PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2022-11-25
Number of transmembrane proteins: 7918 (alpha: 7391 , beta: 522 )
Protein Structure
Sequence
Chain:

MIKSLFAVIIGGSVGCTLRWLLSTKFNSLFPNLPPGTLVVNLLAGLIIGTALAYFLRQPHLDPFWKLMITTGLCGGLSTISTFSVEVFALLQAGNYIWALTSVLVHVIGSLIMTALGFFIITILFA
Downloads
Cross references