PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2020-02-07
Number of transmembrane proteins: 4820 (alpha: 4336 , beta: 454 )
Protein Structure
Sequence
Chain:

KLQLSRAKLKASSKTSALLSGFAMVAMVEVQMLIAFAICTTLLVAVHMLALMISTCILPNHWYIETAWAFSTLLGLILFLLEIAILCWVKFYDLSPPAAWSATVVLILVMIIFMAFAIHFYRSLVSHKYEVTVSGIRELEMLKEQMEQDH
Downloads
Cross references