PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2020-10-23
Number of transmembrane proteins: 5446 (alpha: 4947 , beta: 462 )
Protein Structure
Sequence
Chain:

EKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFKRIVLFDTLGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALK
Downloads
Cross references