 70.707 1.00 20.34 C
ATOM 9161 CD2 PHE C 326 6.692 109.551 68.407 1.00 22.13 C
ATOM 9162 CE1 PHE C 326 8.284 109.929 70.660 1.00 17.75 C
ATOM 9163 CE2 PHE C 326 7.788 110.429 68.343 1.00 19.60 C
ATOM 9164 CZ PHE C 326 8.582 110.615 69.470 1.00 17.72 C
ATOM 9165 N TRP C 327 3.244 109.797 68.166 1.00 30.79 N
ATOM 9166 CA TRP C 327 3.003 110.976 67.336 1.00 29.69 C
ATOM 9167 C TRP C 327 1.805 111.749 67.830 1.00 29.89 C
ATOM 9168 O TRP C 327 1.701 112.945 67.572 1.00 30.25 O
ATOM 9169 CB TRP C 327 2.841 110.585 65.873 1.00 26.58 C
ATOM 9170 CG TRP C 327 4.086 109.983 65.370 1.00 25.31 C
ATOM 9171 CD1 TRP C 327 4.319 108.661 65.095 1.00 22.52 C
ATOM 9172 CD2 TRP C 327 5.323 110.661 65.175 1.00 24.88 C
ATOM 9173 NE1 TRP C 327 5.636 108.479 64.742 1.00 23.35 N
ATOM 9174 CE2 TRP C 327 6.275 109.692 64.786 1.00 24.40 C
ATOM 9175 CE3 TRP C 327 5.724 112.000 65.299 1.00 27.27 C
ATOM 9176 CZ2 TRP C 327 7.605 110.018 64.523 1.00 24.57 C
ATOM 9177 CZ3 TRP C 327 7.052 112.327 65.037 1.00 28.26 C
ATOM 9178 CH2 TRP C 327 7.977 111.336 64.654 1.00 27.26 C
ATOM 9179 N LEU C 328 0.898 111.075 68.531 1.00 29.00 N
ATOM 9180 CA LEU C 328 -0.226 111.800 69.064 1.00 31.34 C
ATOM 9181 C LEU C 328 0.384 112.759 70.063 1.00 32.61 C
ATOM 9182 O LEU C 328 0.087 113.962 70.053 1.00 34.17 O
ATOM 9183 CB LEU C 328 -1.207 110.886 69.788 1.00 33.73 C
ATOM 9184 CG LEU C 328 -2.214 110.137 68.911 1.00 37.46 C
ATOM 9185 CD1 LEU C 328 -3.147 109.335 69.814 1.00 36.90 C
ATOM 9186 CD2 LEU C 328 -2.988 111.125 68.048 1.00 33.80 C
ATOM 9187 N LEU C 329 1.256 112.227 70.918 1.00 31.50 N
ATOM 9188 CA LEU C 329 1.893 113.054 71.927 1.00 29.21 C
ATOM 9189 C LEU C 329 2.628 114.225 71.277 1.00 28.49 C
ATOM 9190 O LEU C 329 2.509 115.369 71.723 1.00 27.46 O
ATOM 9191 CB LEU C 329 2.858 112.215 72.772 1.00 29.73 C
ATOM 9192 CG LEU C 329 3.563 112.925 73.943 1.00 28.10 C
ATOM 9193 CD1 LEU C 329 2.547 113.530 74.878 1.00 25.98 C
ATOM 9194 CD2 LEU C 329 4.410 111.948 74.693 1.00 27.05 C
ATOM 9195 N VAL C 330 3.379 113.953 70.216 1.00 26.56 N
ATOM 9196 CA VAL C 330 4.092 115.040 69.569 1.00 26.21 C
ATOM 9197 C VAL C 330 3.120 116.104 69.096 1.00 26.40 C
ATOM 9198 O VAL C 330 3.334 117.277 69.342 1.00 27.25 O
ATOM 9199 CB VAL C 330 4.903 114.571 68.359 1.00 26.59 C
ATOM 9200 CG1 VAL C 330 5.541 115.775 67.693 1.00 21.99 C
ATOM 9201 CG2 VAL C 330 5.952 113.566 68.788 1.00 23.04 C
ATOM 9202 N ALA C 331 2.053 115.692 68.417 1.00 27.89 N
ATOM 9203 CA ALA C 331 1.039 116.633 67.916 1.00 28.97 C
ATOM 9204 C ALA C 331 0.349 117.357 69.082 1.00 30.21 C
ATOM 9205 O ALA C 331 -0.036 118.527 68.985 1.00 29.60 O
ATOM 9206 CB ALA C 331 0.012 115.896 67.090 1.00 26.52 C
ATOM 9207 N ASN C 332 0.198 116.647 70.190 1.00 30.32 N
ATOM 9208 CA ASN C 332 -0.410 117.220 71.362 1.00 30.88 C
ATOM 9209 C ASN C 332 0.473 118.387 71.810 1.00 31.25 C
ATOM 9210 O ASN C 332 -0.010 119.429 72.279 1.00 32.84 O
ATOM 9211 CB ASN C 332 -0.479 116.163 72.456 1.00 34.40 C
ATOM 9212 CG ASN C 332 -1.465 116.520 73.548 1.00 37.89 C
ATOM 9213 OD1 ASN C 332 -1.402 117.596 74.145 1.00 40.97 O
ATOM 9214 ND2 ASN C 332 -2.383 115.613 73.818 1.00 42.73 N
ATOM 9215 N LEU C 333 1.781 118.211 71.674 1.00 29.29 N
ATOM 9216 CA LEU C 333 2.696 119.263 72.068 1.00 27.89 C
ATOM 9217 C LEU C 333 2.558 120.462 71.136 1.00 27.73 C
ATOM 9218 O LEU C 333 2.617 121.604 71.591 1.00 27.24 O
ATOM 9219 CB LEU C 333 4.135 118.720 72.117 1.00 27.01 C
ATOM 9220 CG LEU C 333 4.377 117.847 73.371 1.00 26.76 C
ATOM 9221 CD1 LEU C 333 5.698 117.160 73.315 1.00 24.40 C
ATOM 9222 CD2 LEU C 333 4.300 118.697 74.612 1.00 24.97 C
ATOM 9223 N LEU C 334 2.376 120.212 69.838 1.00 28.09 N
ATOM 9224 CA LEU C 334 2.180 121.299 68.879 1.00 27.90 C
ATOM 9225 C LEU C 334 0.947 122.088 69.271 1.00 26.33 C
ATOM 9226 O LEU C 334 0.960 123.317 69.321 1.00 25.31 O
ATOM 9227 CB LEU C 334 1.951 120.765 67.472 1.00 32.78 C
ATOM 9228 CG LEU C 334 3.189 120.568 66.600 1.00 38.98 C
ATOM 9229 CD1 LEU C 334 2.765 120.679 65.137 1.00 36.46 C
ATOM 9230 CD2 LEU C 334 4.246 121.645 66.927 1.00 41.52 C
ATOM 9231 N ILE C 335 -0.134 121.366 69.543 1.00 24.44 N
ATOM 9232 CA ILE C 335 -1.372 121.999 69.925 1.00 22.01 C
ATOM 9233 C ILE C 335 -1.124 122.870 71.134 1.00 22.92 C
ATOM 9234 O ILE C 335 -1.538 124.031 71.147 1.00 24.79 O
ATOM 9235 CB ILE C 335 -2.456 120.945 70.214 1.00 21.60 C
ATOM 9236 CG1 ILE C 335 -2.903 120.315 68.903 1.00 26.25 C
ATOM 9237 CG2 ILE C 335 -3.665 121.564 70.849 1.00 21.09 C
ATOM 9238 CD1 ILE C 335 -3.902 119.188 69.066 1.00 27.45 C
ATOM 9239 N LEU C 336 -0.440 122.339 72.147 1.00 22.87 N
ATOM 9240 CA LEU C 336 -0.182 123.137 73.339 1.00 23.27 C
ATOM 9241 C LEU C 336 0.640 124.368 72.968 1.00 24.70 C
ATOM 9242 O LEU C 336 0.323 125.488 73.380 1.00 27.19 O
ATOM 9243 CB LEU C 336 0.520 122.303 74.413 1.00 24.76 C
ATOM 9244 CG LEU C 336 -0.413 121.273 75.076 1.00 27.52 C
ATOM 9245 CD1 LEU C 336 0.349 120.349 75.996 1.00 27.73 C
ATOM 9246 CD2 LEU C 336 -1.472 122.002 75.884 1.00 29.06 C
ATOM 9247 N THR C 337 1.676 124.174 72.164 1.00 23.48 N
ATOM 9248 CA THR C 337 2.512 125.286 71.734 1.00 24.55 C
ATOM 9249 C THR C 337 1.644 126.372 71.111 1.00 26.17 C
ATOM 9250 O THR C 337 1.736 127.542 71.480 1.00 26.28 O
ATOM 9251 CB THR C 337 3.561 124.814 70.709 1.00 24.99 C
ATOM 9252 OG1 THR C 337 4.411 123.829 71.330 1.00 25.96 O
ATOM 9253 CG2 THR C 337 4.381 125.999 70.174 1.00 17.73 C
ATOM 9254 N TRP C 338 0.810 125.980 70.156 1.00 27.32 N
ATOM 9255 CA TRP C 338 -0.093 126.917 69.515 1.00 30.20 C
ATOM 9256 C TRP C 338 -1.031 127.574 70.543 1.00 31.13 C
ATOM 9257 O TRP C 338 -1.215 128.802 70.541 1.00 30.35 O
ATOM 9258 CB TRP C 338 -0.932 126.190 68.480 1.00 32.78 C
ATOM 9259 CG TRP C 338 -2.162 126.936 68.106 1.00 35.08 C
ATOM 9260 CD1 TRP C 338 -2.229 128.184 67.568 1.00 36.13 C
ATOM 9261 CD2 TRP C 338 -3.502 126.461 68.194 1.00 36.72 C
ATOM 9262 NE1 TRP C 338 -3.536 128.521 67.305 1.00 37.51 N
ATOM 9263 CE2 TRP C 338 -4.341 127.479 67.677 1.00 38.31 C
ATOM 9264 CE3 TRP C 338 -4.081 125.271 68.654 1.00 37.82 C
ATOM 9265 CZ2 TRP C 338 -5.732 127.343 67.603 1.00 37.86 C
ATOM 9266 CZ3 TRP C 338 -5.466 125.129 68.580 1.00 40.33 C
ATOM 9267 CH2 TRP C 338 -6.277 126.166 68.054 1.00 41.71 C
ATOM 9268 N ILE C 339 -1.620 126.759 71.417 1.00 29.84 N
ATOM 9269 CA ILE C 339 -2.527 127.285 72.429 1.00 30.28 C
ATOM 9270 C ILE C 339 -1.833 128.276 73.352 1.00 30.27 C
ATOM 9271 O ILE C 339 -2.413 129.280 73.755 1.00 30.96 O
ATOM 9272 CB ILE C 339 -3.147 126.155 73.279 1.00 29.52 C
ATOM 9273 CG1 ILE C 339 -4.232 125.425 72.470 1.00 31.52 C
ATOM 9274 CG2 ILE C 339 -3.751 126.724 74.542 1.00 27.35 C
ATOM 9275 CD1 ILE C 339 -5.414 126.324 72.040 1.00 28.84 C
ATOM 9276 N GLY C 340 -0.585 127.998 73.685 1.00 30.10 N
ATOM 9277 CA GLY C 340 0.140 128.900 74.553 1.00 30.14 C
ATOM 9278 C GLY C 340 0.404 130.270 73.964 1.00 31.31 C
ATOM 9279 O GLY C 340 0.776 131.167 74.695 1.00 31.20 O
ATOM 9280 N SER C 341 0.211 130.434 72.654 1.00 34.70 N
ATOM 9281 CA SER C 341 0.445 131.717 71.970 1.00 36.09 C
ATOM 9282 C SER C 341 -0.841 132.509 71.740 1.00 36.87 C
ATOM 9283 O SER C 341 -0.807 133.616 71.215 1.00 37.66 O
ATOM 9284 CB SER C 341 1.102 131.491 70.607 1.00 35.30 C
ATOM 9285 OG SER C 341 0.185 130.881 69.707 1.00 33.83 O
ATOM 9286 N GLN C 342 -1.971 131.930 72.114 1.00 37.40 N
ATOM 9287 CA GLN C 342 -3.249 132.587 71.946 1.00 38.21 C
ATOM 9288 C GLN C 342 -3.754 133.124 73.264 1.00 40.01 C
ATOM 9289 O GLN C 342 -3.267 132.744 74.326 1.00 41.11 O
ATOM 9290 CB GLN C 342 -4.262 131.596 71.399 1.00 39.39 C
ATOM 9291 CG GLN C 342 -3.906 131.117 70.044 1.00 39.40 C
ATOM 9292 CD GLN C 342 -3.526 132.262 69.172 1.00 40.61 C
ATOM 9293 OE1 GLN C 342 -2.503 132.220 68.501 1.00 42.25 O
ATOM 9294 NE2 GLN C 342 -4.340 133.313 69.182 1.00 41.41 N
ATOM 9295 N PRO C 343 -4.747 134.019 73.216 1.00 41.58 N
ATOM 9296 CA PRO C 343 -5.327 134.609 74.428 1.00 42.34 C
ATOM 9297 C PRO C 343 -6.259 133.627 75.120 1.00 42.96 C
ATOM 9298 O PRO C 343 -6.805 132.734 74.474 1.00 42.36 O
ATOM 9299 CB PRO C 343 -6.072 135.827 73.893 1.00 42.11 C
ATOM 9300 CG PRO C 343 -6.512 135.363 72.521 1.00 41.47 C
ATOM 9301 CD PRO C 343 -5.284 134.661 72.001 1.00 41.12 C
ATOM 9302 N VAL C 344 -6.424 133.788 76.431 1.00 45.66 N
ATOM 9303 CA VAL C 344 -7.308 132.920 77.215 1.00 48.36 C
ATOM 9304 C VAL C 344 -8.770 133.231 76.883 1.00 49.62 C
ATOM 9305 O VAL C 344 -9.409 134.058 77.531 1.00 49.43 O
ATOM 9306 CB VAL C 344 -7.099 133.101 78.758 1.00 48.91 C
ATOM 9307 CG1 VAL C 344 -5.737 132.557 79.176 1.00 46.79 C
ATOM 9308 CG2 VAL C 344 -7.235 134.590 79.144 1.00 49.76 C
ATOM 9309 N GLU C 345 -9.292 132.563 75.867 1.00 50.86 N
ATOM 9310 CA GLU C 345 -10.664 132.778 75.455 1.00 51.95 C
ATOM 9311 C GLU C 345 -11.160 131.589 74.656 1.00 51.38 C
ATOM 9312 O GLU C 345 -10.355 130.862 74.062 1.00 53.09 O
ATOM 9313 CB GLU C 345 -10.742 134.028 74.594 1.00 55.21 C
ATOM 9314 CG GLU C 345 -10.445 135.303 75.350 1.00 61.74 C
ATOM 9315 CD GLU C 345 -10.205 136.481 74.428 1.00 66.66 C
ATOM 9316 OE1 GLU C 345 -11.052 136.720 73.533 1.00 68.56 O
ATOM 9317 OE2 GLU C 345 -9.170 137.167 74.606 1.00 68.40 O
ATOM 9318 N HIS C 346 -12.477 131.384 74.651 1.00 47.87 N
ATOM 9319 CA HIS C 346 -13.073 130.297 73.882 1.00 46.30 C
ATOM 9320 C HIS C 346 -12.642 130.517 72.428 1.00 45.19 C
ATOM 9321 O HIS C 346 -12.592 131.657 71.959 1.00 45.70 O
ATOM 9322 CB HIS C 346 -14.598 130.364 73.988 1.00 46.59 C
ATOM 9323 CG HIS C 346 -15.317 129.352 73.147 1.00 48.98 C
ATOM 9324 ND1 HIS C 346 -15.449 128.029 73.517 1.00 49.74 N
ATOM 9325 CD2 HIS C 346 -15.935 129.467 71.946 1.00 48.82 C
ATOM 9326 CE1 HIS C 346 -16.117 127.375 72.582 1.00 48.65 C
ATOM 9327 NE2 HIS C 346 -16.423 128.223 71.618 1.00 49.50 N
ATOM 9328 N PRO C 347 -12.332 129.440 71.691 1.00 43.43 N
ATOM 9329 CA PRO C 347 -12.340 128.021 72.066 1.00 42.12 C
ATOM 9330 C PRO C 347 -11.000 127.558 72.656 1.00 41.68 C
ATOM 9331 O PRO C 347 -10.872 126.427 73.134 1.00 43.57 O
ATOM 9332 CB PRO C 347 -12.639 127.341 70.743 1.00 42.01 C
ATOM 9333 CG PRO C 347 -11.766 128.169 69.804 1.00 42.89 C
ATOM 9334 CD PRO C 347 -12.064 129.597 70.246 1.00 42.04 C
ATOM 9335 N PHE C 348 -10.004 128.435 72.614 1.00 38.40 N
ATOM 9336 CA PHE C 348 -8.682 128.126 73.131 1.00 35.47 C
ATOM 9337 C PHE C 348 -8.708 127.504 74.521 1.00 36.91 C
ATOM 9338 O PHE C 348 -8.144 126.429 74.734 1.00 37.38 O
