PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2020-05-29
Number of transmembrane proteins: 5074 (alpha: 4584 , beta: 459 )
Protein Structure
Sequence
Chain:

MENFLAQQGKITLILTALCVLIYIAQQLGFEDDIMYLMHYPAYEEQDSEVWRYISHTLVHLSNLHILFNLSWFFIFGGMIERTFGSVKLLMLYVVASAITGYVQNYVSGPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVEMGNAAHISGLIVGLIWGFIDSKLRKNSLELVPR
Downloads
Cross references