PDBTM: Protein Data Bank of Transmembrane Proteins
PDBTM version: 2022-01-14
Number of transmembrane proteins: 6792 (alpha: 6254 , beta: 484 )
Protein Structure
Sequence
Chain:

MSGSHHHHHHSSGIEGRGRLIKHMPPMLSGLLARLVKLLLGRHGSALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAALISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQERRGHFVRHSEKA
Downloads
Cross references