ATOM 9339 CB PHE C 348 -7.840 129.391 73.140 1.00 32.00 C
ATOM 9340 CG PHE C 348 -7.696 130.013 71.797 1.00 28.30 C
ATOM 9341 CD1 PHE C 348 -7.688 131.390 71.651 1.00 29.21 C
ATOM 9342 CD2 PHE C 348 -7.589 129.226 70.668 1.00 27.95 C
ATOM 9343 CE1 PHE C 348 -7.578 131.977 70.384 1.00 26.84 C
ATOM 9344 CE2 PHE C 348 -7.480 129.799 69.413 1.00 28.11 C
ATOM 9345 CZ PHE C 348 -7.475 131.183 69.274 1.00 26.21 C
ATOM 9346 N ILE C 349 -9.365 128.172 75.463 1.00 37.48 N
ATOM 9347 CA ILE C 349 -9.449 127.668 76.831 1.00 38.60 C
ATOM 9348 C ILE C 349 -9.794 126.179 76.912 1.00 39.40 C
ATOM 9349 O ILE C 349 -9.103 125.407 77.582 1.00 40.05 O
ATOM 9350 CB ILE C 349 -10.496 128.461 77.662 1.00 38.05 C
ATOM 9351 CG1 ILE C 349 -10.044 129.916 77.796 1.00 37.71 C
ATOM 9352 CG2 ILE C 349 -10.668 127.833 79.043 1.00 36.10 C
ATOM 9353 CD1 ILE C 349 -10.977 130.782 78.600 1.00 37.08 C
ATOM 9354 N ILE C 350 -10.858 125.766 76.237 1.00 39.66 N
ATOM 9355 CA ILE C 350 -11.233 124.364 76.299 1.00 39.51 C
ATOM 9356 C ILE C 350 -10.233 123.498 75.540 1.00 38.59 C
ATOM 9357 O ILE C 350 -9.787 122.475 76.059 1.00 38.42 O
ATOM 9358 CB ILE C 350 -12.661 124.128 75.760 1.00 39.49 C
ATOM 9359 CG1 ILE C 350 -13.078 122.690 76.037 1.00 40.85 C
ATOM 9360 CG2 ILE C 350 -12.717 124.396 74.279 1.00 40.30 C
ATOM 9361 CD1 ILE C 350 -13.022 122.326 77.509 1.00 44.11 C
ATOM 9362 N ILE C 351 -9.871 123.909 74.327 1.00 37.55 N
ATOM 9363 CA ILE C 351 -8.905 123.145 73.540 1.00 38.35 C
ATOM 9364 C ILE C 351 -7.657 122.945 74.392 1.00 38.78 C
ATOM 9365 O ILE C 351 -7.091 121.846 74.435 1.00 39.47 O
ATOM 9366 CB ILE C 351 -8.469 123.884 72.246 1.00 38.22 C
ATOM 9367 CG1 ILE C 351 -9.679 124.181 71.364 1.00 35.98 C
ATOM 9368 CG2 ILE C 351 -7.472 123.031 71.474 1.00 35.75 C
ATOM 9369 CD1 ILE C 351 -9.324 124.888 70.090 1.00 36.41 C
ATOM 9370 N GLY C 352 -7.244 124.020 75.064 1.00 37.40 N
ATOM 9371 CA GLY C 352 -6.077 123.978 75.924 1.00 36.76 C
ATOM 9372 C GLY C 352 -6.160 122.910 76.997 1.00 37.04 C
ATOM 9373 O GLY C 352 -5.263 122.076 77.111 1.00 38.15 O
ATOM 9374 N GLN C 353 -7.234 122.926 77.781 1.00 37.96 N
ATOM 9375 CA GLN C 353 -7.431 121.949 78.858 1.00 37.56 C
ATOM 9376 C GLN C 353 -7.485 120.517 78.324 1.00 36.99 C
ATOM 9377 O GLN C 353 -7.071 119.578 78.997 1.00 35.15 O
ATOM 9378 CB GLN C 353 -8.707 122.287 79.617 1.00 37.91 C
ATOM 9379 CG GLN C 353 -8.656 123.669 80.230 1.00 38.82 C
ATOM 9380 CD GLN C 353 -10.003 124.140 80.692 1.00 38.99 C
ATOM 9381 OE1 GLN C 353 -10.987 124.041 79.961 1.00 43.83 O
ATOM 9382 NE2 GLN C 353 -10.061 124.667 81.903 1.00 37.76 N
ATOM 9383 N MET C 354 -7.997 120.356 77.112 1.00 36.38 N
ATOM 9384 CA MET C 354 -8.053 119.050 76.494 1.00 38.85 C
ATOM 9385 C MET C 354 -6.614 118.589 76.308 1.00 39.25 C
ATOM 9386 O MET C 354 -6.181 117.575 76.873 1.00 38.15 O
ATOM 9387 CB MET C 354 -8.708 119.143 75.117 1.00 46.05 C
ATOM 9388 CG MET C 354 -10.143 119.624 75.112 1.00 52.91 C
ATOM 9389 SD MET C 354 -11.235 118.393 75.827 1.00 62.62 S
ATOM 9390 CE MET C 354 -11.037 118.754 77.676 1.00 61.13 C
ATOM 9391 N ALA C 355 -5.872 119.354 75.506 1.00 37.93 N
ATOM 9392 CA ALA C 355 -4.480 119.038 75.219 1.00 36.31 C
ATOM 9393 C ALA C 355 -3.686 118.775 76.503 1.00 35.38 C
ATOM 9394 O ALA C 355 -2.922 117.810 76.583 1.00 35.29 O
ATOM 9395 CB ALA C 355 -3.849 120.165 74.396 1.00 34.47 C
ATOM 9396 N SER C 356 -3.873 119.617 77.512 1.00 34.33 N
ATOM 9397 CA SER C 356 -3.171 119.426 78.774 1.00 36.47 C
ATOM 9398 C SER C 356 -3.509 118.078 79.371 1.00 36.60 C
ATOM 9399 O SER C 356 -2.626 117.299 79.738 1.00 36.82 O
ATOM 9400 CB SER C 356 -3.561 120.500 79.766 1.00 35.96 C
ATOM 9401 OG SER C 356 -3.322 121.766 79.193 1.00 42.82 O
ATOM 9402 N LEU C 357 -4.803 117.812 79.468 1.00 36.28 N
ATOM 9403 CA LEU C 357 -5.283 116.572 80.029 1.00 35.37 C
ATOM 9404 C LEU C 357 -4.786 115.351 79.252 1.00 34.32 C
ATOM 9405 O LEU C 357 -4.370 114.359 79.847 1.00 32.91 O
ATOM 9406 CB LEU C 357 -6.804 116.600 80.067 1.00 38.54 C
ATOM 9407 CG LEU C 357 -7.454 115.360 80.661 1.00 40.82 C
ATOM 9408 CD1 LEU C 357 -6.927 115.146 82.074 1.00 40.76 C
ATOM 9409 CD2 LEU C 357 -8.956 115.536 80.653 1.00 40.63 C
ATOM 9410 N SER C 358 -4.813 115.409 77.927 1.00 33.68 N
ATOM 9411 CA SER C 358 -4.337 114.260 77.156 1.00 35.55 C
ATOM 9412 C SER C 358 -2.819 114.105 77.225 1.00 36.21 C
ATOM 9413 O SER C 358 -2.304 112.982 77.123 1.00 39.67 O
ATOM 9414 CB SER C 358 -4.782 114.339 75.695 1.00 32.93 C
ATOM 9415 OG SER C 358 -4.758 115.670 75.253 1.00 39.57 O
ATOM 9416 N TYR C 359 -2.098 115.211 77.393 1.00 33.25 N
ATOM 9417 CA TYR C 359 -0.651 115.128 77.511 1.00 31.46 C
ATOM 9418 C TYR C 359 -0.333 114.167 78.655 1.00 31.31 C
ATOM 9419 O TYR C 359 0.357 113.165 78.459 1.00 31.42 O
ATOM 9420 CB TYR C 359 -0.071 116.498 77.824 1.00 31.73 C
ATOM 9421 CG TYR C 359 1.407 116.510 78.145 1.00 30.43 C
ATOM 9422 CD1 TYR C 359 2.358 116.352 77.150 1.00 30.73 C
ATOM 9423 CD2 TYR C 359 1.849 116.719 79.447 1.00 31.55 C
ATOM 9424 CE1 TYR C 359 3.717 116.410 77.437 1.00 31.46 C
ATOM 9425 CE2 TYR C 359 3.197 116.776 79.754 1.00 32.67 C
ATOM 9426 CZ TYR C 359 4.129 116.626 78.743 1.00 34.65 C
ATOM 9427 OH TYR C 359 5.472 116.726 79.042 1.00 37.36 O
ATOM 9428 N PHE C 360 -0.862 114.460 79.842 1.00 31.21 N
ATOM 9429 CA PHE C 360 -0.616 113.624 81.015 1.00 32.49 C
ATOM 9430 C PHE C 360 -1.213 112.228 80.920 1.00 33.67 C
ATOM 9431 O PHE C 360 -0.663 111.257 81.461 1.00 31.03 O
ATOM 9432 CB PHE C 360 -1.134 114.306 82.273 1.00 32.37 C
ATOM 9433 CG PHE C 360 -0.350 115.518 82.654 1.00 34.83 C
ATOM 9434 CD1 PHE C 360 -0.782 116.781 82.288 1.00 33.85 C
ATOM 9435 CD2 PHE C 360 0.847 115.396 83.367 1.00 35.31 C
ATOM 9436 CE1 PHE C 360 -0.029 117.912 82.630 1.00 35.29 C
ATOM 9437 CE2 PHE C 360 1.603 116.521 83.711 1.00 33.69 C
ATOM 9438 CZ PHE C 360 1.164 117.777 83.342 1.00 33.71 C
ATOM 9439 N THR C 361 -2.340 112.127 80.229 1.00 34.52 N
ATOM 9440 CA THR C 361 -2.995 110.844 80.064 1.00 34.55 C
ATOM 9441 C THR C 361 -2.157 109.920 79.190 1.00 34.51 C
ATOM 9442 O THR C 361 -2.047 108.734 79.476 1.00 37.39 O
ATOM 9443 CB THR C 361 -4.357 111.031 79.430 1.00 35.61 C
ATOM 9444 OG1 THR C 361 -5.092 111.970 80.209 1.00 39.21 O
ATOM 9445 CG2 THR C 361 -5.118 109.734 79.390 1.00 35.22 C
ATOM 9446 N ILE C 362 -1.572 110.445 78.121 1.00 32.82 N
ATOM 9447 CA ILE C 362 -0.761 109.602 77.254 1.00 31.88 C
ATOM 9448 C ILE C 362 0.464 109.081 78.005 1.00 32.95 C
ATOM 9449 O ILE C 362 0.806 107.902 77.941 1.00 32.04 O
ATOM 9450 CB ILE C 362 -0.274 110.374 76.019 1.00 30.80 C
ATOM 9451 CG1 ILE C 362 -1.456 110.699 75.116 1.00 29.40 C
ATOM 9452 CG2 ILE C 362 0.769 109.564 75.269 1.00 27.12 C
ATOM 9453 CD1 ILE C 362 -1.057 111.470 73.902 1.00 30.78 C
ATOM 9454 N LEU C 363 1.122 109.968 78.733 1.00 33.31 N
ATOM 9455 CA LEU C 363 2.311 109.579 79.452 1.00 34.34 C
ATOM 9456 C LEU C 363 2.081 108.682 80.675 1.00 36.36 C
ATOM 9457 O LEU C 363 2.825 107.721 80.883 1.00 38.17 O
ATOM 9458 CB LEU C 363 3.085 110.832 79.853 1.00 33.31 C
ATOM 9459 CG LEU C 363 3.685 111.641 78.700 1.00 31.53 C
ATOM 9460 CD1 LEU C 363 4.375 112.850 79.249 1.00 30.98 C
ATOM 9461 CD2 LEU C 363 4.671 110.796 77.919 1.00 31.20 C
ATOM 9462 N LEU C 364 1.055 108.977 81.472 1.00 36.46 N
ATOM 9463 CA LEU C 364 0.784 108.196 82.680 1.00 35.42 C
ATOM 9464 C LEU C 364 -0.111 106.969 82.527 1.00 35.97 C
ATOM 9465 O LEU C 364 -0.006 106.021 83.320 1.00 35.88 O
ATOM 9466 CB LEU C 364 0.211 109.101 83.775 1.00 33.39 C
ATOM 9467 CG LEU C 364 1.152 110.243 84.177 1.00 32.94 C
ATOM 9468 CD1 LEU C 364 0.463 111.167 85.171 1.00 32.09 C
ATOM 9469 CD2 LEU C 364 2.429 109.671 84.751 1.00 29.52 C
ATOM 9470 N ILE C 365 -0.970 106.953 81.513 1.00 34.65 N
ATOM 9471 CA ILE C 365 -1.853 105.810 81.345 1.00 34.07 C
ATOM 9472 C ILE C 365 -1.718 105.071 80.027 1.00 35.53 C
ATOM 9473 O ILE C 365 -1.438 103.881 79.997 1.00 38.11 O
ATOM 9474 CB ILE C 365 -3.324 106.230 81.510 1.00 32.03 C
ATOM 9475 CG1 ILE C 365 -3.519 106.820 82.895 1.00 29.86 C
ATOM 9476 CG2 ILE C 365 -4.249 105.043 81.308 1.00 27.01 C
ATOM 9477 CD1 ILE C 365 -4.701 107.701 82.968 1.00 32.52 C
ATOM 9478 N LEU C 366 -1.914 105.764 78.924 1.00 35.10 N
ATOM 9479 CA LEU C 366 -1.854 105.074 77.657 1.00 34.80 C
ATOM 9480 C LEU C 366 -0.548 104.370 77.345 1.00 34.61 C
ATOM 9481 O LEU C 366 -0.566 103.213 76.957 1.00 37.62 O
ATOM 9482 CB LEU C 366 -2.259 106.029 76.527 1.00 33.98 C
ATOM 9483 CG LEU C 366 -3.683 106.588 76.749 1.00 32.99 C
ATOM 9484 CD1 LEU C 366 -4.170 107.264 75.493 1.00 25.81 C
ATOM 9485 CD2 LEU C 366 -4.645 105.440 77.134 1.00 30.21 C
ATOM 9486 N PHE C 367 0.585 105.024 77.530 1.00 34.37 N
ATOM 9487 CA PHE C 367 1.844 104.362 77.205 1.00 35.32 C
ATOM 9488 C PHE C 367 2.105 103.069 77.957 1.00 35.30 C
ATOM 9489 O PHE C 367 2.462 102.069 77.350 1.00 37.21 O
ATOM 9490 CB PHE C 367 3.024 105.328 77.355 1.00 36.34 C
ATOM 9491 CG PHE C 367 3.441 105.957 76.056 1.00 35.98 C
ATOM 9492 CD1 PHE C 367 3.733 107.307 75.979 1.00 37.80 C
ATOM 9493 CD2 PHE C 367 3.524 105.191 74.900 1.00 37.37 C
ATOM 9494 CE1 PHE C 367 4.100 107.887 74.769 1.00 38.87 C
ATOM 9495 CE2 PHE C 367 3.889 105.758 73.688 1.00 37.49 C
ATOM 9496 CZ PHE C 367 4.177 107.109 73.621 1.00 38.76 C
ATOM 9497 N PRO C 368 1.965 103.067 79.284 1.00 34.46 N
ATOM 9498 CA PRO C 368 2.211 101.792 79.953 1.00 34.67 C
ATOM 9499 C PRO C 368 1.111 100.779 79.613 1.00 35.27 C
ATOM 9500 O PRO C 368 1.371 99.585 79.438 1.00 39.03 O
ATOM 9501 CB PRO C 368 2.225 102.170 81.432 1.00 33.87 C
ATOM 9502 CG PRO C 368 1.386 103.403 81.493 1.00 34.60 C
ATOM 9503 CD PRO C 368 1.832 104.154 80.263 1.00 34.70 C
ATOM 9504 N THR C 369 -0.117 101.255 79.508 1.00 33.38 N
ATOM 9505 CA THR C 369 -1.225 100.381 79.188 1.00 33.51 C
ATOM 9506 C THR C 369 -1.034 99.715 77.830 1.00 34.78 C
ATOM 9507 O THR C 369 -1.109 98.487 77.724 1.00 34.59 O
ATOM 9508 CB THR C 369 -2.549 101.162 79.208 1.00 32.63 C
ATOM 9509 OG1 THR C 369 -2.834 101.530 80.555 1.00 33.83 O
ATOM 9510 CG2 THR C 369 -3.691 100.322 78.696 1.00 31.01 C
ATOM 9511 N ILE C 370 -0.788 100.522 76.798 1.00 33.98 N
ATOM 9512 CA ILE C 370 -0.593 100.010 75.451 1.00 33.13 C
ATOM 9513 C ILE C 370 0.630 99.099 75.396 1.00 32.65 C
ATOM 9514 O ILE C 370 0.634 98.102 74.672 1.00 31.47 O
ATOM 9515 CB ILE C 370 -0.438 101.183 74.446 1.00 34.20 C
ATOM 9516 CG1 ILE C 370 -1.740 101.986 74.412 1.00 35.27 C
ATOM 9517 CG2 ILE C 370 -0.095 100.673 73.033 1.00 35.84 C
ATOM 9518 CD1 ILE C 370 -2.961 101.195 74.009 1.00 33.14 C
ATOM 9519 N GLY C 371 1.655 99.427 76.177 1.00 32.25 N
ATOM 9520 CA GLY C 371 2.863 98.617 76.185 1.00 34.95 C
ATOM 9521 C GLY C 371 2.577 97.196 76.627 1.00 36.41 C
ATOM 9522 O GLY C 371 3.121 96.219 76.092 1.00 37.02 O
ATOM 9523 N THR C 372 1.716 97.098 77.633 1.00 37.40 N
ATOM 9524 CA THR C 372 1.286 95.830 78.192 1.00 35.46 C
ATOM 9525 C THR C 372 0.439 95.107 77.168 1.00 34.27 C
ATOM 9526 O THR C 372 0.605 93.913 76.953 1.00 32.77 O
ATOM 9527 CB THR C 372 0.443 96.068 79.448 1.00 35.93 C
ATOM 9528 OG1 THR C 372 1.289 96.579 80.487 1.00 38.30 O
ATOM 9529 CG2 THR C 372 -0.238 94.791 79.895 1.00 33.00 C
ATOM 9530 N LEU C 373 -0.466 95.854 76.541 1.00 35.20 N
ATOM 9531 CA LEU C 373 -1.368 95.314 75.546 1.00 35.55 C
ATOM 9532 C LEU C 373 -0.565 94.750 74.393 1.00 36.32 C
ATOM 9533 O LEU C 373 -0.851 93.664 73.901 1.00 37.11 O
ATOM 9534 CB LEU C 373 -2.332 96.396 75.076 1.00 36.33 C
ATOM 9535 CG LEU C 373 -3.299 95.995 73.951 1.00 40.73 C
ATOM 9536 CD1 LEU C 373 -3.975 94.670 74.269 1.00 40.36 C
ATOM 9537 CD2 LEU C 373 -4.354 97.086 73.774 1.00 39.69 C
ATOM 9538 N GLU C 374 0.464 95.472 73.978 1.00 37.78 N
ATOM 9539 CA GLU C 374 1.324 94.989 72.897 1.00 38.69 C
ATOM 9540 C GLU C 374 2.070 93.712 73.308 1.00 37.32 C
ATOM 9541 O GLU C 374 2.264 92.820 72.497 1.00 38.69 O
ATOM 9542 CB GLU C 374 2.336 96.067 72.485 1.00 40.64 C
ATOM 9543 CG GLU C 374 1.793 97.081 71.485 1.00 45.71 C
ATOM 9544 CD GLU C 374 2.726 98.278 71.281 1.00 49.93 C
ATOM 9545 OE1 GLU C 374 2.730 98.841 70.149 1.00 49.38 O
ATOM 9546 OE2 GLU C 374 3.441 98.652 72.255 1.00 48.58 O
ATOM 9547 N ASN C 375 2.502 93.614 74.556 1.00 36.25 N
ATOM 9548 CA ASN C 375 3.206 92.409 74.968 1.00 35.61 C
ATOM 9549 C ASN C 375 2.333 91.192 74.730 1.00 35.96 C
ATOM 9550 O ASN C 375 2.812 90.164 74.269 1.00 35.45 O
ATOM 9551 CB ASN C 375 3.584 92.459 76.452 1.00 35.50 C
ATOM 9552 CG ASN C 375 4.804 93.314 76.725 1.00 34.02 C
ATOM 9553 OD1 ASN C 375 5.614 93.547 75.837 1.00 34.49 O
ATOM 9554 ND2 ASN C 375 4.954 93.766 77.968 1.00 33.66 N
ATOM 9555 N LYS C 376 1.044 91.313 75.036 1.00 37.34 N
ATOM 9556 CA LYS C 376 0.130 90.199 74.865 1.00 38.52 C
ATOM 9557 C LYS C 376 -0.087 89.843 73.411 1.00 38.54 C
ATOM 9558 O LYS C 376 -0.182 88.666 73.069 1.00 40.97 O
ATOM 9559 CB LYS C 376 -1.198 90.487 75.559 1.00 40.25 C
ATOM 9560 CG LYS C 376 -1.076 90.488 77.079 1.00 45.79 C
ATOM 9561 CD LYS C 376 -2.432 90.623 77.757 1.00 52.86 C
ATOM 9562 CE LYS C 376 -2.312 90.940 79.264 1.00 56.41 C
ATOM 9563 NZ LYS C 376 -1.649 89.856 80.059 1.00 59.18 N
ATOM 9564 N MET C 377 -0.152 90.839 72.542 1.00 37.01 N
ATOM 9565 CA MET C 377 -0.328 90.553 71.131 1.00 38.61 C
ATOM 9566 C MET C 377 0.870 89.830 70.533 1.00 39.56 C
ATOM 9567 O MET C 377 0.799 89.302 69.427 1.00 41.63 O
ATOM 9568 CB MET C 377 -0.611 91.839 70.373 1.00 40.80 C
ATOM 9569 CG MET C 377 -1.991 92.367 70.687 1.00 43.84 C
ATOM 9570 SD MET C 377 -2.201 94.028 70.124 1.00 50.92 S
ATOM 9571 CE MET C 377 -2.433 93.743 68.400 1.00 49.65 C
ATOM 9572 N LEU C 378 1.967 89.799 71.275 1.00 40.83 N
ATOM 9573 CA LEU C 378 3.185 89.120 70.854 1.00 41.09 C
ATOM 9574 C LEU C 378 3.225 87.744 71.493 1.00 42.18 C
ATOM 9575 O LEU C 378 4.103 86.927 71.212 1.00 43.12 O
ATOM 9576 CB LEU C 378 4.407 89.916 71.293 1.00 40.93 C
ATOM 9577 CG LEU C 378 4.906 91.011 70.355 1.00 39.83 C
ATOM 9578 CD1 LEU C 378 6.183 91.618 70.917 1.00 42.20 C
ATOM 9579 CD2 LEU C 378 5.200 90.415 68.996 1.00 41.18 C
ATOM 9580 N ASN C 379 2.256 87.510 72.364 1.00 43.93 N
ATOM 9581 CA ASN C 379 2.107 86.263 73.100 1.00 46.91 C
ATOM 9582 C ASN C 379 3.124 86.105 74.221 1.00 48.23 C
ATOM 9583 O ASN C 379 3.682 85.025 74.435 1.00 47.80 O
ATOM 9584 CB ASN C 379 2.170 85.061 72.171 1.00 48.05 C
ATOM 9585 CG ASN C 379 1.441 83.863 72.743 1.00 50.27 C
ATOM 9586 OD1 ASN C 379 0.240 83.928 73.015 1.00 46.25 O
ATOM 9587 ND2 ASN C 379 2.168 82.758 72.938 1.00 54.32 N
ATOM 9588 N TYR C 380 3.339 87.217 74.921 1.00 50.03 N
ATOM 9589 CA TYR C 380 4.234 87.341 76.072 1.00 50.92 C
ATOM 9590 C TYR C 380 3.326 87.873 77.176 1.00 53.84 C
ATOM 9591 O TYR C 380 2.102 87.607 77.105 1.00 55.79 O
ATOM 9592 CB TYR C 380 5.313 88.391 75.822 1.00 48.19 C
ATOM 9593 CG TYR C 380 6.440 87.988 74.916 1.00 45.50 C
ATOM 9594 CD1 TYR C 380 6.934 88.884 73.961 1.00 44.21 C
ATOM 9595 CD2 TYR C 380 7.081 86.765 75.072 1.00 45.19 C
ATOM 9596 CE1 TYR C 380 8.042 88.577 73.187 1.00 44.35 C
ATOM 9597 CE2 TYR C 380 8.196 86.440 74.309 1.00 45.85 C
ATOM 9598 CZ TYR C 380 8.674 87.351 73.365 1.00 45.61 C
ATOM 9599 OH TYR C 380 9.786 87.046 72.609 1.00 44.04 O
ATOM 9600 OXT TYR C 380 3.844 88.570 78.080 1.00 56.56 O
TER 9601 TYR C 380
ATOM 9602 N GLY D 1 -14.985 144.691 69.830 1.00 79.90 N
ATOM 9603 CA GLY D 1 -14.028 145.055 70.908 1.00 80.87 C
ATOM 9604 C GLY D 1 -12.622 144.539 70.652 1.00 81.60 C
ATOM 9605 O GLY D 1 -11.641 145.212 70.973 1.00 81.33 O
ATOM 9606 N GLU D 2 -12.527 143.342 70.072 1.00 82.43 N
ATOM 9607 CA GLU D 2 -11.238 142.698 69.764 1.00 81.81 C
ATOM 9608 C GLU D 2 -10.888 142.872 68.280 1.00 79.45 C
ATOM 9609 O GLU D 2 -10.077 142.114 67.723 1.00 78.87 O
ATOM 9610 CB GLU D 2 -11.315 141.199 70.066 1.00 83.98 C
ATOM 9611 CG GLU D 2 -11.914 140.845 71.412 1.00 88.11 C
ATOM 9612 CD GLU D 2 -12.321 139.381 71.485 1.00 90.90 C
ATOM 9613 OE1 GLU D 2 -11.465 138.520 71.180 1.00 92.01 O
ATOM 9614 OE2 GLU D 2 -13.490 139.094 71.843 1.00 91.56 O
ATOM 9615 N LEU D 3 -11.500 143.868 67.646 1.00 75.57 N
ATOM 9616 CA LEU D 3 -11.274 144.107 66.232 1.00 70.69 C
ATOM 9617 C LEU D 3 -10.062 144.956 65.953 1.00 67.12 C
ATOM 9618 O LEU D 3 -9.814 145.959 66.619 1.00 65.76 O
ATOM 9619 CB LEU D 3 -12.502 144.761 65.611 1.00 71.36 C
ATOM 9620 CG LEU D 3 -13.777 143.937 65.744 1.00 71.17 C
ATOM 9621 CD1 LEU D 3 -14.961 144.759 65.281 1.00 70.98 C
ATOM 9622 CD2 LEU D 3 -13.637 142.652 64.940 1.00 70.51 C
ATOM 9623 N GLU D 4 -9.306 144.527 64.954 1.00 63.78 N
ATOM 9624 CA GLU D 4 -8.118 145.228 64.523 1.00 60.97 C
ATOM 9625 C GLU D 4 -7.920 145.008 63.038 1.00 56.49 C
ATOM 9626 O GLU D 4 -8.293 143.974 62.494 1.00 53.76 O
ATOM 9627 CB GLU D 4 -6.896 144.754 65.305 1.00 64.31 C
ATOM 9628 CG GLU D 4 -6.810 143.258 65.490 1.00 70.29 C
ATOM 9629 CD GLU D 4 -5.715 142.844 66.477 1.00 73.24 C
ATOM 9630 OE1 GLU D 4 -5.591 141.627 66.738 1.00 74.25 O
ATOM 9631 OE2 GLU D 4 -4.984 143.728 66.990 1.00 74.41 O
ATOM 9632 N LEU D 5 -7.348 146.007 62.386 1.00 52.04 N
ATOM 9633 CA LEU D 5 -7.096 145.946 60.961 1.00 47.94 C
ATOM 9634 C LEU D 5 -5.592 145.793 60.758 1.00 45.81 C
ATOM 9635 O LEU D 5 -4.812 146.611 61.225 1.00 47.11 O
ATOM 9636 CB LEU D 5 -7.604 147.235 60.312 1.00 46.62 C
ATOM 9637 CG LEU D 5 -7.167 147.507 58.882 1.00 45.76 C
ATOM 9638 CD1 LEU D 5 -7.907 146.589 57.943 1.00 45.83 C
ATOM 9639 CD2 LEU D 5 -7.434 148.952 58.544 1.00 48.30 C
ATOM 9640 N HIS D 6 -5.169 144.747 60.068 1.00 44.45 N
ATOM 9641 CA HIS D 6 -3.739 144.557 59.851 1.00 44.23 C
ATOM 9642 C HIS D 6 -3.288 145.082 58.487 1.00 42.36 C
ATOM 9643 O HIS D 6 -3.939 144.844 57.464 1.00 43.42 O
ATOM 9644 CB HIS D 6 -3.386 143.080 60.026 1.00 46.99 C
ATOM 9645 CG HIS D 6 -3.680 142.556 61.402 1.00 51.39 C
ATOM 9646 ND1 HIS D 6 -3.842 141.214 61.673 1.00 51.06 N
ATOM 9647 CD2 HIS D 6 -3.864 143.201 62.581 1.00 53.26 C
ATOM 9648 CE1 HIS D 6 -4.119 141.056 62.957 1.00 53.00 C
ATOM 9649 NE2 HIS D 6 -4.139 142.246 63.530 1.00 53.89 N
ATOM 9650 N PRO D 7 -2.160 145.809 58.458 1.00 39.44 N
ATOM 9651 CA PRO D 7 -1.589 146.399 57.243 1.00 37.06 C
ATOM 9652 C PRO D 7 -1.214 145.417 56.144 1.00 35.58 C
ATOM 9653 O PRO D 7 -0.822 144.298 56.415 1.00 35.12 O
ATOM 9654 CB PRO D 7 -0.372 147.137 57.771 1.00 37.60 C
ATOM 9655 CG PRO D 7 0.064 146.270 58.915 1.00 36.38 C
ATOM 9656 CD PRO D 7 -1.234 145.967 59.596 1.00 37.75 C
ATOM 9657 N PRO D 8 -1.334 145.833 54.874 1.00 35.24 N
ATOM 9658 CA PRO D 8 -0.979 144.939 53.765 1.00 33.12 C
ATOM 9659 C PRO D 8 0.530 144.879 53.676 1.00 31.22 C
ATOM 9660 O PRO D 8 1.220 145.618 54.359 1.00 33.12 O
ATOM 9661 CB PRO D 8 -1.584 145.643 52.548 1.00 30.78 C
ATOM 9662 CG PRO D 8 -1.412 147.060 52.892 1.00 28.69 C
ATOM 9663 CD PRO D 8 -1.846 147.116 54.355 1.00 33.05 C
ATOM 9664 N ALA D 9 1.048 144.028 52.813 1.00 30.56 N
ATOM 9665 CA ALA D 9 2.491 143.922 52.669 1.00 30.80 C
ATOM 9666 C ALA D 9 2.994 144.687 51.451 1.00 31.85 C
ATOM 9667 O ALA D 9 2.800 144.244 50.320 1.00 33.62 O
ATOM 9668 CB ALA D 9 2.877 142.472 52.566 1.00 23.77 C
ATOM 9669 N PHE D 10 3.631 145.836 51.661 1.00 33.16 N
ATOM 9670 CA PHE D 10 4.144 146.596 50.517 1.00 33.45 C
ATOM 9671 C PHE D 10 5.468 146.025 50.025 1.00 33.94 C
ATOM 9672 O PHE D 10 6.306 145.565 50.807 1.00 34.59 O
ATOM 9673 CB PHE D 10 4.323 148.072 50.866 1.00 33.93 C
ATOM 9674 CG PHE D 10 3.044 148.764 51.225 1.00 35.86 C
ATOM 9675 CD1 PHE D 10 2.466 148.574 52.471 1.00 36.10 C
ATOM 9676 CD2 PHE D 10 2.400 149.587 50.308 1.00 35.79 C
ATOM 9677 CE1 PHE D 10 1.269 149.191 52.803 1.00 36.33 C
ATOM 9678 CE2 PHE D 10 1.198 150.206 50.636 1.00 37.03 C
ATOM 9679 CZ PHE D 10 0.634 150.007 51.885 1.00 35.90 C
ATOM 9680 N PRO D 11 5.677 146.046 48.709 1.00 34.15 N
ATOM 9681 CA PRO D 11 6.910 145.525 48.114 1.00 33.49 C
ATOM 9682 C PRO D 11 8.143 146.422 48.294 1.00 32.44 C
ATOM 9683 O PRO D 11 8.700 146.908 47.308 1.00 31.66 O
ATOM 9684 CB PRO D 11 6.522 145.364 46.649 1.00 31.31 C
ATOM 9685 CG PRO D 11 5.650 146.507 46.443 1.00 30.23 C
ATOM 9686 CD PRO D 11 4.754 146.498 47.659 1.00 32.80 C
ATOM 9687 N TRP D 12 8.566 146.631 49.542 1.00 31.03 N
ATOM 9688 CA TRP D 12 9.742 147.467 49.827 1.00 30.61 C
ATOM 9689 C TRP D 12 10.944 146.983 49.011 1.00 30.83 C
ATOM 9690 O TRP D 12 11.157 145.777 48.876 1.00 28.82 O
ATOM 9691 CB TRP D 12 10.103 147.422 51.324 1.00 26.18 C
ATOM 9692 CG TRP D 12 8.959 147.753 52.205 1.00 27.07 C
ATOM 9693 CD1 TRP D 12 8.038 146.882 52.718 1.00 26.07 C
ATOM 9694 CD2 TRP D 12 8.549 149.065 52.624 1.00 26.99 C
ATOM 9695 NE1 TRP D 12 7.080 147.569 53.428 1.00 26.45 N
ATOM 9696 CE2 TRP D 12 7.366 148.909 53.383 1.00 26.89 C
ATOM 9697 CE3 TRP D 12 9.062 150.354 52.423 1.00 25.31 C
ATOM 9698 CZ2 TRP D 12 6.685 149.991 53.940 1.00 27.16 C
ATOM 9699 CZ3 TRP D 12 8.389 151.429 52.975 1.00 28.71 C
ATOM 9700 CH2 TRP D 12 7.207 151.241 53.727 1.00 28.06 C
ATOM 9701 N SER D 13 11.738 147.909 48.479 1.00 29.96 N
ATOM 9702 CA SER D 13 12.885 147.479 47.707 1.00 30.97 C
ATOM 9703 C SER D 13 13.964 146.840 48.591 1.00 32.14 C
ATOM 9704 O SER D 13 15.007 146.421 48.101 1.00 34.40 O
ATOM 9705 CB SER D 13 13.485 148.646 46.945 1.00 28.04 C
ATOM 9706 OG SER D 13 14.194 149.477 47.831 1.00 31.21 O
ATOM 9707 N HIS D 14 13.736 146.759 49.892 1.00 32.95 N
ATOM 9708 CA HIS D 14 14.740 146.147 50.750 1.00 35.11 C
ATOM 9709 C HIS D 14 14.196 144.900 51.419 1.00 37.20 C
ATOM 9710 O HIS D 14 14.813 144.370 52.336 1.00 39.06 O
ATOM 9711 CB HIS D 14 15.204 147.132 51.817 1.00 34.90 C
ATOM 9712 CG HIS D 14 14.089 147.712 52.627 1.00 35.34 C
ATOM 9713 ND1 HIS D 14 13.542 148.949 52.363 1.00 35.27 N
ATOM 9714 CD2 HIS D 14 13.394 147.209 53.674 1.00 33.86 C
ATOM 9715 CE1 HIS D 14 12.556 149.181 53.213 1.00 33.57 C
ATOM 9716 NE2 HIS D 14 12.446 148.140 54.018 1.00 32.77 N
ATOM 9717 N GLY D 15 13.038 144.438 50.954 1.00 38.31 N
ATOM 9718 CA GLY D 15 12.417 143.262 51.532 1.00 38.55 C
ATOM 9719 C GLY D 15 13.037 141.931 51.130 1.00 40.43 C
ATOM 9720 O GLY D 15 13.013 140.966 51.910 1.00 40.42 O
ATOM 9721 N GLY D 16 13.581 141.861 49.918 1.00 39.72 N
ATOM 9722 CA GLY D 16 14.192 140.619 49.470 1.00 39.81 C
ATOM 9723 C GLY D 16 15.371 140.171 50.322 1.00 39.20 C
ATOM 9724 O GLY D 16 16.089 141.002 50.892 1.00 39.34 O
ATOM 9725 N PRO D 17 15.606 138.858 50.430 1.00 37.93 N
ATOM 9726 CA PRO D 17 16.737 138.406 51.247 1.00 38.61 C
ATOM 9727 C PRO D 17 18.099 138.943 50.809 1.00 39.22 C
ATOM 9728 O PRO D 17 19.034 138.959 51.599 1.00 42.06 O
ATOM 9729 CB PRO D 17 16.640 136.878 51.169 1.00 37.08 C
ATOM 9730 CG PRO D 17 15.902 136.636 49.871 1.00 33.33 C
ATOM 9731 CD PRO D 17 14.860 137.718 49.872 1.00 35.12 C
ATOM 9732 N LEU D 18 18.221 139.380 49.561 1.00 39.34 N
ATOM 9733 CA LEU D 18 19.491 139.927 49.085 1.00 38.92 C
ATOM 9734 C LEU D 18 19.345 141.394 48.674 1.00 39.29 C
ATOM 9735 O LEU D 18 20.228 141.981 48.038 1.00 38.00 O
ATOM 9736 CB LEU D 18 19.998 139.122 47.900 1.00 37.81 C
ATOM 9737 CG LEU D 18 20.405 137.680 48.184 1.00 38.53 C
ATOM 9738 CD1 LEU D 18 20.962 137.067 46.891 1.00 36.68 C
ATOM 9739 CD2 LEU D 18 21.449 137.643 49.304 1.00 38.14 C
ATOM 9740 N SER D 19 18.226 141.987 49.067 1.00 38.49 N
ATOM 9741 CA SER D 19 17.941 143.356 48.714 1.00 38.24 C
ATOM 9742 C SER D 19 18.415 144.358 49.739 1.00 38.23 C
ATOM 9743 O SER D 19 17.944 144.374 50.874 1.00 38.72 O
ATOM 9744 CB SER D 19 16.446 143.510 48.503 1.00 39.53 C
ATOM 9745 OG SER D 19 15.951 142.370 47.841 1.00 40.96 O
ATOM 9746 N ALA D 20 19.344 145.208 49.322 1.00 37.60 N
ATOM 9747 CA ALA D 20 19.875 146.238 50.186 1.00 36.05 C
ATOM 9748 C ALA D 20 18.811 147.312 50.294 1.00 37.33 C
ATOM 9749 O ALA D 20 17.769 147.240 49.645 1.00 37.82 O
ATOM 9750 CB ALA D 20 21.126 146.820 49.583 1.00 32.85 C
ATOM 9751 N LEU D 21 19.078 148.300 51.133 1.00 37.37 N
ATOM 9752 CA LEU D 21 18.185 149.425 51.312 1.00 36.01 C
ATOM 9753 C LEU D 21 18.464 150.376 50.153 1.00 37.56 C
ATOM 9754 O LEU D 21 19.572 150.390 49.617 1.00 37.16 O
ATOM 9755 CB LEU D 21 18.514 150.143 52.620 1.00 33.69 C
ATOM 9756 CG LEU D 21 18.065 149.583 53.966 1.00 33.46 C
ATOM 9757 CD1 LEU D 21 18.861 150.236 55.073 1.00 30.74 C
ATOM 9758 CD2 LEU D 21 16.581 149.844 54.162 1.00 32.65 C
ATOM 9759 N ASP D 22 17.459 151.164 49.765 1.00 40.35 N
ATOM 9760 CA ASP D 22 17.619 152.161 48.701 1.00 38.67 C
ATOM 9761 C ASP D 22 18.138 153.379 49.424 1.00 36.76 C
ATOM 9762 O ASP D 22 17.383 154.058 50.111 1.00 36.40 O
ATOM 9763 CB ASP D 22 16.288 152.504 48.066 1.00 40.98 C
ATOM 9764 CG ASP D 22 16.448 153.415 46.882 1.00 44.83 C
ATOM 9765 OD1 ASP D 22 17.047 154.495 47.042 1.00 45.17 O
ATOM 9766 OD2 ASP D 22 15.984 153.047 45.782 1.00 50.04 O
ATOM 9767 N HIS D 23 19.421 153.666 49.279 1.00 36.24 N
ATOM 9768 CA HIS D 23 19.992 154.787 50.005 1.00 37.18 C
ATOM 9769 C HIS D 23 19.495 156.170 49.641 1.00 36.96 C
ATOM 9770 O HIS D 23 19.518 157.086 50.474 1.00 35.74 O
ATOM 9771 CB HIS D 23 21.515 154.703 49.972 1.00 36.18 C
ATOM 9772 CG HIS D 23 22.043 153.558 50.778 1.00 38.31 C
ATOM 9773 ND1 HIS D 23 23.054 153.698 51.704 1.00 37.32 N
ATOM 9774 CD2 HIS D 23 21.671 152.255 50.817 1.00 36.69 C
ATOM 9775 CE1 HIS D 23 23.283 152.529 52.279 1.00 37.13 C
ATOM 9776 NE2 HIS D 23 22.458 151.638 51.758 1.00 37.09 N
ATOM 9777 N SER D 24 19.042 156.334 48.404 1.00 37.14 N
ATOM 9778 CA SER D 24 18.494 157.622 48.007 1.00 36.43 C
ATOM 9779 C SER D 24 17.245 157.811 48.861 1.00 36.27 C
ATOM 9780 O SER D 24 17.004 158.891 49.428 1.00 38.06 O
ATOM 9781 CB SER D 24 18.117 157.615 46.528 1.00 36.35 C
ATOM 9782 OG SER D 24 19.280 157.593 45.728 1.00 37.98 O
ATOM 9783 N SER D 25 16.469 156.736 48.968 1.00 34.26 N
ATOM 9784 CA SER D 25 15.249 156.740 49.748 1.00 33.60 C
ATOM 9785 C SER D 25 15.554 156.968 51.222 1.00 35.46 C
ATOM 9786 O SER D 25 14.811 157.686 51.898 1.00 36.84 O
ATOM 9787 CB SER D 25 14.511 155.423 49.569 1.00 32.47 C
ATOM 9788 OG SER D 25 13.237 155.485 50.166 1.00 34.36 O
ATOM 9789 N VAL D 26 16.642 156.373 51.722 1.00 34.95 N
ATOM 9790 CA VAL D 26 17.021 156.543 53.129 1.00 33.64 C
ATOM 9791 C VAL D 26 17.464 157.970 53.419 1.00 33.44 C
ATOM 9792 O VAL D 26 17.191 158.513 54.496 1.00 32.15 O
ATOM 9793 CB VAL D 26 18.168 155.598 53.541 1.00 33.50 C
ATOM 9794 CG1 VAL D 26 18.545 155.850 54.987 1.00 31.24 C
ATOM 9795 CG2 VAL D 26 17.740 154.154 53.372 1.00 32.91 C
ATOM 9796 N ARG D 27 18.148 158.574 52.451 1.00 34.67 N
ATOM 9797 CA ARG D 27 18.618 159.950 52.593 1.00 35.69 C
ATOM 9798 C ARG D 27 17.406 160.853 52.710 1.00 35.76 C
ATOM 9799 O ARG D 27 17.298 161.649 53.654 1.00 35.61 O
ATOM 9800 CB ARG D 27 19.450 160.370 51.385 1.00 36.38 C
ATOM 9801 CG ARG D 27 20.008 161.795 51.471 1.00 35.13 C
ATOM 9802 CD ARG D 27 20.917 162.075 50.284 1.00 34.32 C
ATOM 9803 NE ARG D 27 21.343 163.468 50.203 1.00 35.26 N
ATOM 9804 CZ ARG D 27 22.521 163.920 50.611 1.00 34.63 C
ATOM 9805 NH1 ARG D 27 23.401 163.093 51.137 1.00 39.62 N
ATOM 9806 NH2 ARG D 27 22.830 165.196 50.472 1.00 34.38 N
ATOM 9807 N ARG D 28 16.492 160.713 51.751 1.00 35.07 N
ATOM 9808 CA ARG D 28 15.262 161.495 51.768 1.00 35.66 C
ATOM 9809 C ARG D 28 14.524 161.268 53.087 1.00 35.45 C
ATOM 9810 O ARG D 28 14.120 162.224 53.756 1.00 34.12 O
ATOM 9811 CB ARG D 28 14.350 161.101 50.600 1.00 36.37 C
ATOM 9812 CG ARG D 28 14.657 161.809 49.287 1.00 35.13 C
ATOM 9813 CD ARG D 28 13.478 161.709 48.356 1.00 35.13 C
ATOM 9814 NE ARG D 28 13.132 160.318 48.089 1.00 36.84 N
ATOM 9815 CZ ARG D 28 13.774 159.536 47.226 1.00 36.36 C
ATOM 9816 NH1 ARG D 28 14.802 160.008 46.531 1.00 35.68 N
ATOM 9817 NH2 ARG D 28 13.387 158.277 47.066 1.00 37.18 N
ATOM 9818 N GLY D 29 14.353 159.994 53.446 1.00 35.52 N
ATOM 9819 CA GLY D 29 13.684 159.644 54.692 1.00 36.80 C
ATOM 9820 C GLY D 29 14.243 160.411 55.881 1.00 36.36 C
ATOM 9821 O GLY D 29 13.505 160.855 56.773 1.00 35.02 O
ATOM 9822 N PHE D 30 15.560 160.578 55.886 1.00 35.23 N
ATOM 9823 CA PHE D 30 16.207 161.293 56.967 1.00 35.53 C
ATOM 9824 C PHE D 30 15.720 162.731 57.040 1.00 36.58 C
ATOM 9825 O PHE D 30 15.487 163.276 58.130 1.00 38.06 O
ATOM 9826 CB PHE D 30 17.716 161.306 56.776 1.00 33.89 C
ATOM 9827 CG PHE D 30 18.409 162.289 57.663 1.00 32.67 C
ATOM 9828 CD1 PHE D 30 18.471 162.087 59.029 1.00 31.57 C
ATOM 9829 CD2 PHE D 30 18.954 163.454 57.140 1.00 33.98 C
ATOM 9830 CE1 PHE D 30 19.069 163.034 59.863 1.00 30.63 C
ATOM 9831 CE2 PHE D 30 19.553 164.406 57.970 1.00 32.25 C
ATOM 9832 CZ PHE D 30 19.609 164.192 59.330 1.00 30.52 C
ATOM 9833 N GLN D 31 15.593 163.355 55.874 1.00 36.14 N
ATOM 9834 CA GLN D 31 15.142 164.733 55.806 1.00 35.64 C
ATOM 9835 C GLN D 31 13.755 164.841 56.415 1.00 36.08 C
ATOM 9836 O GLN D 31 13.453 165.808 57.117 1.00 37.29 O
ATOM 9837 CB GLN D 31 15.105 165.202 54.363 1.00 35.87 C
ATOM 9838 CG GLN D 31 15.025 166.715 54.189 1.00 39.77 C
ATOM 9839 CD GLN D 31 14.784 167.119 52.729 1.00 42.24 C
ATOM 9840 OE1 GLN D 31 15.501 166.671 51.815 1.00 40.16 O
ATOM 9841 NE2 GLN D 31 13.767 167.965 52.504 1.00 42.04 N
ATOM 9842 N VAL D 32 12.917 163.838 56.154 1.00 35.83 N
ATOM 9843 CA VAL D 32 11.561 163.838 56.684 1.00 34.06 C
ATOM 9844 C VAL D 32 11.601 163.768 58.188 1.00 32.98 C
ATOM 9845 O VAL D 32 10.823 164.442 58.860 1.00 33.98 O
ATOM 9846 CB VAL D 32 10.716 162.649 56.170 1.00 33.26 C
ATOM 9847 CG1 VAL D 32 9.329 162.675 56.825 1.00 30.55 C
ATOM 9848 CG2 VAL D 32 10.572 162.730 54.678 1.00 32.38 C
ATOM 9849 N TYR D 33 12.500 162.945 58.711 1.00 32.53 N
ATOM 9850 CA TYR D 33 12.619 162.804 60.148 1.00 34.17 C
ATOM 9851 C TYR D 33 13.100 164.120 60.756 1.00 35.42 C
ATOM 9852 O TYR D 33 12.547 164.629 61.748 1.00 34.03 O
ATOM 9853 CB TYR D 33 13.627 161.720 60.521 1.00 33.40 C
ATOM 9854 CG TYR D 33 13.935 161.774 62.004 1.00 35.24 C
ATOM 9855 CD1 TYR D 33 12.964 161.422 62.947 1.00 36.34 C
ATOM 9856 CD2 TYR D 33 15.123 162.313 62.467 1.00 32.59 C
ATOM 9857 CE1 TYR D 33 13.163 161.624 64.303 1.00 35.94 C
ATOM 9858 CE2 TYR D 33 15.327 162.515 63.822 1.00 35.97 C
ATOM 9859 CZ TYR D 33 14.337 162.176 64.736 1.00 35.75 C
ATOM 9860 OH TYR D 33 14.484 162.450 66.082 1.00 38.19 O
ATOM 9861 N LYS D 34 14.155 164.650 60.155 1.00 34.60 N
ATOM 9862 CA LYS D 34 14.747 165.874 60.629 1.00 34.80 C
ATOM 9863 C LYS D 34 13.804 167.066 60.592 1.00 35.53 C
ATOM 9864 O LYS D 34 13.669 167.782 61.577 1.00 34.35 O
ATOM 9865 CB LYS D 34 16.007 166.186 59.820 1.00 34.61 C
ATOM 9866 CG LYS D 34 16.537 167.584 60.057 1.00 33.71 C
ATOM 9867 CD LYS D 34 17.870 167.778 59.392 1.00 37.73 C
ATOM 9868 CE LYS D 34 18.146 169.251 59.116 1.00 38.53 C
ATOM 9869 NZ LYS D 34 17.965 170.051 60.356 1.00 42.99 N
ATOM 9870 N GLN D 35 13.151 167.274 59.452 1.00 36.57 N
ATOM 9871 CA GLN D 35 12.256 168.406 59.280 1.00 35.33 C
ATOM 9872 C GLN D 35 10.824 168.258 59.796 1.00 35.50 C
ATOM 9873 O GLN D 35 10.139 169.261 59.993 1.00 35.01 O
ATOM 9874 CB GLN D 35 12.240 168.792 57.810 1.00 36.96 C
ATOM 9875 CG GLN D 35 13.586 169.268 57.320 1.00 38.83 C
ATOM 9876 CD GLN D 35 13.571 169.621 55.866 1.00 41.44 C
ATOM 9877 OE1 GLN D 35 14.587 170.040 55.307 1.00 45.54 O
ATOM 9878 NE2 GLN D 35 12.416 169.451 55.228 1.00 43.02 N
ATOM 9879 N VAL D 36 10.368 167.029 60.032 1.00 34.77 N
ATOM 9880 CA VAL D 36 9.000 166.828 60.504 1.00 32.07 C
ATOM 9881 C VAL D 36 8.851 166.088 61.830 1.00 31.45 C
ATOM 9882 O VAL D 36 8.390 166.647 62.822 1.00 30.95 O
ATOM 9883 CB VAL D 36 8.170 166.080 59.444 1.00 30.70 C
ATOM 9884 CG1 VAL D 36 6.716 166.014 59.865 1.00 31.46 C
ATOM 9885 CG2 VAL D 36 8.279 166.777 58.119 1.00 29.38 C
ATOM 9886 N CYS D 37 9.263 164.832 61.846 1.00 31.09 N
ATOM 9887 CA CYS D 37 9.117 163.995 63.026 1.00 32.03 C
ATOM 9888 C CYS D 37 9.925 164.368 64.253 1.00 30.83 C
ATOM 9889 O CYS D 37 9.472 164.169 65.381 1.00 30.36 O
ATOM 9890 CB CYS D 37 9.424 162.543 62.650 1.00 32.86 C
ATOM 9891 SG CYS D 37 8.835 162.110 60.975 1.00 36.30 S
ATOM 9892 N SER D 38 11.123 164.896 64.047 1.00 30.27 N
ATOM 9893 CA SER D 38 11.976 165.214 65.180 1.00 29.51 C
ATOM 9894 C SER D 38 11.421 166.285 66.064 1.00 28.09 C
ATOM 9895 O SER D 38 11.907 166.495 67.164 1.00 30.16 O
ATOM 9896 CB SER D 38 13.375 165.596 64.718 1.00 30.09 C
ATOM 9897 OG SER D 38 13.318 166.638 63.776 1.00 36.15 O
ATOM 9898 N ALA D 39 10.399 166.976 65.599 1.00 28.15 N
ATOM 9899 CA ALA D 39 9.799 168.017 66.430 1.00 28.65 C
ATOM 9900 C ALA D 39 9.177 167.400 67.690 1.00 27.83 C
ATOM 9901 O ALA D 39 9.093 168.052 68.716 1.00 27.99 O
ATOM 9902 CB ALA D 39 8.731 168.789 65.637 1.00 26.36 C
ATOM 9903 N CYS D 40 8.749 166.145 67.607 1.00 28.12 N
ATOM 9904 CA CYS D 40 8.127 165.496 68.751 1.00 29.83 C
ATOM 9905 C CYS D 40 8.753 164.157 69.064 1.00 29.72 C
ATOM 9906 O CYS D 40 8.582 163.649 70.161 1.00 30.88 O
ATOM 9907 CB CYS D 40 6.636 165.250 68.502 1.00 30.90 C
ATOM 9908 SG CYS D 40 5.708 166.630 67.771 1.00 33.45 S
ATOM 9909 N HIS D 41 9.469 163.579 68.108 1.00 30.05 N
ATOM 9910 CA HIS D 41 10.067 162.264 68.316 1.00 30.03 C
ATOM 9911 C HIS D 41 11.563 162.301 68.465 1.00 30.90 C
ATOM 9912 O HIS D 41 12.249 162.937 67.665 1.00 33.04 O
ATOM 9913 CB HIS D 41 9.743 161.331 67.138 1.00 30.09 C
ATOM 9914 CG HIS D 41 8.320 160.863 67.089 1.00 29.66 C
ATOM 9915 ND1 HIS D 41 7.801 159.963 67.990 1.00 30.71 N
ATOM 9916 CD2 HIS D 41 7.317 161.144 66.222 1.00 29.17 C
ATOM 9917 CE1 HIS D 41 6.543 159.705 67.680 1.00 30.27 C
ATOM 9918 NE2 HIS D 41 6.223 160.409 66.609 1.00 28.14 N
ATOM 9919 N SER D 42 12.073 161.599 69.470 1.00 30.28 N
ATOM 9920 CA SER D 42 13.510 161.516 69.674 1.00 31.18 C
ATOM 9921 C SER D 42 14.014 160.293 68.901 1.00 32.36 C
ATOM 9922 O SER D 42 13.229 159.457 68.472 1.00 32.78 O
ATOM 9923 CB SER D 42 13.826 161.326 71.157 1.00 32.28 C
ATOM 9924 OG SER D 42 13.324 160.084 71.644 1.00 33.40 O
ATOM 9925 N MET D 43 15.324 160.192 68.731 1.00 33.48 N
ATOM 9926 CA MET D 43 15.944 159.050 68.056 1.00 32.67 C
ATOM 9927 C MET D 43 17.269 158.886 68.775 1.00 33.21 C
ATOM 9928 O MET D 43 18.352 158.991 68.175 1.00 30.94 O
ATOM 9929 CB MET D 43 16.182 159.342 66.581 1.00 32.49 C
ATOM 9930 CG MET D 43 16.747 158.152 65.853 1.00 33.40 C
ATOM 9931 SD MET D 43 15.991 157.928 64.257 1.00 35.96 S
ATOM 9932 CE MET D 43 17.275 158.456 63.266 1.00 39.45 C
ATOM 9933 N ASP D 44 17.154 158.654 70.083 1.00 33.51 N
ATOM 9934 CA ASP D 44 18.305 158.530 70.966 1.00 33.03 C
ATOM 9935 C ASP D 44 19.485 157.718 70.487 1.00 32.05 C
ATOM 9936 O ASP D 44 20.604 158.059 70.822 1.00 33.52 O
ATOM 9937 CB ASP D 44 17.893 157.977 72.325 1.00 35.24 C
ATOM 9938 CG ASP D 44 16.878 158.850 73.034 1.00 38.86 C
ATOM 9939 OD1 ASP D 44 16.915 160.086 72.844 1.00 39.44 O
ATOM 9940 OD2 ASP D 44 16.051 158.288 73.796 1.00 39.83 O
ATOM 9941 N TYR D 45 19.266 156.671 69.697 1.00 30.08 N
ATOM 9942 CA TYR D 45 20.383 155.834 69.291 1.00 28.34 C
ATOM 9943 C TYR D 45 21.133 156.097 67.989 1.00 29.61 C
ATOM 9944 O TYR D 45 21.996 155.310 67.608 1.00 31.75 O
ATOM 9945 CB TYR D 45 19.956 154.373 69.350 1.00 26.92 C
ATOM 9946 CG TYR D 45 19.539 153.959 70.738 1.00 28.03 C
ATOM 9947 CD1 TYR D 45 18.251 154.228 71.212 1.00 27.56 C
ATOM 9948 CD2 TYR D 45 20.445 153.336 71.606 1.00 29.10 C
ATOM 9949 CE1 TYR D 45 17.877 153.889 72.510 1.00 27.73 C
ATOM 9950 CE2 TYR D 45 20.079 152.990 72.926 1.00 26.50 C
ATOM 9951 CZ TYR D 45 18.796 153.273 73.367 1.00 27.62 C
ATOM 9952 OH TYR D 45 18.423 152.972 74.661 1.00 25.91 O
ATOM 9953 N VAL D 46 20.847 157.195 67.305 1.00 29.76 N
ATOM 9954 CA VAL D 46 21.561 157.469 66.069 1.00 28.27 C
ATOM 9955 C VAL D 46 22.307 158.795 66.158 1.00 28.57 C
ATOM 9956 O VAL D 46 21.771 159.804 66.593 1.00 28.43 O
ATOM 9957 CB VAL D 46 20.613 157.494 64.862 1.00 29.18 C
ATOM 9958 CG1 VAL D 46 21.418 157.662 63.573 1.00 28.63 C
ATOM 9959 CG2 VAL D 46 19.816 156.212 64.818 1.00 26.82 C
ATOM 9960 N ALA D 47 23.565 158.777 65.748 1.00 28.98 N
ATOM 9961 CA ALA D 47 24.395 159.964 65.791 1.00 29.65 C
ATOM 9962 C ALA D 47 24.651 160.453 64.370 1.00 30.02 C
ATOM 9963 O ALA D 47 24.553 159.692 63.397 1.00 28.79 O
ATOM 9964 CB ALA D 47 25.706 159.648 66.493 1.00 27.38 C
ATOM 9965 N PHE D 48 24.984 161.730 64.240 1.00 30.77 N
ATOM 9966 CA PHE D 48 25.227 162.267 62.913 1.00 31.04 C
ATOM 9967 C PHE D 48 26.326 161.511 62.156 1.00 31.30 C
ATOM 9968 O PHE D 48 26.282 161.439 60.927 1.00 34.35 O
ATOM 9969 CB PHE D 48 25.550 163.755 62.994 1.00 28.51 C
ATOM 9970 CG PHE D 48 24.410 164.595 63.499 1.00 27.69 C
ATOM 9971 CD1 PHE D 48 24.329 164.964 64.829 1.00 28.65 C
ATOM 9972 CD2 PHE D 48 23.422 165.040 62.635 1.00 30.01 C
ATOM 9973 CE1 PHE D 48 23.272 165.778 65.289 1.00 28.25 C
ATOM 9974 CE2 PHE D 48 22.369 165.848 63.090 1.00 28.80 C
ATOM 9975 CZ PHE D 48 22.302 166.215 64.418 1.00 26.72 C
ATOM 9976 N ARG D 49 27.293 160.934 62.870 1.00 30.18 N
ATOM 9977 CA ARG D 49 28.369 160.191 62.217 1.00 28.87 C
ATOM 9978 C ARG D 49 27.849 158.937 61.507 1.00 30.48 C
ATOM 9979 O ARG D 49 28.403 158.516 60.497 1.00 32.67 O
ATOM 9980 CB ARG D 49 29.456 159.820 63.221 1.00 27.56 C
ATOM 9981 CG ARG D 49 28.990 158.948 64.386 1.00 30.56 C
ATOM 9982 CD ARG D 49 30.129 158.598 65.354 1.00 28.48 C
ATOM 9983 NE ARG D 49 29.635 157.890 66.533 1.00 30.35 N
ATOM 9984 CZ ARG D 49 29.133 156.657 66.514 1.00 29.76 C
ATOM 9985 NH1 ARG D 49 29.064 155.993 65.372 1.00 27.63 N
ATOM 9986 NH2 ARG D 49 28.696 156.089 67.638 1.00 28.70 N
ATOM 9987 N ASN D 50 26.777 158.348 62.017 1.00 29.94 N
ATOM 9988 CA ASN D 50 26.192 157.170 61.388 1.00 29.76 C
ATOM 9989 C ASN D 50 25.735 157.452 59.939 1.00 31.95 C
ATOM 9990 O ASN D 50 25.583 156.534 59.117 1.00 33.49 O
ATOM 9991 CB ASN D 50 25.000 156.689 62.219 1.00 27.66 C
ATOM 9992 CG ASN D 50 25.421 156.160 63.568 1.00 29.07 C
ATOM 9993 OD1 ASN D 50 26.165 155.194 63.646 1.00 27.76 O
ATOM 9994 ND2 ASN D 50 24.947 156.788 64.640 1.00 29.29 N
ATOM 9995 N LEU D 51 25.513 158.723 59.625 1.00 32.81 N
ATOM 9996 CA LEU D 51 25.059 159.094 58.297 1.00 33.41 C
ATOM 9997 C LEU D 51 26.159 158.951 57.263 1.00 33.80 C
ATOM 9998 O LEU D 51 25.920 158.540 56.129 1.00 33.52 O
ATOM 9999 CB LEU D 51 24.556 160.535 58.296 1.00 32.54 C
ATOM 10000 CG LEU D 51 23.331 160.836 59.151 1.00 33.32 C
ATOM 10001 CD1 LEU D 51 23.113 162.337 59.177 1.00 32.27 C
ATOM 10002 CD2 LEU D 51 22.108 160.103 58.595 1.00 31.51 C
ATOM 10003 N ILE D 52 27.372 159.295 57.672 1.00 34.28 N
ATOM 10004 CA ILE D 52 28.528 159.253 56.785 1.00 33.13 C
ATOM 10005 C ILE D 52 28.724 157.951 56.037 1.00 33.17 C
ATOM 10006 O ILE D 52 28.710 156.888 56.629 1.00 34.18 O
ATOM 10007 CB ILE D 52 29.808 159.532 57.565 1.00 30.92 C
ATOM 10008 CG1 ILE D 52 29.665 160.844 58.337 1.00 29.49 C
ATOM 10009 CG2 ILE D 52 30.971 159.572 56.613 1.00 29.90 C
ATOM 10010 CD1 ILE D 52 30.875 161.225 59.092 1.00 26.73 C
ATOM 10011 N GLY D 53 28.918 158.041 54.729 1.00 34.13 N
ATOM 10012 CA GLY D 53 29.153 156.849 53.937 1.00 34.59 C
ATOM 10013 C GLY D 53 27.950 155.951 53.807 1.00 36.09 C
ATOM 10014 O GLY D 53 28.038 154.829 53.304 1.00 38.78 O
ATOM 10015 N VAL D 54 26.813 156.445 54.267 1.00 36.69 N
ATOM 10016 CA VAL D 54 25.571 155.700 54.190 1.00 36.02 C
ATOM 10017 C VAL D 54 24.606 156.544 53.378 1.00 37.67 C
ATOM 10018 O VAL D 54 24.151 156.122 52.310 1.00 39.15 O
ATOM 10019 CB VAL D 54 24.981 155.448 55.592 1.00 36.09 C
ATOM 10020 CG1 VAL D 54 23.579 154.835 55.483 1.00 34.32 C
ATOM 10021 CG2 VAL D 54 25.893 154.536 56.359 1.00 33.10 C
ATOM 10022 N THR D 55 24.311 157.744 53.875 1.00 37.08 N
ATOM 10023 CA THR D 55 23.399 158.651 53.186 1.00 38.25 C
ATOM 10024 C THR D 55 24.018 160.029 52.910 1.00 38.50 C
ATOM 10025 O THR D 55 23.578 160.746 52.018 1.00 36.39 O
ATOM 10026 CB THR D 55 22.106 158.866 54.007 1.00 38.64 C
ATOM 10027 OG1 THR D 55 22.453 159.191 55.361 1.00 39.28 O
ATOM 10028 CG2 THR D 55 21.235 157.617 53.982 1.00 38.72 C
ATOM 10029 N HIS D 56 25.046 160.381 53.671 1.00 38.86 N
ATOM 10030 CA HIS D 56 25.692 161.675 53.534 1.00 40.53 C
ATOM 10031 C HIS D 56 27.205 161.569 53.521 1.00 42.41 C
ATOM 10032 O HIS D 56 27.778 160.560 53.948 1.00 42.99 O
ATOM 10033 CB HIS D 56 25.308 162.582 54.711 1.00 41.41 C
ATOM 10034 CG HIS D 56 23.847 162.908 54.780 1.00 43.48 C
ATOM 10035 ND1 HIS D 56 22.875 161.948 54.967 1.00 42.48 N
ATOM 10036 CD2 HIS D 56 23.194 164.089 54.673 1.00 41.85 C
ATOM 10037 CE1 HIS D 56 21.688 162.525 54.970 1.00 41.20 C
ATOM 10038 NE2 HIS D 56 21.854 163.823 54.794 1.00 40.68 N
ATOM 10039 N THR D 57 27.848 162.638 53.052 1.00 43.15 N
ATOM 10040 CA THR D 57 29.304 162.711 53.027 1.00 43.04 C
ATOM 10041 C THR D 57 29.716 163.280 54.374 1.00 44.52 C
ATOM 10042 O THR D 57 28.909 163.898 55.067 1.00 44.79 O
ATOM 10043 CB THR D 57 29.829 163.678 51.970 1.00 40.83 C
ATOM 10044 OG1 THR D 57 29.464 165.013 52.340 1.00 40.60 O
ATOM 10045 CG2 THR D 57 29.266 163.331 50.596 1.00 39.89 C
ATOM 10046 N GLU D 58 30.969 163.077 54.748 1.00 45.30 N
ATOM 10047 CA GLU D 58 31.431 163.590 56.013 1.00 46.60 C
ATOM 10048 C GLU D 58 31.202 165.101 56.126 1.00 45.89 C
ATOM 10049 O GLU D 58 30.783 165.600 57.169 1.00 46.50 O
ATOM 10050 CB GLU D 58 32.901 163.265 56.181 1.00 49.81 C
ATOM 10051 CG GLU D 58 33.484 163.861 57.427 1.00 54.57 C
ATOM 10052 CD GLU D 58 34.689 163.100 57.886 1.00 57.81 C
ATOM 10053 OE1 GLU D 58 35.572 162.826 57.036 1.00 60.12 O
ATOM 10054 OE2 GLU D 58 34.745 162.777 59.095 1.00 60.03 O
ATOM 10055 N ALA D 59 31.467 165.835 55.054 1.00 44.48 N
ATOM 10056 CA ALA D 59 31.278 167.276 55.094 1.00 43.50 C
ATOM 10057 C ALA D 59 29.826 167.619 55.425 1.00 43.67 C
ATOM 10058 O ALA D 59 29.558 168.490 56.264 1.00 44.20 O
ATOM 10059 CB ALA D 59 31.674 167.881 53.775 1.00 43.65 C
ATOM 10060 N GLU D 60 28.892 166.933 54.764 1.00 41.68 N
ATOM 10061 CA GLU D 60 27.468 167.152 55.006 1.00 39.64 C
ATOM 10062 C GLU D 60 27.098 166.847 56.451 1.00 39.98 C
ATOM 10063 O GLU D 60 26.481 167.662 57.127 1.00 41.56 O
ATOM 10064 CB GLU D 60 26.622 166.261 54.102 1.00 36.79 C
ATOM 10065 CG GLU D 60 26.580 166.671 52.669 1.00 35.11 C
ATOM 10066 CD GLU D 60 25.919 165.625 51.805 1.00 39.07 C
ATOM 10067 OE1 GLU D 60 25.478 165.974 50.690 1.00 41.83 O
ATOM 10068 OE2 GLU D 60 25.847 164.448 52.230 1.00 38.33 O
ATOM 10069 N ALA D 61 27.483 165.664 56.914 1.00 39.83 N
ATOM 10070 CA ALA D 61 27.173 165.223 58.261 1.00 39.89 C
ATOM 10071 C ALA D 61 27.606 166.244 59.303 1.00 41.91 C
ATOM 10072 O ALA D 61 26.887 166.507 60.281 1.00 40.12 O
ATOM 10073 CB ALA D 61 27.837 163.881 58.522 1.00 39.29 C
ATOM 10074 N LYS D 62 28.785 166.822 59.091 1.00 43.50 N
ATOM 10075 CA LYS D 62 29.313 167.809 60.026 1.00 44.91 C
ATOM 10076 C LYS D 62 28.382 169.030 60.051 1.00 44.38 C
ATOM 10077 O LYS D 62 28.044 169.557 61.126 1.00 42.03 O
ATOM 10078 CB LYS D 62 30.729 168.213 59.610 1.00 45.45 C
ATOM 10079 CG LYS D 62 31.342 169.236 60.519 1.00 49.12 C
ATOM 10080 CD LYS D 62 32.774 169.553 60.129 1.00 53.88 C
ATOM 10081 CE LYS D 62 33.329 170.687 60.993 1.00 56.00 C
ATOM 10082 NZ LYS D 62 34.795 170.863 60.795 1.00 60.17 N
ATOM 10083 N ALA D 63 27.963 169.458 58.860 1.00 42.74 N
ATOM 10084 CA ALA D 63 27.062 170.591 58.725 1.00 42.33 C
ATOM 10085 C ALA D 63 25.809 170.279 59.536 1.00 42.64 C
ATOM 10086 O ALA D 63 25.464 171.000 60.467 1.00 43.78 O
ATOM 10087 CB ALA D 63 26.711 170.805 57.271 1.00 41.57 C
ATOM 10088 N LEU D 64 25.134 169.194 59.186 1.00 42.27 N
ATOM 10089 CA LEU D 64 23.945 168.779 59.917 1.00 41.86 C
ATOM 10090 C LEU D 64 24.123 168.857 61.429 1.00 42.66 C
ATOM 10091 O LEU D 64 23.269 169.392 62.128 1.00 43.90 O
ATOM 10092 CB LEU D 64 23.575 167.353 59.540 1.00 39.36 C
ATOM 10093 CG LEU D 64 23.014 167.273 58.129 1.00 37.00 C
ATOM 10094 CD1 LEU D 64 23.045 165.842 57.660 1.00 38.18 C
ATOM 10095 CD2 LEU D 64 21.614 167.832 58.109 1.00 31.99 C
ATOM 10096 N ALA D 65 25.231 168.336 61.939 1.00 43.40 N
ATOM 10097 CA ALA D 65 25.458 168.359 63.381 1.00 44.33 C
ATOM 10098 C ALA D 65 25.635 169.761 63.945 1.00 44.76 C
ATOM 10099 O ALA D 65 25.205 170.047 65.057 1.00 43.32 O
ATOM 10100 CB ALA D 65 26.675 167.498 63.742 1.00 42.45 C
ATOM 10101 N GLU D 66 26.266 170.640 63.178 1.00 47.55 N
ATOM 10102 CA GLU D 66 26.518 171.989 63.661 1.00 49.93 C
ATOM 10103 C GLU D 66 25.261 172.835 63.695 1.00 49.33 C
ATOM 10104 O GLU D 66 25.210 173.856 64.384 1.00 50.56 O
ATOM 10105 CB GLU D 66 27.629 172.645 62.828 1.00 52.82 C
ATOM 10106 CG GLU D 66 28.937 171.858 62.911 1.00 58.09 C
ATOM 10107 CD GLU D 66 30.051 172.429 62.052 1.00 62.32 C
ATOM 10108 OE1 GLU D 66 29.761 172.884 60.922 1.00 64.97 O
ATOM 10109 OE2 GLU D 66 31.223 172.402 62.497 1.00 64.66 O
ATOM 10110 N GLU D 67 24.238 172.400 62.969 1.00 48.04 N
ATOM 10111 CA GLU D 67 22.966 173.107 62.966 1.00 47.63 C
ATOM 10112 C GLU D 67 22.323 173.030 64.341 1.00 49.50 C
ATOM 10113 O GLU D 67 21.460 173.823 64.674 1.00 50.96 O
ATOM 10114 CB GLU D 67 22.017 172.489 61.957 1.00 45.14 C
ATOM 10115 CG GLU D 67 22.262 172.918 60.539 1.00 45.18 C
ATOM 10116 CD GLU D 67 21.308 172.242 59.599 1.00 46.95 C
ATOM 10117 OE1 GLU D 67 20.114 172.187 59.956 1.00 48.81 O
ATOM 10118 OE2 GLU D 67 21.736 171.765 58.520 1.00 46.93 O
ATOM 10119 N VAL D 68 22.746 172.067 65.142 1.00 52.98 N
ATOM 10120 CA VAL D 68 22.195 171.890 66.475 1.00 55.89 C
ATOM 10121 C VAL D 68 23.087 172.461 67.573 1.00 59.27 C
ATOM 10122 O VAL D 68 24.318 172.475 67.456 1.00 59.63 O
ATOM 10123 CB VAL D 68 21.989 170.396 66.790 1.00 55.40 C
ATOM 10124 CG1 VAL D 68 21.263 170.242 68.120 1.00 55.46 C
ATOM 10125 CG2 VAL D 68 21.243 169.720 65.661 1.00 53.80 C
ATOM 10126 N GLU D 69 22.456 172.940 68.640 1.00 62.68 N
ATOM 10127 CA GLU D 69 23.198 173.457 69.783 1.00 67.12 C
ATOM 10128 C GLU D 69 23.090 172.356 70.824 1.00 67.18 C
ATOM 10129 O GLU D 69 22.000 171.843 71.070 1.00 68.41 O
ATOM 10130 CB GLU D 69 22.575 174.755 70.335 1.00 71.17 C
ATOM 10131 CG GLU D 69 22.745 176.006 69.445 1.00 78.58 C
ATOM 10132 CD GLU D 69 24.212 176.422 69.227 1.00 82.47 C
ATOM 10133 OE1 GLU D 69 24.891 176.792 70.219 1.00 84.06 O
ATOM 10134 OE2 GLU D 69 24.683 176.381 68.059 1.00 83.68 O
ATOM 10135 N VAL D 70 24.211 171.961 71.410 1.00 66.34 N
ATOM 10136 CA VAL D 70 24.168 170.926 72.421 1.00 66.36 C
ATOM 10137 C VAL D 70 24.734 171.457 73.717 1.00 66.94 C
ATOM 10138 O VAL D 70 25.551 172.376 73.719 1.00 66.43 O
ATOM 10139 CB VAL D 70 24.949 169.686 71.989 1.00 65.54 C
ATOM 10140 CG1 VAL D 70 24.215 168.982 70.879 1.00 66.92 C
ATOM 10141 CG2 VAL D 70 26.305 170.086 71.502 1.00 67.80 C
ATOM 10142 N GLN D 71 24.276 170.883 74.822 1.00 68.51 N
ATOM 10143 CA GLN D 71 24.734 171.291 76.134 1.00 69.45 C
ATOM 10144 C GLN D 71 25.970 170.499 76.486 1.00 70.25 C
ATOM 10145 O GLN D 71 26.072 169.316 76.166 1.00 70.23 O
ATOM 10146 CB GLN D 71 23.658 171.042 77.178 1.00 69.49 C
ATOM 10147 CG GLN D 71 23.956 171.702 78.495 1.00 72.12 C
ATOM 10148 CD GLN D 71 22.729 171.802 79.372 1.00 73.73 C
ATOM 10149 OE1 GLN D 71 22.275 170.804 79.935 1.00 74.72 O
ATOM 10150 NE2 GLN D 71 22.174 173.010 79.487 1.00 72.97 N
ATOM 10151 N ASP D 72 26.910 171.162 77.146 1.00 71.70 N
ATOM 10152 CA ASP D 72 28.150 170.527 77.538 1.00 72.65 C
ATOM 10153 C ASP D 72 28.593 171.149 78.856 1.00 73.52 C
ATOM 10154 O ASP D 72 27.883 171.990 79.419 1.00 73.67 O
ATOM 10155 CB ASP D 72 29.199 170.748 76.450 1.00 72.59 C
ATOM 10156 CG ASP D 72 30.214 169.638 76.396 1.00 73.61 C
ATOM 10157 OD1 ASP D 72 30.908 169.430 77.411 1.00 75.00 O
ATOM 10158 OD2 ASP D 72 30.312 168.971 75.342 1.00 73.66 O
ATOM 10159 N GLY D 73 29.757 170.734 79.346 1.00 73.48 N
ATOM 10160 CA GLY D 73 30.260 171.266 80.597 1.00 73.11 C
ATOM 10161 C GLY D 73 30.345 170.188 81.653 1.00 73.38 C
ATOM 10162 O GLY D 73 30.215 169.012 81.334 1.00 71.97 O
ATOM 10163 N PRO D 74 30.547 170.558 82.927 1.00 74.72 N
ATOM 10164 CA PRO D 74 30.693 171.943 83.380 1.00 75.50 C
ATOM 10165 C PRO D 74 32.030 172.550 82.981 1.00 76.24 C
ATOM 10166 O PRO D 74 33.004 171.829 82.763 1.00 75.72 O
ATOM 10167 CB PRO D 74 30.543 171.818 84.890 1.00 75.52 C
ATOM 10168 CG PRO D 74 31.196 170.508 85.162 1.00 75.14 C
ATOM 10169 CD PRO D 74 30.627 169.632 84.072 1.00 75.20 C
ATOM 10170 N ASP D 75 32.066 173.876 82.889 1.00 77.48 N
ATOM 10171 CA ASP D 75 33.288 174.587 82.529 1.00 79.56 C
ATOM 10172 C ASP D 75 34.121 174.866 83.771 1.00 80.70 C
ATOM 10173 O ASP D 75 33.995 174.175 84.781 1.00 81.30 O
ATOM 10174 CB ASP D 75 32.964 175.919 81.847 1.00 79.47 C
ATOM 10175 CG ASP D 75 32.095 176.819 82.707 1.00 80.28 C
ATOM 10176 OD1 ASP D 75 32.146 176.693 83.953 1.00 79.61 O
ATOM 10177 OD2 ASP D 75 31.369 177.661 82.134 1.00 80.23 O
ATOM 10178 N GLU D 76 34.953 175.900 83.684 1.00 82.16 N
ATOM 10179 CA GLU D 76 35.831 176.318 84.774 1.00 84.00 C
ATOM 10180 C GLU D 76 35.081 176.738 86.046 1.00 83.90 C
ATOM 10181 O GLU D 76 35.578 176.554 87.157 1.00 83.16 O
ATOM 10182 CB GLU D 76 36.722 177.479 84.312 1.00 86.79 C
ATOM 10183 CG GLU D 76 37.710 177.156 83.173 1.00 91.26 C
ATOM 10184 CD GLU D 76 37.057 177.040 81.789 1.00 93.28 C
ATOM 10185 OE1 GLU D 76 36.362 177.993 81.364 1.00 94.48 O
ATOM 10186 OE2 GLU D 76 37.254 176.000 81.119 1.00 93.67 O
ATOM 10187 N ASN D 77 33.889 177.303 85.885 1.00 84.11 N
ATOM 10188 CA ASN D 77 33.096 177.744 87.032 1.00 84.19 C
ATOM 10189 C ASN D 77 32.104 176.677 87.471 1.00 83.43 C
ATOM 10190 O ASN D 77 31.345 176.881 88.419 1.00 83.40 O
ATOM 10191 CB ASN D 77 32.316 179.017 86.691 1.00 85.31 C
ATOM 10192 CG ASN D 77 33.190 180.092 86.086 1.00 86.96 C
ATOM 10193 OD1 ASN D 77 34.251 180.416 86.621 1.00 88.17 O
ATOM 10194 ND2 ASN D 77 32.746 180.660 84.965 1.00 87.71 N
ATOM 10195 N GLY D 78 32.111 175.542 86.781 1.00 82.07 N
ATOM 10196 CA GLY D 78 31.180 174.481 87.115 1.00 81.08 C
ATOM 10197 C GLY D 78 29.843 174.796 86.472 1.00 80.17 C
ATOM 10198 O GLY D 78 28.786 174.370 86.940 1.00 78.83 O
ATOM 10199 N GLU D 79 29.905 175.550 85.381 1.00 79.17 N
ATOM 10200 CA GLU D 79 28.715 175.959 84.655 1.00 78.64 C
ATOM 10201 C GLU D 79 28.521 175.162 83.382 1.00 76.29 C
ATOM 10202 O GLU D 79 29.492 174.786 82.728 1.00 75.99 O
ATOM 10203 CB GLU D 79 28.816 177.438 84.290 1.00 82.72 C
ATOM 10204 CG GLU D 79 28.726 178.391 85.468 1.00 87.74 C
ATOM 10205 CD GLU D 79 27.359 178.355 86.126 1.00 91.09 C
ATOM 10206 OE1 GLU D 79 27.127 179.149 87.066 1.00 92.66 O
ATOM 10207 OE2 GLU D 79 26.516 177.530 85.699 1.00 93.13 O
ATOM 10208 N LEU D 80 27.262 174.907 83.034 1.00 73.06 N
ATOM 10209 CA LEU D 80 26.951 174.185 81.807 1.00 69.30 C
ATOM 10210 C LEU D 80 26.836 175.220 80.702 1.00 67.40 C
ATOM 10211 O LEU D 80 26.308 176.308 80.916 1.00 67.36 O
ATOM 10212 CB LEU D 80 25.630 173.430 81.933 1.00 68.77 C
ATOM 10213 CG LEU D 80 25.590 172.246 82.899 1.00 68.52 C
ATOM 10214 CD1 LEU D 80 24.261 171.532 82.738 1.00 67.24 C
ATOM 10215 CD2 LEU D 80 26.747 171.287 82.617 1.00 67.98 C
ATOM 10216 N PHE D 81 27.330 174.890 79.520 1.00 64.66 N
ATOM 10217 CA PHE D 81 27.273 175.831 78.418 1.00 63.11 C
ATOM 10218 C PHE D 81 26.791 175.160 77.143 1.00 62.37 C
ATOM 10219 O PHE D 81 26.663 173.942 77.085 1.00 62.09 O
ATOM 10220 CB PHE D 81 28.654 176.446 78.195 1.00 62.90 C
ATOM 10221 CG PHE D 81 29.714 175.442 77.852 1.00 62.93 C
ATOM 10222 CD1 PHE D 81 29.879 175.006 76.544 1.00 62.93 C
ATOM 10223 CD2 PHE D 81 30.519 174.895 78.846 1.00 62.78 C
ATOM 10224 CE1 PHE D 81 30.830 174.037 76.229 1.00 63.20 C
ATOM 10225 CE2 PHE D 81 31.470 173.927 78.544 1.00 62.93 C
ATOM 10226 CZ PHE D 81 31.624 173.496 77.234 1.00 63.61 C
ATOM 10227 N MET D 82 26.521 175.966 76.125 1.00 61.34 N
ATOM 10228 CA MET D 82 26.059 175.455 74.845 1.00 60.08 C
ATOM 10229 C MET D 82 27.190 175.528 73.845 1.00 60.00 C
ATOM 10230 O MET D 82 28.079 176.367 73.960 1.00 61.41 O
ATOM 10231 CB MET D 82 24.894 176.281 74.315 1.00 58.89 C
ATOM 10232 CG MET D 82 23.632 176.158 75.109 1.00 59.33 C
ATOM 10233 SD MET D 82 23.003 174.481 75.178 1.00 64.09 S
ATOM 10234 CE MET D 82 22.889 174.253 76.934 1.00 62.92 C
ATOM 10235 N ARG D 83 27.144 174.649 72.854 1.00 58.63 N
ATOM 10236 CA ARG D 83 28.161 174.611 71.820 1.00 56.99 C
ATOM 10237 C ARG D 83 27.518 174.049 70.567 1.00 57.19 C
ATOM 10238 O ARG D 83 26.413 173.511 70.611 1.00 57.20 O
ATOM 10239 CB ARG D 83 29.311 173.695 72.246 1.00 55.32 C
ATOM 10240 CG ARG D 83 28.886 172.238 72.470 1.00 52.96 C
ATOM 10241 CD ARG D 83 30.071 171.345 72.798 1.00 51.62 C
ATOM 10242 NE ARG D 83 29.697 169.943 72.988 1.00 51.02 N
ATOM 10243 CZ ARG D 83 29.240 169.145 72.028 1.00 48.71 C
ATOM 10244 NH1 ARG D 83 29.098 169.601 70.792 1.00 49.50 N
ATOM 10245 NH2 ARG D 83 28.909 167.894 72.306 1.00 44.55 N
ATOM 10246 N PRO D 84 28.192 174.187 69.423 1.00 57.22 N
ATOM 10247 CA PRO D 84 27.633 173.651 68.180 1.00 56.49 C
ATOM 10248 C PRO D 84 27.884 172.135 68.154 1.00 55.98 C
ATOM 10249 O PRO D 84 28.880 171.658 68.712 1.00 56.93 O
ATOM 10250 CB PRO D 84 28.409 174.406 67.103 1.00 56.34 C
ATOM 10251 CG PRO D 84 29.744 174.629 67.743 1.00 57.08 C
ATOM 10252 CD PRO D 84 29.368 175.034 69.157 1.00 56.97 C
ATOM 10253 N GLY D 85 26.982 171.385 67.522 1.00 54.83 N
ATOM 10254 CA GLY D 85 27.120 169.938 67.457 1.00 52.19 C
ATOM 10255 C GLY D 85 28.328 169.387 66.712 1.00 50.31 C
ATOM 10256 O GLY D 85 28.926 170.063 65.867 1.00 48.62 O
ATOM 10257 N LYS D 86 28.669 168.141 67.041 1.00 48.62 N
ATOM 10258 CA LYS D 86 29.796 167.412 66.455 1.00 46.95 C
ATOM 10259 C LYS D 86 29.222 166.124 65.877 1.00 44.61 C
ATOM 10260 O LYS D 86 28.246 165.606 66.404 1.00 45.17 O
ATOM 10261 CB LYS D 86 30.812 167.023 67.539 1.00 49.40 C
ATOM 10262 CG LYS D 86 31.345 168.149 68.393 1.00 51.85 C
ATOM 10263 CD LYS D 86 32.266 167.590 69.461 1.00 56.44 C
ATOM 10264 CE LYS D 86 32.981 168.704 70.236 1.00 61.63 C
ATOM 10265 NZ LYS D 86 34.059 168.162 71.131 1.00 64.78 N
ATOM 10266 N ILE D 87 29.833 165.578 64.831 1.00 41.34 N
ATOM 10267 CA ILE D 87 29.304 164.356 64.258 1.00 39.35 C
ATOM 10268 C ILE D 87 29.159 163.221 65.282 1.00 41.38 C
ATOM 10269 O ILE D 87 28.384 162.278 65.073 1.00 41.82 O
ATOM 10270 CB ILE D 87 30.159 163.862 63.076 1.00 36.39 C
ATOM 10271 CG1 ILE D 87 31.589 163.615 63.523 1.00 35.54 C
ATOM 10272 CG2 ILE D 87 30.101 164.864 61.943 1.00 34.79 C
ATOM 10273 CD1 ILE D 87 32.469 163.055 62.418 1.00 33.71 C
ATOM 10274 N SER D 88 29.885 163.317 66.391 1.00 40.96 N
ATOM 10275 CA SER D 88 29.823 162.285 67.416 1.00 41.18 C
ATOM 10276 C SER D 88 28.598 162.444 68.310 1.00 40.93 C
ATOM 10277 O SER D 88 28.329 161.596 69.164 1.00 41.54 O
ATOM 10278 CB SER D 88 31.102 162.303 68.264 1.00 42.00 C
ATOM 10279 OG SER D 88 31.279 163.556 68.901 1.00 46.67 O
ATOM 10280 N ASP D 89 27.856 163.529 68.121 1.00 40.27 N
ATOM 10281 CA ASP D 89 26.649 163.758 68.911 1.00 40.91 C
ATOM 10282 C ASP D 89 25.476 162.965 68.352 1.00 42.26 C
ATOM 10283 O ASP D 89 25.368 162.737 67.138 1.00 44.39 O
ATOM 10284 CB ASP D 89 26.240 165.234 68.902 1.00 42.34 C
ATOM 10285 CG ASP D 89 27.150 166.114 69.745 1.00 44.44 C
ATOM 10286 OD1 ASP D 89 27.477 165.700 70.882 1.00 45.25 O
ATOM 10287 OD2 ASP D 89 27.517 167.226 69.277 1.00 41.70 O
ATOM 10288 N TYR D 90 24.579 162.561 69.240 1.00 41.60 N
ATOM 10289 CA TYR D 90 23.394 161.837 68.824 1.00 39.28 C
ATOM 10290 C TYR D 90 22.285 162.847 68.527 1.00 38.20 C
ATOM 10291 O TYR D 90 22.336 163.982 69.000 1.00 38.03 O
ATOM 10292 CB TYR D 90 22.973 160.876 69.928 1.00 39.09 C
ATOM 10293 CG TYR D 90 23.926 159.725 70.054 1.00 39.34 C
ATOM 10294 CD1 TYR D 90 25.161 159.885 70.688 1.00 38.75 C
ATOM 10295 CD2 TYR D 90 23.639 158.493 69.465 1.00 38.72 C
ATOM 10296 CE1 TYR D 90 26.097 158.849 70.729 1.00 36.18 C
ATOM 10297 CE2 TYR D 90 24.567 157.453 69.498 1.00 40.26 C
ATOM 10298 CZ TYR D 90 25.801 157.642 70.132 1.00 38.52 C
ATOM 10299 OH TYR D 90 26.739 156.631 70.130 1.00 40.05 O
ATOM 10300 N PHE D 91 21.300 162.451 67.725 1.00 36.63 N
ATOM 10301 CA PHE D 91 20.193 163.348 67.400 1.00 34.84 C
ATOM 10302 C PHE D 91 19.553 163.936 68.666 1.00 34.66 C
ATOM 10303 O PHE D 91 19.338 163.248 69.665 1.00 34.04 O
ATOM 10304 CB PHE D 91 19.155 162.615 66.547 1.00 33.40 C
ATOM 10305 CG PHE D 91 19.695 162.133 65.233 1.00 30.03 C
ATOM 10306 CD1 PHE D 91 20.875 162.661 64.725 1.00 28.78 C
ATOM 10307 CD2 PHE D 91 19.025 161.166 64.500 1.00 29.53 C
ATOM 10308 CE1 PHE D 91 21.379 162.239 63.512 1.00 29.24 C
ATOM 10309 CE2 PHE D 91 19.525 160.738 63.288 1.00 29.15 C
ATOM 10310 CZ PHE D 91 20.704 161.274 62.790 1.00 29.06 C
ATOM 10311 N PRO D 92 19.243 165.232 68.627 1.00 35.39 N
ATOM 10312 CA PRO D 92 18.643 166.036 69.694 1.00 35.14 C
ATOM 10313 C PRO D 92 17.286 165.555 70.137 1.00 37.00 C
ATOM 10314 O PRO D 92 16.423 165.268 69.315 1.00 39.49 O
ATOM 10315 CB PRO D 92 18.536 167.415 69.072 1.00 34.51 C
ATOM 10316 CG PRO D 92 19.470 167.380 67.909 1.00 37.13 C
ATOM 10317 CD PRO D 92 19.296 166.004 67.379 1.00 37.06 C
ATOM 10318 N LYS D 93 17.082 165.492 71.441 1.00 37.18 N
ATOM 10319 CA LYS D 93 15.797 165.067 71.955 1.00 38.15 C
ATOM 10320 C LYS D 93 14.919 166.300 71.898 1.00 37.70 C
ATOM 10321 O LYS D 93 15.370 167.395 72.202 1.00 38.23 O
ATOM 10322 CB LYS D 93 15.910 164.605 73.416 1.00 41.00 C
ATOM 10323 CG LYS D 93 16.909 163.490 73.681 1.00 44.39 C
ATOM 10324 CD LYS D 93 16.722 162.952 75.088 1.00 50.19 C
ATOM 10325 CE LYS D 93 17.616 161.758 75.367 1.00 52.80 C
ATOM 10326 NZ LYS D 93 19.029 162.202 75.465 1.00 55.39 N
ATOM 10327 N PRO D 94 13.652 166.146 71.509 1.00 38.11 N
ATOM 10328 CA PRO D 94 12.755 167.303 71.441 1.00 37.82 C
ATOM 10329 C PRO D 94 12.363 167.786 72.828 1.00 39.30 C
ATOM 10330 O PRO D 94 12.020 168.949 73.002 1.00 39.90 O
ATOM 10331 CB PRO D 94 11.553 166.766 70.681 1.00 36.03 C
ATOM 10332 CG PRO D 94 12.118 165.665 69.884 1.00 37.94 C
ATOM 10333 CD PRO D 94 13.043 164.987 70.849 1.00 37.96 C
ATOM 10334 N TYR D 95 12.404 166.883 73.807 1.00 40.37 N
ATOM 10335 CA TYR D 95 12.040 167.217 75.176 1.00 42.01 C
ATOM 10336 C TYR D 95 13.050 166.641 76.163 1.00 43.94 C
ATOM 10337 O TYR D 95 13.736 165.660 75.863 1.00 45.89 O
ATOM 10338 CB TYR D 95 10.655 166.663 75.505 1.00 42.48 C
ATOM 10339 CG TYR D 95 9.641 166.842 74.408 1.00 43.51 C
ATOM 10340 CD1 TYR D 95 9.314 165.787 73.551 1.00 44.25 C
ATOM 10341 CD2 TYR D 95 8.997 168.056 74.228 1.00 43.22 C
ATOM 10342 CE1 TYR D 95 8.363 165.942 72.543 1.00 44.77 C
ATOM 10343 CE2 TYR D 95 8.041 168.228 73.223 1.00 44.69 C
ATOM 10344 CZ TYR D 95 7.729 167.172 72.387 1.00 46.20 C
ATOM 10345 OH TYR D 95 6.783 167.353 71.405 1.00 46.86 O
ATOM 10346 N PRO D 96 13.139 167.234 77.366 1.00 44.14 N
ATOM 10347 CA PRO D 96 14.046 166.838 78.452 1.00 44.15 C
ATOM 10348 C PRO D 96 13.665 165.544 79.158 1.00 45.57 C
ATOM 10349 O PRO D 96 14.508 164.877 79.768 1.00 47.38 O
ATOM 10350 CB PRO D 96 13.975 168.020 79.411 1.00 45.34 C
ATOM 10351 CG PRO D 96 13.483 169.175 78.533 1.00 45.03 C
ATOM 10352 CD PRO D 96 12.464 168.501 77.688 1.00 43.42 C
ATOM 10353 N ASN D 97 12.390 165.188 79.080 1.00 46.00 N
ATOM 10354 CA ASN D 97 11.893 163.981 79.732 1.00 44.92 C
ATOM 10355 C ASN D 97 10.492 163.702 79.208 1.00 44.27 C
ATOM 10356 O ASN D 97 9.831 164.601 78.691 1.00 41.00 O
ATOM 10357 CB ASN D 97 11.851 164.206 81.237 1.00 45.36 C
ATOM 10358 CG ASN D 97 11.110 165.468 81.595 1.00 46.94 C
ATOM 10359 OD1 ASN D 97 9.877 165.519 81.539 1.00 46.58 O
ATOM 10360 ND2 ASN D 97 11.858 166.516 81.930 1.00 47.22 N
ATOM 10361 N PRO D 98 10.015 162.453 79.348 1.00 45.18 N
ATOM 10362 CA PRO D 98 8.678 162.116 78.858 1.00 46.18 C
ATOM 10363 C PRO D 98 7.577 162.989 79.456 1.00 46.23 C
ATOM 10364 O PRO D 98 6.583 163.265 78.792 1.00 46.43 O
ATOM 10365 CB PRO D 98 8.550 160.622 79.192 1.00 45.81 C
ATOM 10366 CG PRO D 98 9.427 160.459 80.373 1.00 44.35 C
ATOM 10367 CD PRO D 98 10.624 161.302 80.036 1.00 44.93 C
ATOM 10368 N GLU D 99 7.761 163.437 80.695 1.00 46.60 N
ATOM 10369 CA GLU D 99 6.770 164.304 81.331 1.00 46.77 C
ATOM 10370 C GLU D 99 6.570 165.546 80.463 1.00 46.02 C
ATOM 10371 O GLU D 99 5.443 165.925 80.156 1.00 47.61 O
ATOM 10372 CB GLU D 99 7.225 164.747 82.729 1.00 48.51 C
ATOM 10373 CG GLU D 99 7.156 163.699 83.837 1.00 49.91 C
ATOM 10374 CD GLU D 99 8.124 162.532 83.632 1.00 53.65 C
ATOM 10375 OE1 GLU D 99 9.267 162.748 83.156 1.00 55.85 O
ATOM 10376 OE2 GLU D 99 7.745 161.391 83.970 1.00 54.30 O
ATOM 10377 N ALA D 100 7.666 166.186 80.076 1.00 44.02 N
ATOM 10378 CA ALA D 100 7.580 167.376 79.237 1.00 43.52 C
ATOM 10379 C ALA D 100 6.940 167.015 77.886 1.00 43.64 C
ATOM 10380 O ALA D 100 6.123 167.748 77.346 1.00 43.73 O
ATOM 10381 CB ALA D 100 8.976 167.954 79.026 1.00 41.74 C
ATOM 10382 N ALA D 101 7.320 165.862 77.358 1.00 43.73 N
ATOM 10383 CA ALA D 101 6.816 165.385 76.088 1.00 42.24 C
ATOM 10384 C ALA D 101 5.308 165.290 76.112 1.00 41.59 C
ATOM 10385 O ALA D 101 4.635 165.832 75.237 1.00 41.47 O
ATOM 10386 CB ALA D 101 7.408 164.025 75.784 1.00 42.38 C
ATOM 10387 N ARG D 102 4.781 164.580 77.108 1.00 40.78 N
ATOM 10388 CA ARG D 102 3.334 164.403 77.245 1.00 39.47 C
ATOM 10389 C ARG D 102 2.704 165.763 77.411 1.00 38.94 C
ATOM 10390 O ARG D 102 1.686 166.082 76.795 1.00 38.29 O
ATOM 10391 CB ARG D 102 3.007 163.553 78.470 1.00 37.73 C
ATOM 10392 CG ARG D 102 3.331 162.090 78.305 1.00 40.84 C
ATOM 10393 CD ARG D 102 3.029 161.323 79.580 1.00 42.05 C
ATOM 10394 NE ARG D 102 3.327 159.894 79.459 1.00 44.90 N
ATOM 10395 CZ ARG D 102 2.722 159.068 78.603 1.00 46.06 C
ATOM 10396 NH1 ARG D 102 1.781 159.524 77.784 1.00 45.84 N
ATOM 10397 NH2 ARG D 102 3.051 157.780 78.564 1.00 45.86 N
ATOM 10398 N ALA D 103 3.340 166.567 78.250 1.00 38.41 N
ATOM 10399 CA ALA D 103 2.876 167.904 78.536 1.00 38.36 C
ATOM 10400 C ALA D 103 2.679 168.709 77.256 1.00 39.54 C
ATOM 10401 O ALA D 103 1.823 169.597 77.203 1.00 41.10 O
ATOM 10402 CB ALA D 103 3.868 168.597 79.441 1.00 36.09 C
ATOM 10403 N ALA D 104 3.459 168.395 76.226 1.00 37.45 N
ATOM 10404 CA ALA D 104 3.378 169.126 74.977 1.00 35.92 C
ATOM 10405 C ALA D 104 2.605 168.364 73.926 1.00 37.66 C
ATOM 10406 O ALA D 104 2.631 168.736 72.754 1.00 40.38 O
ATOM 10407 CB ALA D 104 4.764 169.413 74.477 1.00 34.20 C
ATOM 10408 N ASN D 105 1.920 167.300 74.333 1.00 37.54 N
ATOM 10409 CA ASN D 105 1.160 166.487 73.395 1.00 37.56 C
ATOM 10410 C ASN D 105 -0.118 165.935 73.998 1.00 40.04 C
ATOM 10411 O ASN D 105 -0.534 164.816 73.707 1.00 39.55 O
ATOM 10412 CB ASN D 105 2.043 165.360 72.874 1.00 36.48 C
ATOM 10413 CG ASN D 105 3.113 165.864 71.924 1.00 37.44 C
ATOM 10414 OD1 ASN D 105 2.832 166.125 70.752 1.00 40.42 O
ATOM 10415 ND2 ASN D 105 4.339 166.033 72.426 1.00 33.74 N
ATOM 10416 N ASN D 106 -0.737 166.735 74.855 1.00 42.92 N
ATOM 10417 CA ASN D 106 -1.989 166.353 75.489 1.00 45.02 C
ATOM 10418 C ASN D 106 -1.933 165.056 76.251 1.00 43.04 C
ATOM 10419 O ASN D 106 -2.820 164.223 76.129 1.00 43.71 O
ATOM 10420 CB ASN D 106 -3.094 166.277 74.441 1.00 50.08 C
ATOM 10421 CG ASN D 106 -3.152 167.525 73.590 1.00 57.06 C
ATOM 10422 OD1 ASN D 106 -3.353 168.632 74.110 1.00 60.31 O
ATOM 10423 ND2 ASN D 106 -2.954 167.365 72.273 1.00 60.02 N
ATOM 10424 N GLY D 107 -0.883 164.883 77.034 1.00 41.92 N
ATOM 10425 CA GLY D 107 -0.773 163.685 77.839 1.00 40.11 C
ATOM 10426 C GLY D 107 -0.281 162.482 77.082 1.00 39.11 C
ATOM 10427 O GLY D 107 -0.034 161.440 77.690 1.00 40.95 O
ATOM 10428 N ALA D 108 -0.142 162.608 75.766 1.00 35.82 N
ATOM 10429 CA ALA D 108 0.339 161.497 74.959 1.00 33.26 C
ATOM 10430 C ALA D 108 1.859 161.584 74.827 1.00 33.33 C
ATOM 10431 O ALA D 108 2.443 162.675 74.762 1.00 32.28 O
ATOM 10432 CB ALA D 108 -0.312 161.518 73.586 1.00 31.00 C
ATOM 10433 N LEU D 109 2.491 160.415 74.782 1.00 33.49 N
ATOM 10434 CA LEU D 109 3.945 160.315 74.676 1.00 31.31 C
ATOM 10435 C LEU D 109 4.450 159.795 73.320 1.00 29.80 C
ATOM 10436 O LEU D 109 4.329 158.608 73.013 1.00 29.76 O
ATOM 10437 CB LEU D 109 4.456 159.411 75.796 1.00 30.89 C
ATOM 10438 CG LEU D 109 5.942 159.062 75.856 1.00 30.23 C
ATOM 10439 CD1 LEU D 109 6.776 160.321 75.874 1.00 30.77 C
ATOM 10440 CD2 LEU D 109 6.197 158.230 77.084 1.00 27.25 C
ATOM 10441 N PRO D 110 5.005 160.688 72.482 1.00 27.72 N
ATOM 10442 CA PRO D 110 5.503 160.214 71.185 1.00 26.41 C
ATOM 10443 C PRO D 110 6.741 159.368 71.449 1.00 27.59 C
ATOM 10444 O PRO D 110 7.740 159.863 71.965 1.00 28.81 O
ATOM 10445 CB PRO D 110 5.824 161.506 70.428 1.00 24.48 C
ATOM 10446 CG PRO D 110 6.052 162.519 71.541 1.00 26.12 C
ATOM 10447 CD PRO D 110 5.060 162.157 72.593 1.00 24.63 C
ATOM 10448 N PRO D 111 6.698 158.077 71.092 1.00 26.62 N
ATOM 10449 CA PRO D 111 7.838 157.174 71.311 1.00 26.21 C
ATOM 10450 C PRO D 111 9.128 157.495 70.520 1.00 27.47 C
ATOM 10451 O PRO D 111 9.088 158.093 69.435 1.00 28.66 O
ATOM 10452 CB PRO D 111 7.269 155.814 70.921 1.00 18.63 C
ATOM 10453 CG PRO D 111 6.434 156.161 69.782 1.00 24.84 C
ATOM 10454 CD PRO D 111 5.716 157.456 70.192 1.00 24.45 C
ATOM 10455 N ASP D 112 10.271 157.089 71.075 1.00 27.49 N
ATOM 10456 CA ASP D 112 11.553 157.276 70.408 1.00 27.52 C
ATOM 10457 C ASP D 112 11.442 156.411 69.148 1.00 26.75 C
ATOM 10458 O ASP D 112 10.843 155.344 69.196 1.00 27.75 O
ATOM 10459 CB ASP D 112 12.687 156.790 71.323 1.00 25.79 C
ATOM 10460 CG ASP D 112 14.057 156.927 70.685 1.00 28.86 C
ATOM 10461 OD1 ASP D 112 14.482 155.971 69.974 1.00 28.25 O
ATOM 10462 OD2 ASP D 112 14.696 157.995 70.885 1.00 23.77 O
ATOM 10463 N LEU D 113 12.000 156.842 68.026 1.00 24.78 N
ATOM 10464 CA LEU D 113 11.853 156.037 66.816 1.00 26.66 C
ATOM 10465 C LEU D 113 13.019 155.149 66.389 1.00 27.45 C
ATOM 10466 O LEU D 113 12.928 154.469 65.376 1.00 27.77 O
ATOM 10467 CB LEU D 113 11.457 156.942 65.658 1.00 24.44 C
ATOM 10468 CG LEU D 113 10.186 157.688 66.014 1.00 24.04 C
ATOM 10469 CD1 LEU D 113 9.928 158.721 64.979 1.00 26.38 C
ATOM 10470 CD2 LEU D 113 9.020 156.702 66.118 1.00 26.73 C
ATOM 10471 N SER D 114 14.091 155.131 67.168 1.00 28.42 N
ATOM 10472 CA SER D 114 15.264 154.324 66.838 1.00 28.90 C
ATOM 10473 C SER D 114 14.948 152.878 66.479 1.00 28.75 C
ATOM 10474 O SER D 114 15.525 152.331 65.536 1.00 28.67 O
ATOM 10475 CB SER D 114 16.256 154.332 68.006 1.00 28.95 C
ATOM 10476 OG SER D 114 16.613 155.655 68.352 1.00 32.83 O
ATOM 10477 N TYR D 115 14.051 152.251 67.236 1.00 28.45 N
ATOM 10478 CA TYR D 115 13.705 150.853 66.985 1.00 28.70 C
ATOM 10479 C TYR D 115 12.212 150.675 66.683 1.00 29.80 C
ATOM 10480 O TYR D 115 11.687 149.559 66.732 1.00 29.58 O
ATOM 10481 CB TYR D 115 14.071 149.998 68.215 1.00 29.52 C
ATOM 10482 CG TYR D 115 15.557 149.903 68.517 1.00 30.45 C
ATOM 10483 CD1 TYR D 115 16.125 150.576 69.608 1.00 28.37 C
ATOM 10484 CD2 TYR D 115 16.397 149.153 67.695 1.00 29.75 C
ATOM 10485 CE1 TYR D 115 17.492 150.497 69.867 1.00 31.51 C
ATOM 10486 CE2 TYR D 115 17.757 149.075 67.938 1.00 33.34 C
ATOM 10487 CZ TYR D 115 18.309 149.738 69.020 1.00 34.35 C
ATOM 10488 OH TYR D 115 19.671 149.596 69.244 1.00 36.88 O
ATOM 10489 N ILE D 116 11.530 151.757 66.331 1.00 29.51 N
ATOM 10490 CA ILE D 116 10.105 151.652 66.126 1.00 28.69 C
ATOM 10491 C ILE D 116 9.638 150.591 65.118 1.00 30.17 C
ATOM 10492 O ILE D 116 8.630 149.892 65.378 1.00 30.85 O
ATOM 10493 CB ILE D 116 9.501 153.041 65.825 1.00 27.12 C
ATOM 10494 CG1 ILE D 116 7.991 152.996 66.038 1.00 26.03 C
ATOM 10495 CG2 ILE D 116 9.867 153.489 64.453 1.00 28.59 C
ATOM 10496 CD1 ILE D 116 7.599 152.752 67.491 1.00 17.81 C
ATOM 10497 N VAL D 117 10.346 150.419 63.999 1.00 28.23 N
ATOM 10498 CA VAL D 117 9.897 149.402 63.053 1.00 27.11 C
ATOM 10499 C VAL D 117 10.086 147.995 63.598 1.00 26.91 C
ATOM 10500 O VAL D 117 9.541 147.049 63.066 1.00 28.34 O
ATOM 10501 CB VAL D 117 10.581 149.492 61.673 1.00 26.34 C
ATOM 10502 CG1 VAL D 117 10.365 150.862 61.084 1.00 25.97 C
ATOM 10503 CG2 VAL D 117 12.037 149.164 61.778 1.00 25.29 C
ATOM 10504 N ASN D 118 10.857 147.841 64.664 1.00 27.81 N
ATOM 10505 CA ASN D 118 11.036 146.507 65.238 1.00 26.93 C
ATOM 10506 C ASN D 118 10.189 146.357 66.490 1.00 26.70 C
ATOM 10507 O ASN D 118 9.948 145.245 66.944 1.00 28.86 O
ATOM 10508 CB ASN D 118 12.507 146.232 65.578 1.00 25.07 C
ATOM 10509 CG ASN D 118 13.322 145.826 64.364 1.00 24.00 C
ATOM 10510 OD1 ASN D 118 12.780 145.564 63.306 1.00 27.34 O
ATOM 10511 ND2 ASN D 118 14.627 145.767 64.518 1.00 25.66 N
ATOM 10512 N ALA D 119 9.720 147.478 67.026 1.00 26.07 N
ATOM 10513 CA ALA D 119 8.913 147.479 68.242 1.00 26.67 C
ATOM 10514 C ALA D 119 7.417 147.396 67.961 1.00 27.10 C
ATOM 10515 O ALA D 119 6.600 147.480 68.874 1.00 29.28 O
ATOM 10516 CB ALA D 119 9.221 148.739 69.051 1.00 23.33 C
ATOM 10517 N ARG D 120 7.062 147.247 66.696 1.00 27.95 N
ATOM 10518 CA ARG D 120 5.669 147.169 66.292 1.00 27.27 C
ATOM 10519 C ARG D 120 5.486 146.046 65.301 1.00 28.49 C
ATOM 10520 O ARG D 120 6.289 145.894 64.367 1.00 27.68 O
ATOM 10521 CB ARG D 120 5.259 148.461 65.608 1.00 29.55 C
ATOM 10522 CG ARG D 120 5.221 149.645 66.522 1.00 28.74 C
ATOM 10523 CD ARG D 120 4.084 149.505 67.463 1.00 27.40 C
ATOM 10524 NE ARG D 120 3.929 150.714 68.237 1.00 31.41 N
ATOM 10525 CZ ARG D 120 4.785 151.099 69.170 1.00 28.02 C
ATOM 10526 NH1 ARG D 120 5.841 150.348 69.432 1.00 27.58 N
ATOM 10527 NH2 ARG D 120 4.594 152.242 69.808 1.00 25.09 N
ATOM 10528 N HIS D 121 4.440 145.251 65.497 1.00 27.98 N
ATOM 10529 CA HIS D 121 4.174 144.172 64.568 1.00 26.73 C
ATOM 10530 C HIS D 121 3.879 144.830 63.247 1.00 26.52 C
ATOM 10531 O HIS D 121 3.174 145.830 63.211 1.00 30.99 O
ATOM 10532 CB HIS D 121 2.974 143.369 65.013 1.00 27.75 C
ATOM 10533 CG HIS D 121 3.284 142.376 66.082 1.00 30.87 C
ATOM 10534 ND1 HIS D 121 2.906 142.551 67.395 1.00 33.29 N
ATOM 10535 CD2 HIS D 121 3.904 141.174 66.026 1.00 31.93 C
ATOM 10536 CE1 HIS D 121 3.274 141.497 68.103 1.00 32.89 C
ATOM 10537 NE2 HIS D 121 3.881 140.647 67.295 1.00 32.76 N
ATOM 10538 N GLY D 122 4.432 144.301 62.166 1.00 25.86 N
ATOM 10539 CA GLY D 122 4.183 144.883 60.859 1.00 26.48 C
ATOM 10540 C GLY D 122 5.283 145.807 60.364 1.00 27.44 C
ATOM 10541 O GLY D 122 5.302 146.175 59.173 1.00 29.52 O
ATOM 10542 N GLY D 123 6.184 146.197 61.264 1.00 23.97 N
ATOM 10543 CA GLY D 123 7.283 147.063 60.882 1.00 25.19 C
ATOM 10544 C GLY D 123 6.908 148.237 60.003 1.00 26.98 C
ATOM 10545 O GLY D 123 5.933 148.929 60.283 1.00 23.99 O
ATOM 10546 N GLU D 124 7.672 148.465 58.930 1.00 30.20 N
ATOM 10547 CA GLU D 124 7.365 149.587 58.045 1.00 32.34 C
ATOM 10548 C GLU D 124 6.002 149.425 57.398 1.00 32.29 C
ATOM 10549 O GLU D 124 5.366 150.414 57.050 1.00 34.52 O
ATOM 10550 CB GLU D 124 8.442 149.793 56.964 1.00 33.54 C
ATOM 10551 CG GLU D 124 8.922 148.544 56.251 1.00 35.74 C
ATOM 10552 CD GLU D 124 10.088 147.894 56.973 1.00 36.94 C
ATOM 10553 OE1 GLU D 124 9.894 147.455 58.128 1.00 37.61 O
ATOM 10554 OE2 GLU D 124 11.195 147.831 56.394 1.00 34.74 O
ATOM 10555 N ASP D 125 5.536 148.192 57.241 1.00 32.23 N
ATOM 10556 CA ASP D 125 4.216 148.000 56.648 1.00 32.60 C
ATOM 10557 C ASP D 125 3.180 148.655 57.554 1.00 30.94 C
ATOM 10558 O ASP D 125 2.211 149.241 57.093 1.00 31.48 O
ATOM 10559 CB ASP D 125 3.898 146.515 56.498 1.00 34.22 C
ATOM 10560 CG ASP D 125 4.457 145.912 55.214 1.00 36.77 C
ATOM 10561 OD1 ASP D 125 4.478 144.666 55.133 1.00 40.11 O
ATOM 10562 OD2 ASP D 125 4.860 146.654 54.287 1.00 36.40 O
ATOM 10563 N TYR D 126 3.406 148.569 58.853 1.00 28.83 N
ATOM 10564 CA TYR D 126 2.491 149.161 59.797 1.00 27.81 C
ATOM 10565 C TYR D 126 2.691 150.652 59.908 1.00 27.99 C
ATOM 10566 O TYR D 126 1.723 151.386 59.998 1.00 31.03 O
ATOM 10567 CB TYR D 126 2.671 148.538 61.179 1.00 26.43 C
ATOM 10568 CG TYR D 126 2.019 149.341 62.274 1.00 25.20 C
ATOM 10569 CD1 TYR D 126 0.625 149.385 62.397 1.00 24.64 C
ATOM 10570 CD2 TYR D 126 2.790 150.105 63.161 1.00 22.80 C
ATOM 10571 CE1 TYR D 126 0.015 150.169 63.376 1.00 23.82 C
ATOM 10572 CE2 TYR D 126 2.190 150.891 64.134 1.00 22.44 C
ATOM 10573 CZ TYR D 126 0.806 150.914 64.234 1.00 24.09 C
ATOM 10574 OH TYR D 126 0.207 151.684 65.199 1.00 31.63 O
ATOM 10575 N VAL D 127 3.937 151.112 59.918 1.00 28.60 N
ATOM 10576 CA VAL D 127 4.190 152.549 60.048 1.00 29.77 C
ATOM 10577 C VAL D 127 3.659 153.267 58.805 1.00 31.56 C
ATOM 10578 O VAL D 127 3.082 154.360 58.904 1.00 32.38 O
ATOM 10579 CB VAL D 127 5.720 152.858 60.279 1.00 27.52 C
ATOM 10580 CG1 VAL D 127 5.966 154.354 60.405 1.00 21.42 C
ATOM 10581 CG2 VAL D 127 6.187 152.191 61.548 1.00 25.85 C
ATOM 10582 N PHE D 128 3.825 152.639 57.645 1.00 31.07 N
ATOM 10583 CA PHE D 128 3.333 153.227 56.410 1.00 32.96 C
ATOM 10584 C PHE D 128 1.800 153.297 56.395 1.00 33.99 C
ATOM 10585 O PHE D 128 1.220 154.329 56.049 1.00 35.45 O
ATOM 10586 CB PHE D 128 3.793 152.427 55.202 1.00 32.25 C
ATOM 10587 CG PHE D 128 3.517 153.118 53.900 1.00 34.79 C
ATOM 10588 CD1 PHE D 128 4.344 154.154 53.459 1.00 35.87 C
ATOM 10589 CD2 PHE D 128 2.413 152.764 53.126 1.00 34.69 C
ATOM 10590 CE1 PHE D 128 4.076 154.826 52.263 1.00 35.90 C
ATOM 10591 CE2 PHE D 128 2.137 153.427 51.934 1.00 35.26 C
ATOM 10592 CZ PHE D 128 2.970 154.460 51.501 1.00 35.80 C
ATOM 10593 N SER D 129 1.146 152.197 56.753 1.00 32.21 N
ATOM 10594 CA SER D 129 -0.300 152.169 56.788 1.00 31.80 C
ATOM 10595 C SER D 129